EMBL-EBI Now and in the Future

Total Page:16

File Type:pdf, Size:1020Kb

Load more

SureChEMBL: Open Patent Data Chemaxon UGM, Budapest 21/05/2014 Mark Davies ChEMBL Group, EMBL-EBI EMBL-EBI Resources Genes, genomes & variation European Nucleotide Ensembl European Genome-phenome Archive Archive Ensembl Genomes Metagenomics portal 1000 Genomes Gene, protein & metabolite expression ArrayExpress Metabolights Expression Atlas PRIDE Literature & Protein sequences, families & motifs ontologies InterPro Pfam UniProt Europe PubMed Central Gene Ontology Experimental Factor Molecular structures Ontology Protein Data Bank in Europe Electron Microscopy Data Bank Chemical biology ChEMBL ChEBI Reactions, interactions & pathways Systems BioModels BioSamples IntAct Reactome MetaboLights Enzyme Portal ChEMBL – Data for Drug Discovery 1. Scientific facts 3. Insight, tools and resources for translational drug discovery >Thrombin MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQARSLLQRVRRANTFLEEVRKGNLE Compound RECVEETCSYEEAFEALESSTATDVFWAKYTACETARTPRDKLAACLEGNCAEGLGT NYRGHVNITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYT TDPTVRRQECSIPVCGQDQVTVAMTPRSEGSSVNLSPPLEQCVPDRGQQYQGRLAVT THGLPCLAWASAQAKALSKHQDFNSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFGY CDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLF EKKSLEDKTERELLESYIDGRIVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDR WVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWR ENLDRDIALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETWTA NVGKGQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG Ki = 4.5nM PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQFGE Bioactivity data Assay/Target APTT = 11 min. 2. Organization, integration, curation and standardization of pharmacology data Patent Data • Do we include patent data in the ChEMBL database? • We do provide cross-references (UniChem), but not the underlying chemical data • Most common question asked about ChEMBL during training and outreach • Why is this important to Drug Discovery researchers? • Patent literature 2-3 years ahead of published literature • Prior art and freedom to operate • Lots more data – but high cost to extract + lots of noisy data SureChem = SureChEMBL • December 2013 EMBL-EBI acquired SureChem – a leading ‘chemistry patent mining’ product from Digital Science, Macmillan Group • SureChem not aligned with core future academic business • SureChem provides a live (updated daily) view chemical patent space • Existing SureChem User base • Free (SureChemOpen) • Paying (SureChemPro + API) • EMBL-EBI will support existing licensees - All have expired now • EMBL-EBI will provide an ongoing, free and open resource to entire community • Rebranded SureChEMBL EMBL-EBI Chemistry Resources RDF and REST API interfaces Atlas PDBe ChEBI ChEMBL SureChEMBL 3rd Party Data ZINC, PubChem, ThomsonPharma Ligand Ligand Nomenclature Bioactivity Ligand DOTF, IUPHAR, DrugBank, KEGG, induced structures of primary and data from structures NIH NCC, transcript from secondary literature from patent eMolecules, FDA response structurally metabolites. and literature SRS, PharmGKB, defined Chemical depositions Selleck, …. protein Ontology complexes 750 15K 24K 1.5M 15M ~55M UniChem – InChI-based chemical resolver (full + relaxed ‘lenses’) >70M REST API Interface SureChEMBL System Filter by authority Patent number Keyword search search Types of chemistry Structure search Filter sketch by date Paste SMILES, Filter by document MOL, name section Help https://www.surechembl.org/ SureChEMBL System SureChEMBL System SureChEMBL System Data Export and View Patent Family SureChEMBL System SureChEMBL API Access System Capabilities • Searching capabilities • Free text keywords and Lucene fields • Patent IDs & bibliographic information • Patent authority & date • Chemical structure • Retrieving capabilities • Retrieve chemistry (with additional filters) • Retrieve patent family information • Retrieve annotated full patent text • Accessible via Web Interface and API SureChEMBL Data Coverage Data Description & Languages Years Bib. data DocDB + Original EP applications from 1978 Full text Original (EN, DE, FR) Bib. data DocDB + Original EP granted From 1980 Full text Original (EN, DE, FR) Bib. data DocDB + Original From 1978 WO applications Full text Original (EN, DE, FR, ES, RU) From 1978 Bib. data DocDB + Original From 2001 US applications Full text Original (EN) From 2001 Bib. data DocDB + Original From 1920 US granted Full text Original (EN) From 1976 Bib. data DocDB From 1973 JP applications Full text PAJ - English abstracts/titles From 1976 JP granted Bib. data DocDB From 1994 90+ countries Bib. data DocDB From 1920 All patents from above data sources are searchable via SureChEMBL SureChEMBL Chemistry Data Coverage • Exemplified structures from patent title, description, abstract and claims • Structures from text 1976 onwards • Structures from images 2007 onwards • USPTO have provided ‘Complex Work Units’ since 2001 • CWU file types include MOL and CDX • CWUs processed as part of pipeline SureChEMBL Data Processing SureChEMBL System Patent Offices 1-[4-ethoxy-3-(6,7-dihydro-1-methyl-7-oxo-3-propyl- Chemistry 1H-pyrazolo[4,3-d]pyrimidin-5-yl)phenylsulfonyl]-4- WO methylpiperazine Database SureChem IP Name to EP Entity OCR Applications Recognition Structure & Granted Processed (five methods) patents Database US (service) Image to Applications & granted Structure (one method) Patent JP Application API PDFs Abstracts Server (service) Users SureChEMBL and Chemaxon SureChEMBL System Patent Offices Chemistry WO Database SureChem IP Name to EP Entity OCR Applications Recognition Structure & Granted Processed (five methods) patents Database US (service) Image to Applications & granted Structure (one method) Patent JP Application API PDFs Abstracts Server (service) Users ChEMBL Overlap • InChI based comparison using filtered parent compounds SureChEMBL ChEMBL 235K 1.3M 18.4% 12.2M (ChEMBL 18) (Exported 08/05/14) Filters • MW between 100 and 1200 • #Atoms between 6 and 70 • ALogP between -10 and 10 • #Rings > 0 • #C > 0 • #C != #Atoms • RTB <= 20 SureChEMBL and UniChem • 12.2M SureChEMBL compounds are being loaded into UniChem - InChI based ‘Unified Chemical Identifier' system • SureChem drug-like subset (~5M) previously loaded • Other UniChem sources include: https://www.ebi.ac.uk/unichem/ Migration Status • System currently built and optimised to run on Amazon Web Services • The time and cost considered too high to move away from AWS in short term • Long term plan will be to migrate on to EBI infrastructure • 3 Phase migration process 1. Patent Data Server (IFI Claims/Fairview) – done 2. Data Processing Pipeline – done 3. Web Application/API – working in progress Technical Challenges • User account migration • System currently uses Digital Science authentication system • User account required by Pro account service • Plan to move over open system e.g. OAuth/OpenID • We aim to minimise impact on existing user, but may require users to sign-up again • Impact of providing free and open access to the Pro account service and API • Need to monitor usage • Usage limitations may be required Entity Extraction Enhanced Entity Extraction • Identify new entity types e.g. proteins, diseases, cell lines, assays.. • Extend using ChEMBL dictionaries + others • Ontology mapping/Semantic tagging • Protein/biotherapeutic sequence extraction • Sequence based patent searches • Currently system provides minimal cross referencing • Quickly enhance using UniChem • Tag up all commonly used identifiers (ChEBI, ChEMBL, PubChem, UniProt,…) Bioactivity Data Extraction? Compounds Target/Assay Bioactivity Markush Structure Extraction? -alkyl -aryl -heteroaryl -heterocyclyl -cycloalkyl …. Image Processing • Image extraction starts from 01/01/2007 • Use Amazon EC2 Spot Instances to process pre-2007 image data • Spot instance significantly cheaper, e.g. m1.xlarge instance costs: • Standard Cost = $0.52/hour • Spot Instance Cost = ~$0.125/hour Image Processing • New methods and tools can be introduced to improve compound image extraction • System currently uses CLiDE, alternatives include OSRA and Imago • Document segmentation, developed as part of curation system, could be applied to complex patent images Open PHACTS Extension • Open PHACTS project is keen to include patent data in future extensions to the project • ENSO approved - funding to include SureChEMBL data in Open PHACTS • RDF conversion, target indexing and API development • EBI-RDF project benefit from RDF conversion • SureChEMBL is updated daily, compared to quarterly ChEMBL updates • Interesting challenge for us creating exports and systems loading SureChEMBL More Future Plans • Refactor interface for EMBL look and feel • Third party user support system migration • Workflow tool enhancements • Update and release existing KNIME protocols + Pipeline Pilot • Lots of interest to bring the system in-house for internal document processing and searching • Complex licensing issues • AWS setup makes this easier • Ligand Ensemble-based mapping of ChEMBL literature to patents • Provide weekly/monthly feed of patent structures to PubChem Rebranding Complete People and Groups Involved The ChEMBL Group Digital Science • John Overington • Nicko Goncharoff • Mark Davies • James Siddle • George Papadatos • Richard Koks • Jon Chambers • Tom Llewellyn • Anne Hersey ChEMBL 18 Released Website Web Virtual Services 1,359,508 compounds 12,419,715 activities Machine 1,042,374 assays 9,414 targets 53,298 documents 19 bioactivity sources Semantic Widgets Web Downloads https://www.ebi.ac.uk/chembl/ myChEMBL Update Coming Soon http://chembl.blogspot.co.uk/ .
Recommended publications
  • Cryptic Inoviruses Revealed As Pervasive in Bacteria and Archaea Across Earth’S Biomes

