Nucleomorph Karyotype Diversity in the Freshwater
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Plant Life MagillS Encyclopedia of Science
MAGILLS ENCYCLOPEDIA OF SCIENCE PLANT LIFE MAGILLS ENCYCLOPEDIA OF SCIENCE PLANT LIFE Volume 4 Sustainable Forestry–Zygomycetes Indexes Editor Bryan D. Ness, Ph.D. Pacific Union College, Department of Biology Project Editor Christina J. Moose Salem Press, Inc. Pasadena, California Hackensack, New Jersey Editor in Chief: Dawn P. Dawson Managing Editor: Christina J. Moose Photograph Editor: Philip Bader Manuscript Editor: Elizabeth Ferry Slocum Production Editor: Joyce I. Buchea Assistant Editor: Andrea E. Miller Page Design and Graphics: James Hutson Research Supervisor: Jeffry Jensen Layout: William Zimmerman Acquisitions Editor: Mark Rehn Illustrator: Kimberly L. Dawson Kurnizki Copyright © 2003, by Salem Press, Inc. All rights in this book are reserved. No part of this work may be used or reproduced in any manner what- soever or transmitted in any form or by any means, electronic or mechanical, including photocopy,recording, or any information storage and retrieval system, without written permission from the copyright owner except in the case of brief quotations embodied in critical articles and reviews. For information address the publisher, Salem Press, Inc., P.O. Box 50062, Pasadena, California 91115. Some of the updated and revised essays in this work originally appeared in Magill’s Survey of Science: Life Science (1991), Magill’s Survey of Science: Life Science, Supplement (1998), Natural Resources (1998), Encyclopedia of Genetics (1999), Encyclopedia of Environmental Issues (2000), World Geography (2001), and Earth Science (2001). ∞ The paper used in these volumes conforms to the American National Standard for Permanence of Paper for Printed Library Materials, Z39.48-1992 (R1997). Library of Congress Cataloging-in-Publication Data Magill’s encyclopedia of science : plant life / edited by Bryan D. -
Fig.S1. the Pairwise Aligments of High Scoring Pairs of Recognizable Pseudogenes
LysR transcriptional regulator Identities = 57/164 (35%), Positives = 82/164 (50%), Gaps = 13/164 (8%) 70530- SNQAIKTYLMPK*LRLLRQK*SPVEFQLQVHLIKKIRLNIVIRDINLTIIEN-TPVKLKI -70354 ++Q TYLMP+ + L RQK V QLQVH ++I ++ INL II P++LK 86251- ASQTTGTYLMPRLIGLFRQKYPQVAVQLQVHSTRRIAWSVANGHINLAIIGGEVPIELKN -86072 70353- FYTLLRMKERI*H*YCLGFL------FQFLIAYKKKNLYGLRLIKVDIPFPIRGIMNNP* -70192 + E L + F L + +K++LY LR I +D IR +++ 86071- MLQVTSYAED-----ELALILPKSHPFSMLRSIQKEDLYRLRFIALDRQSTIRKVIDKVL -85907 70191- IKTELIPRNLN-EMELSLFKPIKNAV*PGLNVTLIFVSAIAKEL -70063 + + EMEL+ + IKNAV GL + VSAIAKEL 85906- NQNGIDSTRFKIEMELNSVEAIKNAVQSGLGAAFVSVSAIAKEL -85775 ycf3 Photosystem I assembly protein Identities = 25/59 (42%), Positives = 39/59 (66%), Gaps = 3/59 (5%) 19162- NRSYML-SIQCM-PNNSDYVNTLKHCR*ALDLSSKL-LAIRNVTISYYCQDIIFSEKKD -19329 +RSY+L +I + +N +YV L++ ALDL+S+L AI N+ + Y+ Q + SEKKD 19583- DRSYILYNIGLIYASNGEYVKALEYYHQALDLNSRLPPAINNIAVIYHYQGVKASEKKD -19759 Fig.S1. The pairwise aligments of high scoring pairs of recognizable pseudogenes. The upper amino acid sequences indicates Cryptomonas sp. SAG977-2f. The lower sequences are corresponding amino acid sequences of homologs in C. curvata CCAP979/52. Table S1. Presence/absence of protein genes in the plastid genomes of Cryptomonas and representative species of Cryptomonadales. Note; y indicates pseudogenes. Photosynthetic Non-Photosynthetic Guillardia Rhodomonas Cryptomonas C. C. curvata C. curvata parameciu Guillardia Rhodomonas FBCC300 CCAP979/ SAG977 CCAC1634 m theta salina -2f B 012D 52 CCAP977/2 a rps2 + + + + -
The Apicoplast: a Review of the Derived Plastid of Apicomplexan Parasites
