Anti-MED16 (Aa 1-110) Polyclonal Antibody (DPAB- DC091) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-MED16 (aa 1-110) polyclonal antibody (DPAB- DC091) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description MED16 (mediator complex subunit 16) is a protein-coding gene. Diseases associated with MED16 include thyroiditis, and bulimia nervosa, and among its related super-pathways are Gene Expression and Axon guidance. GO annotations related to this gene include transcription coactivator activity and transcription cofactor activity. Immunogen THRAP5 (AAH17282, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. The sequence is MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMI HILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSM Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name MED16 mediator complex subunit 16 [ Homo sapiens (human) ] Official Symbol MED16 Synonyms MED16; mediator complex subunit 16; DRIP92; THRAP5; TRAP95; mediator of RNA polymerase II transcription subunit 16; thyroid hormone receptor-associated protein 5; thyroid hormone receptor-associated protein, 95-kD subunit; vitamin D3 receptor-interacting protein 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved complex 92 kDa component; thyroid hormone receptor-associated protein complex 95 kDa component; Entrez Gene ID 10025 Protein Refseq NP_005472 UniProt ID Q9Y2X0 Chromosome Location 19p13.3 Pathway Developmental Biology; Gene Expression; Metabolism; PPARA activates gene expression. Function catalytic activity; receptor activity; thyroid hormone receptor binding; thyroid hormone receptor coactivator activity 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

Transcriptome Analysis of Four Arabidopsis Thaliana Mediator Tail Mutants Reveals Overlapping and Unique Functions in Gene Regulation
G3: Genes|Genomes|Genetics Early Online, published on July 26, 2018 as doi:10.1534/g3.118.200573 Title: Transcriptome Analysis of Four Arabidopsis thaliana Mediator Tail Mutants Reveals Overlapping and Unique Functions in Gene Regulation Authors: Whitney L. Dolan and Clint Chapple Department of Biochemistry, Purdue University, West Lafayette, IN 47907, USA and Purdue Center for Plant Biology, West Lafayette, IN 47907, USA. Reference numbers: Gene expression data are available in the Gene Expression Omnibus under accession GSE95574. 1 © The Author(s) 2013. Published by the Genetics Society of America. Running title: RNAseq of Four Arabidopsis MED Mutants Keywords: Mediator, Arabidopsis, transcription regulation, gene expression Corresponding author: Clint Chapple Department of Biochemistry Purdue University 175 South University St. West Lafayette, IN 47907 Telephone: 765-494-0494 Fax: 765-494-7897 E-mail: [email protected] 2 1 ABSTRACT 2 3 The Mediator complex is a central component of transcriptional regulation in Eukaryotes. The 4 complex is structurally divided into four modules known as the head, middle, tail and kinase 5 modules, and in Arabidopsis thaliana, comprises 28-34 subunits. Here, we explore the functions 6 of four Arabidopsis Mediator tail subunits, MED2, MED5a/b, MED16, and MED23, by comparing 7 the impact of mutations in each on the Arabidopsis transcriptome. We find that these subunits 8 affect both unique and overlapping sets of genes, providing insight into the functional and 9 structural relationships between them. The mutants primarily exhibit changes in the expression 10 of genes related to biotic and abiotic stress. We find evidence for a tissue specific role for 11 MED23, as well as in the production of alternative transcripts.