    Cryptic Inoviruses Revealed As Pervasive in Bacteria and Archaea Across Earth’S Biomes

    ARTICLES https://doi.org/10.1038/s41564-019-0510-x Corrected: Author Correction Cryptic inoviruses revealed as pervasive in bacteria and archaea across Earth’s biomes Simon Roux 1*, Mart Krupovic 2, Rebecca A. Daly3, Adair L. Borges4, Stephen Nayfach1, Frederik Schulz 1, Allison Sharrar5, Paula B. Matheus Carnevali 5, Jan-Fang Cheng1, Natalia N. Ivanova 1, Joseph Bondy-Denomy4,6, Kelly C. Wrighton3, Tanja Woyke 1, Axel Visel 1, Nikos C. Kyrpides1 and Emiley A. Eloe-Fadrosh 1* Bacteriophages from the Inoviridae family (inoviruses) are characterized by their unique morphology, genome content and infection cycle. One of the most striking features of inoviruses is their ability to establish a chronic infection whereby the viral genome resides within the cell in either an exclusively episomal state or integrated into the host chromosome and virions are continuously released without killing the host. To date, a relatively small number of inovirus isolates have been extensively studied, either for biotechnological applications, such as phage display, or because of their effect on the toxicity of known bacterial pathogens including Vibrio cholerae and Neisseria meningitidis. Here, we show that the current 56 members of the Inoviridae family represent a minute fraction of a highly diverse group of inoviruses. Using a machine learning approach lever- aging a combination of marker gene and genome features, we identified 10,295 inovirus-like sequences from microbial genomes and metagenomes. Collectively, our results call for reclassification of the current Inoviridae family into a viral order including six distinct proposed families associated with nearly all bacterial phyla across virtually every ecosystem.
  • Learning Protein Constitutive Motifs from Sequence Data Je´ Roˆ Me Tubiana, Simona Cocco, Re´ Mi Monasson*

    Learning Protein Constitutive Motifs from Sequence Data Je´ Roˆ Me Tubiana, Simona Cocco, Re´ Mi Monasson*

    TOOLS AND RESOURCES Learning protein constitutive motifs from sequence data Je´ roˆ me Tubiana, Simona Cocco, Re´ mi Monasson* Laboratory of Physics of the Ecole Normale Supe´rieure, CNRS UMR 8023 & PSL Research, Paris, France Abstract Statistical analysis of evolutionary-related protein sequences provides information about their structure, function, and history. We show that Restricted Boltzmann Machines (RBM), designed to learn complex high-dimensional data and their statistical features, can efficiently model protein families from sequence information. We here apply RBM to 20 protein families, and present detailed results for two short protein domains (Kunitz and WW), one long chaperone protein (Hsp70), and synthetic lattice proteins for benchmarking. The features inferred by the RBM are biologically interpretable: they are related to structure (residue-residue tertiary contacts, extended secondary motifs (a-helixes and b-sheets) and intrinsically disordered regions), to function (activity and ligand specificity), or to phylogenetic identity. In addition, we use RBM to design new protein sequences with putative properties by composing and ’turning up’ or ’turning down’ the different modes at will. Our work therefore shows that RBM are versatile and practical tools that can be used to unveil and exploit the genotype–phenotype relationship for protein families. DOI: https://doi.org/10.7554/eLife.39397.001 Introduction In recent years, the sequencing of many organisms’ genomes has led to the collection of a huge number of protein sequences, which are catalogued in databases such as UniProt or PFAM Finn et al., 2014). Sequences that share a common ancestral origin, defining a family (Figure 1A), *For correspondence: are likely to code for proteins with similar functions and structures, providing a unique window into [email protected] the relationship between genotype (sequence content) and phenotype (biological features).
  • DECIPHER: Harnessing Local Sequence Context to Improve Protein Multiple Sequence Alignment Erik S