Curr. Issues Mol. Biol. 7: 57-80. Online journalThe Apicoplastat www.cimb.org 57 The Apicoplast: A Review of the Derived Plastid of Apicomplexan Parasites Ross F. Waller1 and Geoffrey I. McFadden2,* way to apicoplast discovery with studies of extra- chromosomal DNAs recovered from isopycnic density 1Botany, University of British Columbia, 3529-6270 gradient fractionation of total Plasmodium DNA. This University Boulevard, Vancouver, BC, V6T 1Z4, Canada group recovered two DNA forms; one a 6kb tandemly 2Plant Cell Biology Research Centre, Botany, University repeated element that was later identifed as the of Melbourne, 3010, Australia mitochondrial genome, and a second, 35kb circle that was supposed to represent the DNA circles previously observed by microscopists (Wilson et al., 1996b; Wilson Abstract and Williamson, 1997). This molecule was also thought The apicoplast is a plastid organelle, homologous to to be mitochondrial DNA, and early sequence data of chloroplasts of plants, that is found in apicomplexan eubacterial-like rRNA genes supported this organellar parasites such as the causative agents of Malaria conclusion. However, as the sequencing effort continued Plasmodium spp. It occurs throughout the Apicomplexa a new conclusion, that was originally embraced with and is an ancient feature of this group acquired by the some awkwardness (“Have malaria parasites three process of endosymbiosis. Like plant chloroplasts, genomes?”, Wilson et al., 1991), began to emerge. apicoplasts are semi-autonomous with their own genome Gradually, evermore convincing character traits of a and expression machinery. In addition, apicoplasts import plastid genome were uncovered, and strong parallels numerous proteins encoded by nuclear genes. These with plastid genomes from non-photosynthetic plants nuclear genes largely derive from the endosymbiont (Epifagus virginiana) and algae (Astasia longa) became through a process of intracellular gene relocation. -
Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea
Baltic Sea Environment Proceedings No.106 Biovolumes and Size-Classes of Phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Baltic Sea Environment Proceedings No. 106 Biovolumes and size-classes of phytoplankton in the Baltic Sea Helsinki Commission Baltic Marine Environment Protection Commission Authors: Irina Olenina, Centre of Marine Research, Taikos str 26, LT-91149, Klaipeda, Lithuania Susanna Hajdu, Dept. of Systems Ecology, Stockholm University, SE-106 91 Stockholm, Sweden Lars Edler, SMHI, Ocean. Services, Nya Varvet 31, SE-426 71 V. Frölunda, Sweden Agneta Andersson, Dept of Ecology and Environmental Science, Umeå University, SE-901 87 Umeå, Sweden, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Norbert Wasmund, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Susanne Busch, Baltic Sea Research Institute, Seestr. 15, D-18119 Warnemünde, Germany Jeanette Göbel, Environmental Protection Agency (LANU), Hamburger Chaussee 25, D-24220 Flintbek, Germany Slawomira Gromisz, Sea Fisheries Institute, Kollataja 1, 81-332, Gdynia, Poland Siv Huseby, Umeå Marine Sciences Centre, Umeå University, SE-910 20 Hörnefors, Sweden Maija Huttunen, Finnish Institute of Marine Research, Lyypekinkuja 3A, P.O. Box 33, FIN-00931 Helsinki, Finland Andres Jaanus, Estonian Marine Institute, Mäealuse 10 a, 12618 Tallinn, Estonia Pirkko Kokkonen, Finnish Environment Institute, P.O. Box 140, FIN-00251 Helsinki, Finland Iveta Ledaine, Inst. of Aquatic Ecology, Marine Monitoring Center, University of Latvia, Daugavgrivas str. 8, Latvia Elzbieta Niemkiewicz, Maritime Institute in Gdansk, Laboratory of Ecology, Dlugi Targ 41/42, 80-830, Gdansk, Poland All photographs by Finnish Institute of Marine Research (FIMR) Cover photo: Aphanizomenon flos-aquae For bibliographic purposes this document should be cited to as: Olenina, I., Hajdu, S., Edler, L., Andersson, A., Wasmund, N., Busch, S., Göbel, J., Gromisz, S., Huseby, S., Huttunen, M., Jaanus, A., Kokkonen, P., Ledaine, I. -
Diversity and Evolution of Protist Mitochondria: Introns, Gene Content and Genome Architecture
Diversity and Evolution of Protist Mitochondria: Introns, Gene Content and Genome Architecture 著者 西村 祐貴 内容記述 この博士論文は内容の要約のみの公開(または一部 非公開)になっています year 2016 その他のタイトル プロティストミトコンドリアの多様性と進化:イン トロン、遺伝子組成、ゲノム構造 学位授与大学 筑波大学 (University of Tsukuba) 学位授与年度 2015 報告番号 12102甲第7737号 URL http://hdl.handle.net/2241/00144261 Diversity and Evolution of Protist Mitochondria: Introns, Gene Content and Genome Architecture A Dissertation Submitted to the Graduate School of Life and Environmental Sciences, the University of Tsukuba in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy in Science (Doctral Program in Biologial Sciences) Yuki NISHIMURA Table of Contents Abstract ........................................................................................................................... 