[Show full text]
Proteomic Analysis of the Mediator Complex Interactome in Saccharomyces Cerevisiae Received: 26 October 2016 Henriette Uthe, Jens T
www.nature.com/scientificreports OPEN Proteomic Analysis of the Mediator Complex Interactome in Saccharomyces cerevisiae Received: 26 October 2016 Henriette Uthe, Jens T. Vanselow & Andreas Schlosser Accepted: 25 January 2017 Here we present the most comprehensive analysis of the yeast Mediator complex interactome to date. Published: 27 February 2017 Particularly gentle cell lysis and co-immunopurification conditions allowed us to preserve even transient protein-protein interactions and to comprehensively probe the molecular environment of the Mediator complex in the cell. Metabolic 15N-labeling thereby enabled stringent discrimination between bona fide interaction partners and nonspecifically captured proteins. Our data indicates a functional role for Mediator beyond transcription initiation. We identified a large number of Mediator-interacting proteins and protein complexes, such as RNA polymerase II, general transcription factors, a large number of transcriptional activators, the SAGA complex, chromatin remodeling complexes, histone chaperones, highly acetylated histones, as well as proteins playing a role in co-transcriptional processes, such as splicing, mRNA decapping and mRNA decay. Moreover, our data provides clear evidence, that the Mediator complex interacts not only with RNA polymerase II, but also with RNA polymerases I and III, and indicates a functional role of the Mediator complex in rRNA processing and ribosome biogenesis. The Mediator complex is an essential coactivator of eukaryotic transcription. Its major function is to communi- cate regulatory signals from gene-specific transcription factors upstream of the transcription start site to RNA Polymerase II (Pol II) and to promote activator-dependent assembly and stabilization of the preinitiation complex (PIC)1–3. The yeast Mediator complex is composed of 25 subunits and forms four distinct modules: the head, the middle, and the tail module, in addition to the four-subunit CDK8 kinase module (CKM), which can reversibly associate with the 21-subunit Mediator complex.
[Show full text]
FBXL19 Recruits CDK-Mediator to Cpg Islands of Developmental Genes Priming Them for Activation During Lineage Commitment
RESEARCH ARTICLE FBXL19 recruits CDK-Mediator to CpG islands of developmental genes priming them for activation during lineage commitment Emilia Dimitrova1, Takashi Kondo2†, Angelika Feldmann1†, Manabu Nakayama3, Yoko Koseki2, Rebecca Konietzny4‡, Benedikt M Kessler4, Haruhiko Koseki2,5, Robert J Klose1* 1Department of Biochemistry, University of Oxford, Oxford, United Kingdom; 2Laboratory for Developmental Genetics, RIKEN Center for Integrative Medical Sciences, Yokohama, Japan; 3Department of Technology Development, Kazusa DNA Research Institute, Kisarazu, Japan; 4Nuffield Department of Medicine, TDI Mass Spectrometry Laboratory, Target Discovery Institute, University of Oxford, Oxford, United Kingdom; 5CREST, Japan Science and Technology Agency, Kawaguchi, Japan Abstract CpG islands are gene regulatory elements associated with the majority of mammalian promoters, yet how they regulate gene expression remains poorly understood. Here, we identify *For correspondence: FBXL19 as a CpG island-binding protein in mouse embryonic stem (ES) cells and show that it [email protected] associates with the CDK-Mediator complex. We discover that FBXL19 recruits CDK-Mediator to †These authors contributed CpG island-associated promoters of non-transcribed developmental genes to prime these genes equally to this work for activation during cell lineage commitment. We further show that recognition of CpG islands by Present address: ‡Agilent FBXL19 is essential for mouse development. Together this reveals a new CpG island-centric Technologies, Waldbronn, mechanism for CDK-Mediator recruitment to developmental gene promoters in ES cells and a Germany requirement for CDK-Mediator in priming these developmental genes for activation during cell lineage commitment. Competing interests: The DOI: https://doi.org/10.7554/eLife.37084.001 authors declare that no competing interests exist.