    DECIPHER: Harnessing Local Sequence Context to Improve Protein Multiple Sequence Alignment Erik S

    Wright BMC Bioinformatics (2015) 16:322 DOI 10.1186/s12859-015-0749-z RESEARCH ARTICLE Open Access DECIPHER: harnessing local sequence context to improve protein multiple sequence alignment Erik S. Wright1,2 Abstract Background: Alignment of large and diverse sequence sets is a common task in biological investigations, yet there remains considerable room for improvement in alignment quality. Multiple sequence alignment programs tend to reach maximal accuracy when aligning only a few sequences, and then diminish steadily as more sequences are added. This drop in accuracy can be partly attributed to a build-up of error and ambiguity as more sequences are aligned. Most high-throughput sequence alignment algorithms do not use contextual information under the assumption that sites are independent. This study examines the extent to which local sequence context can be exploited to improve the quality of large multiple sequence alignments. Results: Two predictors based on local sequence context were assessed: (i) single sequence secondary structure predictions, and (ii) modulation of gap costs according to the surrounding residues. The results indicate that context-based predictors have appreciable information content that can be utilized to create more accurate alignments. Furthermore, local context becomes more informative as the number of sequences increases, enabling more accurate protein alignments of large empirical benchmarks. These discoveries became the basis for DECIPHER, a new context-aware program for sequence alignment, which outperformed other programs on largesequencesets. Conclusions: Predicting secondary structure based on local sequence context is an efficient means of breaking the independence assumption in alignment. Since secondary structure is more conserved than primary sequence, it can be leveraged to improve the alignment of distantly related proteins.
  • 1 Codon-Level Information Improves Predictions of Inter-Residue Contacts in Proteins 2 by Correlated Mutation Analysis 3

    1 Codon-Level Information Improves Predictions of Inter-Residue Contacts in Proteins 2 by Correlated Mutation Analysis 3

    1 Codon-level information improves predictions of inter-residue contacts in proteins 2 by correlated mutation analysis 3 4 5 6 7 8 Etai Jacob1,2, Ron Unger1,* and Amnon Horovitz2,* 9 10 11 1The Mina & Everard Goodman Faculty of Life Sciences, Bar-Ilan University, Ramat- 12 Gan, 52900, 2Department of Structural Biology 13 Weizmann Institute of Science, Rehovot 7610001, Israel 14 15 16 *To whom correspondence should be addressed: 17 Amnon Horovitz ([email protected]) 18 Ron Unger ([email protected]) 19 1 20 Abstract 21 Methods for analysing correlated mutations in proteins are becoming an increasingly 22 powerful tool for predicting contacts within and between proteins. Nevertheless, 23 limitations remain due to the requirement for large multiple sequence alignments (MSA) 24 and the fact that, in general, only the relatively small number of top-ranking predictions 25 are reliable. To date, methods for analysing correlated mutations have relied exclusively 26 on amino acid MSAs as inputs. Here, we describe a new approach for analysing 27 correlated mutations that is based on combined analysis of amino acid and codon MSAs. 28 We show that a direct contact is more likely to be present when the correlation between 29 the positions is strong at the amino acid level but weak at the codon level. The 30 performance of different methods for analysing correlated mutations in predicting 31 contacts is shown to be enhanced significantly when amino acid and codon data are 32 combined. 33 2 34 The effects of mutations that disrupt protein structure and/or function at one site are often 35 suppressed by mutations that occur at other sites either in the same protein or in other 36 proteins.
  • Origin of a Folded Repeat Protein from an Intrinsically Disordered Ancestor