1 Genes encoded in mitochondrial genomes of eukaryotes ..................................................... 3 Terminology .......................................................................................................................... 4 Chapter 1. General introduction ................................................................................ 5 The origin and evolution of mitochondria ............................................................................ 5 Mobile introns in mitochondrial genome .............................................................................. 6 The organisms which are lacking in mitochondrial genome data ........................................ 8 Chapter 2. Lateral transfers of mobile introns -
Lateral Gene Transfer of Anion-Conducting Channelrhodopsins Between Green Algae and Giant Viruses
bioRxiv preprint doi: https://doi.org/10.1101/2020.04.15.042127; this version posted April 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 5 Lateral gene transfer of anion-conducting channelrhodopsins between green algae and giant viruses Andrey Rozenberg 1,5, Johannes Oppermann 2,5, Jonas Wietek 2,3, Rodrigo Gaston Fernandez Lahore 2, Ruth-Anne Sandaa 4, Gunnar Bratbak 4, Peter Hegemann 2,6, and Oded 10 Béjà 1,6 1Faculty of Biology, Technion - Israel Institute of Technology, Haifa 32000, Israel. 2Institute for Biology, Experimental Biophysics, Humboldt-Universität zu Berlin, Invalidenstraße 42, Berlin 10115, Germany. 3Present address: Department of Neurobiology, Weizmann 15 Institute of Science, Rehovot 7610001, Israel. 4Department of Biological Sciences, University of Bergen, N-5020 Bergen, Norway. 5These authors contributed equally: Andrey Rozenberg, Johannes Oppermann. 6These authors jointly supervised this work: Peter Hegemann, Oded Béjà. e-mail: [email protected] ; [email protected] 20 ABSTRACT Channelrhodopsins (ChRs) are algal light-gated ion channels widely used as optogenetic tools for manipulating neuronal activity 1,2. Four ChR families are currently known. Green algal 3–5 and cryptophyte 6 cation-conducting ChRs (CCRs), cryptophyte anion-conducting ChRs (ACRs) 7, and the MerMAID ChRs 8. Here we 25 report the discovery of a new family of phylogenetically distinct ChRs encoded by marine giant viruses and acquired from their unicellular green algal prasinophyte hosts. -
Chloroplast Structure of the Cryptophyceae
CHLOROPLAST STRUCTURE OF THE CRYPTOPHYCEAE Evidence for Phycobiliproteins within Intrathylakoidal Spaces E . GANTT, M . R . EDWARDS, and L . PROVASOLI From the Radiation Biology Laboratory, Smithsonian Institution, Rockville, Maryland 20852, the Division of Laboratories and Research, New York State Department of Health, Albany, New York 12201, and the Haskins Laboratories, New Haven, Connecticut 06520 ABSTRACT Selective extraction and morphological evidence indicate that the phycobiliproteins in three Cryptophyceaen algae (Chroomonas, Rhodomonas, and Cryptomonas) are contained within intrathylakoidal spaces and are not on the stromal side of the lamellae as in the red and blue-green algae . Furthermore, no discrete phycobilisome-type aggregates have thus far been observed in the Cryptophyceae . Structurally, although not necessarily functionally, this is a radical difference . The width of the intrathylakoidal spaces can vary but is gen- erally about 200-300 A . While the thylakoid membranes are usually closely aligned, grana- type fusions do not occur. In Chroomonas these membranes evidence an extensive periodic display with a spacing on the order of 140-160 A . This periodicity is restricted to the mem- branes and has not been observed in the electron-opaque intrathylakoidal matrix . INTRODUCTION The varied characteristics of the cryptomonads (3), Greenwood in Kirk and Tilney-Bassett (10), are responsible for their indefinite taxonomic and Lucas (13) . The thylakoids have a tendency position (17), but at the same time they enhance to be arranged in pairs, that is, for two of them to their status in evolutionary schemes (1, 4) . Their be closely associated with a 30-50 A space between chloroplast structure is distinct from that of every them . -