[Show full text]
Analysis of the Complex Interaction of Cdr1as‑Mirna‑Protein and Detection of Its Novel Role in Melanoma
ONCOLOGY LETTERS 16: 1219-1225, 2018 Analysis of the complex interaction of CDR1as‑miRNA‑protein and detection of its novel role in melanoma LIHUAN ZHANG*, YUAN LI*, WENYAN LIU, HUIFENG LI and ZHIWEI ZHU College of Life Sciences, Shanxi Agricultural University, Taigu, Shanxi 030801, P.R. China Received May 15, 2017; Accepted April 9, 2018 DOI: 10.3892/ol.2018.8700 Abstract. Despite improvements in the prevention, diagnosis has been detected in several species, including viruses (2), and treatment of melanoma having developed rapidly, the role plants (4), archaea (5)[Salzman, 2013 #198; Memczak, 2013 of circular RNA CDR1 antisense RNA (CDR1as) in melanoma #291] and animals (6). In eukaryotic cells, circRNA has remains to be elucidated. The aim of the present study was to attracted attention due to its unique characteristics, including predict the novel roles of CDR1as in melanoma through novel high stability, specificity and evolutionary conservation (7). bioinformatics analysis. In the present study, the circ2Traits The majority of circRNAs are derived from exons of coding database was used to supply information on CDR1as in cancer. regions, 3'UTRs, 5'UTRs, introns, intergenetic regions and CircNet, circBase and circInteractome databases were used to antisense RNAs (8). CircRNAs, which have attracted attention detect the co-expression of CDR1as, microRNAs and proteins. in recent years, can be produced by canonical and nonca- Furthermore, the functions and pathways of the associated nonical splicing as distinguished from the linear RNAs (9). proteins were predicted using the Database for Annotation, Through high-throughput sequencing, three types of circRNAs Visualization and Integrated Discovery. Gene Ontology have been identified: Exonic circRNAs (7), circular intronic enrichment analysis suggested that the proteins associated RNAs (ciRNAs) (9), and retained-intron circular RNAs or with CDR1as were mainly regulated in the cytoplasm as exon-intron circRNAs (elciRNAs) (10).
[Show full text]
Functional Studies of the Yeast Med5, Med15 and Med16 Mediator Tail Subunits
Functional Studies of the Yeast Med5, Med15 and Med16 Mediator Tail Subunits Miriam Larsson1, Hanna Uvell1¤a, Jenny Sandstro¨ m1, Patrik Ryde´n2, Luke A. Selth3¤b, Stefan Bjo¨ rklund1* 1 Department of Medical Biochemistry and Biophysics, Umea˚ University, Umea˚, Sweden, 2 Department of Statistics, Umea˚ University, Umea˚, Sweden, 3 Mechanisms of Transcription Laboratory, Clare Hall Laboratories, Cancer Research UK London Research Institute, South Mimms, United Kingdom Abstract The yeast Mediator complex can be divided into three modules, designated Head, Middle and Tail. Tail comprises the Med2, Med3, Med5, Med15 and Med16 protein subunits, which are all encoded by genes that are individually non-essential for viability. In cells lacking Med16, Tail is displaced from Head and Middle. However, inactivation of MED5/MED15 and MED15/ MED16 are synthetically lethal, indicating that Tail performs essential functions as a separate complex even when it is not bound to Middle and Head. We have used the N-Degron method to create temperature-sensitive (ts) mutants in the Mediator tail subunits Med5, Med15 and Med16 to study the immediate effects on global gene expression when each subunit is individually inactivated, and when Med5/15 or Med15/16 are inactivated together. We identify 25 genes in each double mutant that show a significant change in expression when compared to the corresponding single mutants and to the wild type strain. Importantly, 13 of the 25 identified genes are common for both double mutants. We also find that all strains in which MED15 is inactivated show down-regulation of genes that have been identified as targets for the Ace2 transcriptional activator protein, which is important for progression through the G1 phase of the cell cycle.
[Show full text]
Human Social Genomics in the Multi-Ethnic Study of Atherosclerosis
Getting “Under the Skin”: Human Social Genomics in the Multi-Ethnic Study of Atherosclerosis by Kristen Monét Brown A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Epidemiological Science) in the University of Michigan 2017 Doctoral Committee: Professor Ana V. Diez-Roux, Co-Chair, Drexel University Professor Sharon R. Kardia, Co-Chair Professor Bhramar Mukherjee Assistant Professor Belinda Needham Assistant Professor Jennifer A. Smith © Kristen Monét Brown, 2017 [email protected] ORCID iD: 0000-0002-9955-0568 Dedication I dedicate this dissertation to my grandmother, Gertrude Delores Hampton. Nanny, no one wanted to see me become “Dr. Brown” more than you. I know that you are standing over the bannister of heaven smiling and beaming with pride. I love you more than my words could ever fully express. ii Acknowledgements First, I give honor to God, who is the head of my life. Truly, without Him, none of this would be possible. Countless times throughout this doctoral journey I have relied my favorite scripture, “And we know that all things work together for good, to them that love God, to them who are called according to His purpose (Romans 8:28).” Secondly, I acknowledge my parents, James and Marilyn Brown. From an early age, you two instilled in me the value of education and have been my biggest cheerleaders throughout my entire life. I thank you for your unconditional love, encouragement, sacrifices, and support. I would not be here today without you. I truly thank God that out of the all of the people in the world that He could have chosen to be my parents, that He chose the two of you.