    Origin of a Folded Repeat Protein from an Intrinsically Disordered Ancestor

    RESEARCH ARTICLE Origin of a folded repeat protein from an intrinsically disordered ancestor Hongbo Zhu, Edgardo Sepulveda, Marcus D Hartmann, Manjunatha Kogenaru†, Astrid Ursinus, Eva Sulz, Reinhard Albrecht, Murray Coles, Jo¨ rg Martin, Andrei N Lupas* Department of Protein Evolution, Max Planck Institute for Developmental Biology, Tu¨ bingen, Germany Abstract Repetitive proteins are thought to have arisen through the amplification of subdomain- sized peptides. Many of these originated in a non-repetitive context as cofactors of RNA-based replication and catalysis, and required the RNA to assume their active conformation. In search of the origins of one of the most widespread repeat protein families, the tetratricopeptide repeat (TPR), we identified several potential homologs of its repeated helical hairpin in non-repetitive proteins, including the putatively ancient ribosomal protein S20 (RPS20), which only becomes structured in the context of the ribosome. We evaluated the ability of the RPS20 hairpin to form a TPR fold by amplification and obtained structures identical to natural TPRs for variants with 2–5 point mutations per repeat. The mutations were neutral in the parent organism, suggesting that they could have been sampled in the course of evolution. TPRs could thus have plausibly arisen by amplification from an ancestral helical hairpin. DOI: 10.7554/eLife.16761.001 *For correspondence: andrei. [email protected] Introduction † Present address: Department Most present-day proteins arose through the combinatorial shuffling and differentiation of a set of of Life Sciences, Imperial College domain prototypes. In many cases, these prototypes can be traced back to the root of cellular life London, London, United and have since acted as the primary unit of protein evolution (Anantharaman et al., 2001; Kingdom Apic et al., 2001; Koonin, 2003; Kyrpides et al., 1999; Orengo and Thornton, 2005; Ponting and Competing interests: The Russell, 2002; Ranea et al., 2006).
  • The Pfam Protein Families Database Marco Punta1,*, Penny C

    The Pfam Protein Families Database Marco Punta1,*, Penny C

    D290–D301 Nucleic Acids Research, 2012, Vol. 40, Database issue Published online 29 November 2011 doi:10.1093/nar/gkr1065 The Pfam protein families database Marco Punta1,*, Penny C. Coggill1, Ruth Y. Eberhardt1, Jaina Mistry1, John Tate1, Chris Boursnell1, Ningze Pang1, Kristoffer Forslund2, Goran Ceric3, Jody Clements3, Andreas Heger4, Liisa Holm5, Erik L. L. Sonnhammer2, Sean R. Eddy3, Alex Bateman1 and Robert D. Finn3 1Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus, Hinxton CB10 1SA, UK, 2Stockholm Bioinformatics Center, Swedish eScience Research Center, Department of Biochemistry and Biophysics, Science for Life Laboratory, Stockholm University, Box 1031, SE-17121 Solna, Sweden, 3HHMI Janelia Farm Research Campus, 19700 Helix Drive, Ashburn, VA 20147, USA, 4Department of Physiology, Anatomy and Genetics, MRC Functional Genomics Unit, University of Oxford, Oxford, OX1 3QX, UK and 5Institute of Biotechnology and Department of Biological and Environmental Sciences, University of Helsinki, PO Box 56 Downloaded from (Viikinkaari 5), 00014 Helsinki, Finland Received October 7, 2011; Revised October 26, 2011; Accepted October 27, 2011 http://nar.oxfordjournals.org/ ABSTRACT INTRODUCTION Pfam is a widely used database of protein families, Pfam is a database of protein families, where families are currently containing more than 13 000 manually sets of protein regions that share a significant degree of curated protein families as of release 26.0. Pfam is sequence similarity, thereby suggesting homology. available via servers in the UK (http://pfam.sanger Similarity is detected using the HMMER3 (http:// hmmer.janelia.org/) suite of programs. .ac.uk/), the USA (http://pfam.janelia.org/) and Pfam contains two types of families: high quality, Sweden (http://pfam.sbc.su.se/).
  • Comparative Genomics of the Major Parasitic Worms

    Comparative Genomics of the Major Parasitic Worms

    Comparative genomics of the major parasitic worms International Helminth Genomes Consortium Supplementary Information Introduction ............................................................................................................................... 4 Contributions from Consortium members ..................................................................................... 5 Methods .................................................................................................................................... 6 1 Sample collection and preparation ................................................................................................................. 6 2.1 Data production, Wellcome Trust Sanger Institute (WTSI) ........................................................................ 12 DNA template preparation and sequencing................................................................................................. 12 Genome assembly ........................................................................................................................................ 13 Assembly QC ................................................................................................................................................. 14 Gene prediction ............................................................................................................................................ 15 Contamination screening ............................................................................................................................
  • UC Berkeley UC Berkeley Electronic Theses and Dissertations