Phytoref: a Reference Database of the Plastidial 16S Rrna Gene of Photosynthetic Eukaryotes with Curated Taxonomy
Molecular Ecology Resources (2015) 15, 1435–1445 doi: 10.1111/1755-0998.12401 PhytoREF: a reference database of the plastidial 16S rRNA gene of photosynthetic eukaryotes with curated taxonomy JOHAN DECELLE,*† SARAH ROMAC,*† ROWENA F. STERN,‡ EL MAHDI BENDIF,§ ADRIANA ZINGONE,¶ STEPHANE AUDIC,*† MICHAEL D. GUIRY,** LAURE GUILLOU,*† DESIRE TESSIER,††‡‡ FLORENCE LE GALL,*† PRISCILLIA GOURVIL,*† ADRIANA L. DOS SANTOS,*† IAN PROBERT,*† DANIEL VAULOT,*† COLOMBAN DE VARGAS*† and RICHARD CHRISTEN††‡‡ *UMR 7144 - Sorbonne Universites, UPMC Univ Paris 06, Station Biologique de Roscoff, Roscoff 29680, France, †CNRS, UMR 7144, Station Biologique de Roscoff, Roscoff 29680, France, ‡Sir Alister Hardy Foundation for Ocean Science, The Laboratory, Citadel Hill, Plymouth PL1 2PB, UK, §Marine Biological Association, The Laboratory, Citadel Hill, Plymouth PL1 2PB, UK, ¶Stazione Zoologica Anton Dohrn, Villa Comunale, Naples 80121, Italy, **The AlgaeBase Foundation, c/o Ryan Institute, National University of Ireland, University Road, Galway Ireland, ††CNRS, UMR 7138, Systematique Adaptation Evolution, Parc Valrose, BP71, Nice F06108, France, ‡‡Universite de Nice-Sophia Antipolis, UMR 7138, Systematique Adaptation Evolution, Parc Valrose, BP71, Nice F06108, France Abstract Photosynthetic eukaryotes have a critical role as the main producers in most ecosystems of the biosphere. The ongo- ing environmental metabarcoding revolution opens the perspective for holistic ecosystems biological studies of these organisms, in particular the unicellular microalgae that -
A Reference Database of the Plastidial 16S Rrna Gene Of
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by HAL-UNICE PhytoREF: a reference database of the plastidial 16S rRNA gene of photosynthetic eukaryotes with curated taxonomy Johan Decelle, Sarah Romac, Rowena F Stern, El Mahdi Bendif, Adriana Zingone, St´ephane Audic, Michel D Guiry, Laure Guillou, D´esir´eTessier, Florence Le Gall, et al. To cite this version: Johan Decelle, Sarah Romac, Rowena F Stern, El Mahdi Bendif, Adriana Zingone, et al.. PhytoREF: a reference database of the plastidial 16S rRNA gene of photosynthetic eukaryotes with curated taxonomy. Molecular Ecology Resources, Blackwell, 2015, 15 (6), pp.1435-1445. <10.1111/1755-0998.12401>. <hal-01149047> HAL Id: hal-01149047 http://hal.upmc.fr/hal-01149047 Submitted on 6 May 2015 HAL is a multi-disciplinary open access L'archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destin´eeau d´ep^otet `ala diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publi´esou non, lished or not. The documents may come from ´emanant des ´etablissements d'enseignement et de teaching and research institutions in France or recherche fran¸caisou ´etrangers,des laboratoires abroad, or from public or private research centers. publics ou priv´es. Received Date : 12-Nov-2014 Revised Date : 20-Feb-2015 Accepted Date : 02-Mar-2015 Article type : Resource Article PhytoREF: a reference database of the plastidial 16S rRNA gene of photosynthetic eukaryotes with curated taxonomy Johan Decelle1,2, Sarah Romac1,2, Rowena F. Stern3, El Mahdi Bendif4, Adriana Zingone5, Stéphane Audic1,2, Michael D. -
Introns, Gene Content and Genome Architecture
Diversity and Evolution of Protist Mitochondria: Introns, Gene Content and Genome Architecture A Dissertation Submitted to the Graduate School of Life and Environmental Sciences, the University of Tsukuba in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy in Science (Doctral Program in Biologial Sciences) Yuki NISHIMURA Table of Contents Abstract ........................................................................................................................... 1 Genes encoded in mitochondrial genomes of eukaryotes ..................................................... 3 Terminology .......................................................................................................................... 4 Chapter 1. General introduction ................................................................................ 