[Show full text]
Identification of MEDIATOR16 As the Arabidopsis COBRA Suppressor MONGOOSE1
Identification of MEDIATOR16 as the Arabidopsis COBRA suppressor MONGOOSE1 Nadav Soreka,b,1, Heidi Szemenyeia,1, Hagit Soreka, Abigail Landersa, Heather Knightc, Stefan Bauera, David E. Wemmerd, and Chris R. Somervillea,b,2 aEnergy Biosciences Institute, University of California, Berkeley, CA 94720; bPlant and Microbial Biology Department, University of California, Berkeley, CA 94720; cSchool of Biological and Biomedical Sciences, Durham University, Durham DH1 3LE, United Kingdom; and dDepartment of Chemistry, University of California, Berkeley, CA 94720 Contributed by Chris R. Somerville, November 14, 2015 (sent for review July 30, 2015; reviewed by Clint Chapple and Bruce Kohorn) We performed a screen for genetic suppressors of cobra,anArabi- regulatory network leading to organized secondary wall formation dopsis mutant with defects in cellulose formation and an increased in xylem (21). It was recently discovered that disruption of ratio of unesterified/esterified pectin. We identified a suppressor the genes for MEDIATOR5a and 5b can suppress the growth named mongoose1 (mon1) that suppressed the growth defects of defects of Arabidopsis ref8, a mutant defective in lignin bio- cobra, partially restored cellulose levels, and restored the esterifica- synthesis (22). tion ratio of pectin to wild-type levels. mon1 was mapped to the The mediator transcriptional coactivator complex has been MEDIATOR16 (MED16) locus, a tail mediator subunit, also known as found to be a crucial component in promoting eukaryotic tran- SENSITIVE TO FREEZING6 (SFR6). When separated from the cobra scription, as it links transcription factor binding at promoters to mutation, mutations in MED16 caused resistance to cellulose bio- the activity of RNA polymerase II (Pol II) (23).
[Show full text]
Sex Dependent Glial-Specific Changes in the Chromatin Accessibility
bioRxiv preprint doi: https://doi.org/10.1101/2021.04.07.438835; this version posted April 9, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 Sex dependent glial-specific changes in the chromatin accessibility landscape in late-onset 2 Alzheimer’s disease brains 3 4 Julio Barrera#,1,2, Lingyun Song#,2, Alexias Safi2, Young Yun1,2, Melanie E. Garrett3, Julia 5 Gamache1,2, Ivana Premasinghe1,2, Daniel Sprague1,2, Danielle Chipman1,2, Jeffrey Li2, 6 Hélène Fradin2, Karen Soldano3, Raluca Gordân2,4,5, Allison E. Ashley-Koch*,3,6, Gregory E. 7 Crawford*,2,7,8, Ornit Chiba-Falek*,1,2 8 9 1 Division of Translational Brain Sciences, Department of Neurology, Duke University Medical Center, Durham, 10 NC, 27710, USA. 11 2 Center for Genomic and Computational Biology, Duke University Medical Center, Durham, NC, 27708, USA. 12 3 Duke Molecular Physiology Institute, Duke University Medical Center, Durham, NC, 27701, USA. 13 4 Department of Biostatistics and Bioinformatics, Duke University Medical Center, Durham, NC, 27705, USA. 14 5 Department of Computer Science, Duke University, Durham, NC, 27705, USA. 15 6 Department of Medicine, Duke University Medical Center, Durham, NC, 27708, USA. 16 7 Department of Pediatrics, Division of Medical Genetics, Duke University Medical Center, Durham, NC, 27708 17 8 Center for Advanced Genomic Technologies, Duke University Medical Center, Durham, NC, 27708, USA. 18 19 # These authors contributed equally to this work 20 21 * To whom correspondence should be addressed: 22 23 Ornit Chiba-Falek 24 Dept of Neurology 25 DUMC Box 2900 26 Duke University Medical Center, 27 Durham, North Carolina 27710, USA 28 Tel: 919 681-8001 29 Fax: 919 684-6514 30 E-mail: [email protected] 31 32 Gregory E.
