Anti-MED16 (aa 1-110) polyclonal antibody (DPAB- DC091) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description MED16 (mediator complex subunit 16) is a protein-coding gene. Diseases associated with MED16 include thyroiditis, and bulimia nervosa, and among its related super-pathways are Gene Expression and Axon guidance. GO annotations related to this gene include transcription coactivator activity and transcription cofactor activity. Immunogen THRAP5 (AAH17282, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. The sequence is MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMI HILDTEHPWDLHSIPSEHHEAITCLEWDQSGSRLLSADADGQIKCWSM Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name MED16 mediator complex subunit 16 [ Homo sapiens (human) ] Official Symbol MED16 Synonyms MED16; mediator complex subunit 16; DRIP92; THRAP5; TRAP95; mediator of RNA polymerase II transcription subunit 16; thyroid hormone receptor-associated protein 5; thyroid hormone receptor-associated protein, 95-kD subunit; vitamin D3 receptor-interacting protein 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved complex 92 kDa component; thyroid hormone receptor-associated protein complex 95 kDa component; Entrez Gene ID 10025 Protein Refseq NP_005472 UniProt ID Q9Y2X0 Chromosome Location 19p13.3 Pathway Developmental Biology; Gene Expression; Metabolism; PPARA activates gene expression. Function catalytic activity; receptor activity; thyroid hormone receptor binding; thyroid hormone receptor coactivator activity 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.