5 The origin and evolution of mitochondria ............................................................................ 5 Mobile introns in mitochondrial genome .............................................................................. 6 The organisms which are lacking in mitochondrial genome data ........................................ 8 Chapter 2. Lateral transfers of mobile introns among distantly related mitochondrial genomes ................................................................................................ 11 Summary ................................................................................................................................ 11 2-1. Leucocryptos -
Bangor University DOCTOR of PHILOSOPHY
Bangor University DOCTOR OF PHILOSOPHY Studies on micro algal fine-structure, taxonomy and systematics : cryptophyceae and bacillariophyceae. Novarino, Gianfranco Award date: 1990 Link to publication General rights Copyright and moral rights for the publications made accessible in the public portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from the public portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain • You may freely distribute the URL identifying the publication in the public portal ? Take down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim. Download date: 02. Oct. 2021 Studies on microalgal fine-structure, taxonomy, and systematics: Cryptopbyceae and Bacillariopbyceae In Two Volumes Volume I (Text) ,, ý,ý *-ýýI Twl by Gianfranco Novarino, Dottore in Scienze Biologiche (Rom) A Thesis submitted to the University of Wales in candidature for the degree of Philosophiae Doctor University of Wales (Bangor) School of Ocean Sciences Marine Science Laboratories Menai Bridge, Isle of Anglesey, United Kingdom December 1990 Lýýic. JýýVt. BEST COPY AVAILABLE Acknowledge mehts Dr I. A. N. Lucas, who supervised this work, kindly provided his helpful guidance, sharing his knowledge and expertise with patience and concern, critically reading the manuscripts of papers on the Cryptophyceae, and supplying many starter cultures of the strains studied here. -
Nanoplankton Protists from the Western Mediterranean Sea. II. Cryptomonads (Cryptophyceae = Cryptomonadea)*
sm69n1047 4/3/05 20:30 Página 47 SCI. MAR., 69 (1): 47-74 SCIENTIA MARINA 2005 Nanoplankton protists from the western Mediterranean Sea. II. Cryptomonads (Cryptophyceae = Cryptomonadea)* GIANFRANCO NOVARINO Department of Zoology, The Natural History Museum, Cromwell Road, London SW7 5BD, U.K. E-mail: [email protected] SUMMARY: This paper is an electron microscopical account of cryptomonad flagellates (Cryptophyceae = Cryptomon- adea) in the plankton of the western Mediterranean Sea. Bottle samples collected during the spring-summer of 1998 in the Sea of Alboran and Barcelona coastal waters contained a total of eleven photosynthetic species: Chroomonas (sensu aucto- rum) sp., Cryptochloris sp., 3 species of Hemiselmis, 3 species of Plagioselmis including Plagioselmis nordica stat. nov/sp. nov., Rhinomonas reticulata (Lucas) Novarino, Teleaulax acuta (Butcher) Hill, and Teleaulax amphioxeia (Conrad) Hill. Identification was based largely on cell surface features, as revealed by scanning electron microscopy (SEM). Cells were either dispersed in the water-column or associated with suspended particulate matter (SPM). Plagioselmis prolonga was the most common species both in the water-column and in association with SPM, suggesting that it might be a key primary pro- ducer of carbon. Taxonomic keys are given based on SEM. Key words: Cryptomonadea, cryptomonads, Cryptophyceae, flagellates, nanoplankton, taxonomy, ultrastructure. RESUMEN: PROTISTAS NANOPLANCTÓNICOS DEL MAR MEDITERRANEO NOROCCIDENTAL II. CRYPTOMONADALES (CRYPTOPHY- CEAE = CRYPTOMONADEA). – Este estudio describe a los flagelados cryptomonadales (Cryptophyceae = Cryptomonadea) planctónicos del Mar Mediterraneo Noroccidental mediante microscopia electrónica. La muestras recogidas en botellas durante la primavera-verano de 1998 en el Mar de Alboran y en aguas costeras de Barcelona, contenian un total de 11 espe- cies fotosintéticas: Chroomonas (sensu auctorum) sp., Cryptochloris sp., 3 especies de Hemiselmis, 3 especies de Plagio- selmis incluyendo Plagioselmis nordica stat.