[Show full text]
An Enrichment Tool for Gene Ontology and Functional Network Analysis and Visualization of Data from Omics Technologies
G C A T T A C G G C A T genes Article NeVOmics: An Enrichment Tool for Gene Ontology and Functional Network Analysis and Visualization of Data from OMICs Technologies Eduardo Zúñiga-León , Ulises Carrasco-Navarro and Francisco Fierro * Departamento de Biotecnología, Universidad Autónoma Metropolitana-Unidad Iztapalapa, Ciudad de Mexico 09340, Mexico; [email protected] (E.Z.-L.); [email protected] (U.C.-N.) * Correspondence: [email protected] or fi[email protected] Received: 26 September 2018; Accepted: 16 November 2018; Published: 23 November 2018 Abstract: The increasing number of OMICs studies demands bioinformatic tools that aid in the analysis of large sets of genes or proteins to understand their roles in the cell and establish functional networks and pathways. In the last decade, over-representation or enrichment tools have played a successful role in the functional analysis of large gene/protein lists, which is evidenced by thousands of publications citing these tools. However, in most cases the results of these analyses are long lists of biological terms associated to proteins that are difficult to digest and interpret. Here we present NeVOmics, Network-based Visualization for Omics, a functional enrichment analysis tool that identifies statistically over-represented biological terms within a given gene/protein set. This tool provides a hypergeometric distribution test to calculate significantly enriched biological terms, and facilitates analysis on cluster distribution and relationship of proteins to processes and pathways. NeVOmics is adapted to use updated information from the two main annotation databases: Gene Ontology and Kyoto Encyclopedia of Genes and Genomes (KEGG). NeVOmics compares favorably to other Gene Ontology and enrichment tools regarding coverage in the identification of biological terms.
[Show full text]
Association of Chromosome 19 to Lung Cancer Genotypes and Phenotypes
Cancer Metastasis Rev DOI 10.1007/s10555-015-9556-2 Association of chromosome 19 to lung cancer genotypes and phenotypes Xiangdong Wang1 & Yong Zhang 1 & Carol L. Nilsson2 & Frode S. Berven3 & Per E. Andrén4 & Elisabet Carlsohn5 & Johan Malm7 & Manuel Fuentes7 & Ákos Végvári6,8 & Charlotte Welinder6,9 & Thomas E. Fehniger6,10 & Melinda Rezeli8 & Goutham Edula11 & Sophia Hober12 & Toshihide Nishimura13 & György Marko-Varga6,8,13 # Springer Science+Business Media New York 2015 Abstract The Chromosome 19 Consortium, a part of the aberrations include translocation t(15, 19) (q13, p13.1) fusion Chromosome-Centric Human Proteome Project (C-HPP, oncogene BRD4-NUT, DNA repair genes (ERCC1, ERCC2, http://www.C-HPP.org), is tasked with the understanding XRCC1), TGFβ1 pathway activation genes (TGFB1, LTBP4) chromosome 19 functions at the gene and protein levels, as , Dyrk1B, and potential oncogenesis protector genes such as well as their roles in lung oncogenesis. Comparative genomic NFkB pathway inhibition genes (NFKBIB, PPP1R13L) and hybridization (CGH) studies revealed chromosome aberration EGLN2. In conclusion, neXtProt is an effective resource for in lung cancer subtypes, including ADC, SCC, LCC, and the validation of gene aberrations identified in genomic SCLC. The most common abnormality is 19p loss and 19q studies. It promises to enhance our understanding of lung gain. Sixty-four aberrant genes identified in previous genomic cancer oncogenesis. studies and their encoded protein functions were further vali- dated in the neXtProt database (http://www.nextprot.org/). Among those, the loss of tumor suppressor genes STK11, Keywords Proteins . Genes . Antibodies . mRNA . Mass MUM1, KISS1R (19p13.3), and BRG1 (19p13.13) is spectrometry .