    UC Berkeley UC Berkeley Electronic Theses and Dissertations

    UC Berkeley UC Berkeley Electronic Theses and Dissertations Title Evolutionary constraints on the sequence of Ras Permalink https://escholarship.org/uc/item/0sc6g33x Author Bandaru, Pradeep Publication Date 2017 Peer reviewed|Thesis/dissertation eScholarship.org Powered by the California Digital Library University of California Evolutionary constraints on the sequence of Ras By Pradeep Bandaru A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor in Philosophy in Molecular and Cell Biology in the Graduate Division of the University of California, Berkeley Committee in Charge: Professor John Kuriyan, Chair Professor Tanja Kortemme Professor Michael Eisen Professor Phillip Geissler Fall 2017 Dedication “As the heat of a fire reduces wood to ashes, the fire of knowledge burns to ashes all karma.” i Acknowledgements When I first started graduate school in 2012, I expected a relatively breezy path from classes and rotations to publishing and graduating. Suffice to say, reality did not fall in line with my expectations. But at the end, everything worked out as well as it could have and more. Along the way, I made some absolutely great friends and did some very exciting science, and I couldn’t be more thankful for the experience. I first have to thank my family for being there for me throughout every step of graduate school. My parents have been exceptionally supportive and optimistic over the past five years, and they kept me going even when I wanted to quit. One of the main reasons I kept pushing through graduate school was my dad, a fellow scientist. I realized at a young age that science isn’t always the easiest career path as a relatively unknown commodity, and he would have loved to study at a place as scientifically vibrant as UC Berkeley.
  • Structural Basis for Effector Transmembrane Domain Recognition

    Structural Basis for Effector Transmembrane Domain Recognition

    RESEARCH ARTICLE Structural basis for effector transmembrane domain recognition by type VI secretion system chaperones Shehryar Ahmad1,2, Kara K Tsang1,2†, Kartik Sachar3†, Dennis Quentin4, Tahmid M Tashin1,2, Nathan P Bullen1,2, Stefan Raunser4, Andrew G McArthur1,2,5, Gerd Prehna3*, John C Whitney1,2,5* 1Michael DeGroote Institute for Infectious Disease Research, McMaster University, Hamilton, Canada; 2Department of Biochemistry and Biomedical Sciences, McMaster University, Hamilton, Canada; 3Department of Microbiology, University of Manitoba, Winnipeg, Canada; 4Department of Structural Biochemistry, Max Planck Institute of Molecular Physiology, Dortmund, Germany; 5David Braley Centre for Antibiotic Discovery, McMaster University, Hamilton, Canada Abstract Type VI secretion systems (T6SSs) deliver antibacterial effector proteins between neighboring bacteria. Many effectors harbor N-terminal transmembrane domains (TMDs) implicated in effector translocation across target cell membranes. However, the distribution of these TMD-containing effectors remains unknown. Here, we discover prePAAR, a conserved motif found in over 6000 putative TMD-containing effectors encoded predominantly by 15 genera of Proteobacteria. Based on differing numbers of TMDs, effectors group into two distinct classes that both require a member of the Eag family of T6SS chaperones for export. Co-crystal structures of *For correspondence: class I and class II effector TMD-chaperone complexes from Salmonella Typhimurium and [email protected] (GP); Pseudomonas aeruginosa, respectively, reveals that Eag chaperones mimic transmembrane helical [email protected] (JCW) packing to stabilize effector TMDs. In addition to participating in the chaperone-TMD interface, we †These authors contributed find that prePAAR residues mediate effector-VgrG spike interactions. Taken together, our findings equally to this work reveal mechanisms of chaperone-mediated stabilization and secretion of two distinct families of T6SS membrane protein effectors.
  • MEROPS: the Peptidase Database Neil D

    MEROPS: the Peptidase Database Neil D

    Published online 5 November 2009 Nucleic Acids Research, 2010, Vol. 38, Database issue D227–D233 doi:10.1093/nar/gkp971 MEROPS: the peptidase database Neil D. Rawlings*, Alan J. Barrett and Alex Bateman The Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridgeshire, CB10 1SA, UK Received September 11, 2009; Revised October 12, 2009; Accepted October 14, 2009 ABSTRACT which are grouped into clans. A family contains proteins that can be shown to be related by sequence comparison Peptidases, their substrates and inhibitors are of alone, whereas a clan contains proteins where the great relevance to biology, medicine and biotech- sequences are so distantly related that similarity can nology. The MEROPS database (http://merops only be seen by comparing structures. Sequence analysis .sanger.ac.uk) aims to fulfil the need for an is restricted to that portion of the protein directly respon- integrated source of information about these. sible for peptidase or inhibitor activity which is termed the The database has a hierarchical classification ‘peptidase unit’ or the ‘inhibitor unit’, respectively. in which homologous sets of peptidases and A peptidase or inhibitor unit will normally correspond protein inhibitors are grouped into protein species, to a structural domain, and some proteins will contain which are grouped into families, which are in turn more than one peptidase or inhibitor domain. Examples grouped into clans. The classification framework is are potato virus Y polyprotein which contains three peptidase units, each in a different family, and turkey used for attaching information at each level. ovomucoid, which contains three inhibitor units all in An important focus of the database has become the same family.
  • Human Genetics 1990–2009

    Human Genetics 1990–2009

    Portfolio Review Human Genetics 1990–2009 June 2010 Acknowledgements The Wellcome Trust would like to thank the many people who generously gave up their time to participate in this review. The project was led by Liz Allen, Michael Dunn and Claire Vaughan. Key input and support was provided by Dave Carr, Kevin Dolby, Audrey Duncanson, Katherine Littler, Suzi Morris, Annie Sanderson and Jo Scott (landscaping analysis), and Lois Reynolds and Tilli Tansey (Wellcome Trust Expert Group). We also would like to thank David Lynn for his ongoing support to the review. The views expressed in this report are those of the Wellcome Trust project team – drawing on the evidence compiled during the review. We are indebted to the independent Expert Group, who were pivotal in providing the assessments of the Wellcome Trust’s role in supporting human genetics and have informed ‘our’ speculations for the future. Finally, we would like to thank Professor Francis Collins, who provided valuable input to the development of the timelines. The Wellcome Trust is a charity registered in England and Wales, no. 210183. Contents Acknowledgements 2 Overview and key findings 4 Landmarks in human genetics 6 1. Introduction and background 8 2. Human genetics research: the global research landscape 9 2.1 Human genetics publication output: 1989–2008 10 3. Looking back: the Wellcome Trust and human genetics 14 3.1 Building research capacity and infrastructure 14 3.1.1 Wellcome Trust Sanger Institute (WTSI) 15 3.1.2 Wellcome Trust Centre for Human Genetics 15 3.1.3 Collaborations, consortia and partnerships 16 3.1.4 Research resources and data 16 3.2 Advancing knowledge and making discoveries 17 3.3 Advancing knowledge and making discoveries: within the field of human genetics 18 3.4 Advancing knowledge and making discoveries: beyond the field of human genetics – ‘ripple’ effects 19 Case studies 22 4.
  • Browsing Genes and Genomes with Ensembl

    Browsing Genes and Genomes with Ensembl

    Browsing Genes and Genomes with Ensembl Ensembl Workshop University of Cambridge 3rd September 2013 www.ensembl.org Denise Carvalho-Silva Ensembl Outreach Notes: This workshop is based on Ensembl release 72 (June 2013). 1) Presentation slides The pdf file of the talks presented in this workshop is available in the link below: http://www.ebi.ac.uk/~denise/naturimmun 2) Course booklet A diGital Copy of this course booklet can be found below: http://www.ebi.ac.uk/~denise/coursebooklet.pdf 3) Answers The answers to the exercises in this course booklet can be found below: http://www.ebi.ac.uk/~denise/answers 2 TABLE OF CONTENTS OVERVIEW ...................................................................................................... 4 INTRODUCTION TO ENSEMBL .................................................................. 5 BROWSER WALKTHROUGH .................................................................... 14 EXERCISES .................................................................................................... 38 BROWSER ..................................................................................................... 38 BIOMART ...................................................................................................... 41 VARIATION ................................................................................................... 48 COMPARATIVE GENOMICS ...................................................................... 50 REGULATION ..............................................................................................