[Show full text]
(NF1) As a Breast Cancer Driver
INVESTIGATION Comparative Oncogenomics Implicates the Neurofibromin 1 Gene (NF1) as a Breast Cancer Driver Marsha D. Wallace,*,† Adam D. Pfefferle,‡,§,1 Lishuang Shen,*,1 Adrian J. McNairn,* Ethan G. Cerami,** Barbara L. Fallon,* Vera D. Rinaldi,* Teresa L. Southard,*,†† Charles M. Perou,‡,§,‡‡ and John C. Schimenti*,†,§§,2 *Department of Biomedical Sciences, †Department of Molecular Biology and Genetics, ††Section of Anatomic Pathology, and §§Center for Vertebrate Genomics, Cornell University, Ithaca, New York 14853, ‡Department of Pathology and Laboratory Medicine, §Lineberger Comprehensive Cancer Center, and ‡‡Department of Genetics, University of North Carolina, Chapel Hill, North Carolina 27514, and **Memorial Sloan-Kettering Cancer Center, New York, New York 10065 ABSTRACT Identifying genomic alterations driving breast cancer is complicated by tumor diversity and genetic heterogeneity. Relevant mouse models are powerful for untangling this problem because such heterogeneity can be controlled. Inbred Chaos3 mice exhibit high levels of genomic instability leading to mammary tumors that have tumor gene expression profiles closely resembling mature human mammary luminal cell signatures. We genomically characterized mammary adenocarcinomas from these mice to identify cancer-causing genomic events that overlap common alterations in human breast cancer. Chaos3 tumors underwent recurrent copy number alterations (CNAs), particularly deletion of the RAS inhibitor Neurofibromin 1 (Nf1) in nearly all cases. These overlap with human CNAs including NF1, which is deleted or mutated in 27.7% of all breast carcinomas. Chaos3 mammary tumor cells exhibit RAS hyperactivation and increased sensitivity to RAS pathway inhibitors. These results indicate that spontaneous NF1 loss can drive breast cancer. This should be informative for treatment of the significant fraction of patients whose tumors bear NF1 mutations.
[Show full text]
Specific Functions for Mediator Complex Subunits from Different
www.nature.com/scientificreports OPEN Specifc functions for Mediator complex subunits from diferent modules in the transcriptional response of Arabidopsis thaliana to abiotic stress Tim Crawford1,3, Fazeelat Karamat2,4, Nóra Lehotai1,4, Matilda Rentoft2,4, Jeanette Blomberg2, Åsa Strand1 & Stefan Björklund2* Adverse environmental conditions are detrimental to plant growth and development. Acclimation to abiotic stress conditions involves activation of signaling pathways which often results in changes in gene expression via networks of transcription factors (TFs). Mediator is a highly conserved co-regulator complex and an essential component of the transcriptional machinery in eukaryotes. Some Mediator subunits have been implicated in stress-responsive signaling pathways; however, much remains unknown regarding the role of plant Mediator in abiotic stress responses. Here, we use RNA-seq to analyze the transcriptional response of Arabidopsis thaliana to heat, cold and salt stress conditions. We identify a set of common abiotic stress regulons and describe the sequential and combinatorial nature of TFs involved in their transcriptional regulation. Furthermore, we identify stress-specifc roles for the Mediator subunits MED9, MED16, MED18 and CDK8, and putative TFs connecting them to diferent stress signaling pathways. Our data also indicate diferent modes of action for subunits or modules of Mediator at the same gene loci, including a co-repressor function for MED16 prior to stress. These results illuminate a poorly understood but important player in the transcriptional response of plants to abiotic stress and identify target genes and mechanisms as a prelude to further biochemical characterization. Heat, cold, salinity or drought, constitute abiotic stress conditions that are sub-optimal for plant growth1.
[Show full text]