Trinity College Dublin. The University of Dublin. UNDERGRADUATE COURSES, 2012. www.tcd.ie

Copies of this publication are available free of charge from The Admissions Office Regent House Trinity College Dublin 2, Ireland Telephone: +353 1 896 4444 Fax: +353 1 872 2853 Email: [email protected] Website: www.tcd.ie/admissions/undergraduate

The Board of Trinity College is not bound by errors in or omissions from this publication UNDERGRADUATE COURSES 2012

UNDERGRADUATE COURSES 2012 www.tcd.ie Welcome from the Provost

programme. You will learn to think for yourself, to learn from your mistakes, and refine your mind to be able to manage whatever the changing world may throw at you. These skills are for life.

Located in the heart of Ireland’s busy capital city, TCD students can avail of the many attractions and facilities Dublin has to offer. The campus’s state-of-the-art facilities include a modern Sports Centre, the Science Gallery – which is the first of its kind in the world, and the Trinity College Library, the largest research library in Ireland. In addition to collections gathered over four centuries, the College has had 200 years of legal deposit, allowing Trinity College to claim a copy of every book published in Ireland and the UK. It is also home to an extensive collection of manuscripts, the most famous being the Book of Kells.

I hope that you will consider joining us as a student at Trinity The ‘Trinity Experience’ is a chance in a lifetime for personal College Dublin. development in the broadest sense. Trinity College has many diverse and colourful societies and clubs which contribute much Trinity College Dublin is recognised internationally as Ireland’s to the life and fabric of the University and community. There premier university and as one of the top universities in the are some 50 sports clubs and almost 100 student societies world*. Founded in 1592, it is the oldest university in Ireland. to participate in, with something to suit all interests. Today the College has a vibrant community of 16,837 students representing every county in Ireland, 122 nationalities, and a Committed to excellence in teaching, research and innovation, wide range of social backgrounds and age-groups. Some of Trinity College Dublin guarantees a distinctive all-round the most famous people in Irish history have been educated undergraduate experience that will change your life forever. at Trinity College; writers like Oscar Wilde and Samuel Beckett; As a student you feel a great sense of history, of walking in scientists like William Rowan Hamilton and E.T.S. Walton, who the footsteps of famous graduates, many of whom have and won the Nobel Prize for his work on the atom, as well as two are helping shape the history of Ireland and the wider world. Irish presidents and many industry leaders. I hope you will consider joining us to study here and look forward to welcoming you on campus for an exciting new journey that Trinity College has a number of important priorities for its will open your mind to new experiences, ways of thinking and students. Each incoming student is assigned a Tutor, a member friendships, many of which will last for a lifetime. of the academic staff, who is there to advise you and help if any personal problem arises. This tutorial system is unique in Ireland. In addition, a student-to-student mentoring programme for first year students has been initiated. Other high quality student services include the Careers Advisory Service. There are also Patrick Prendergast possibilities of studying abroad in other leading universities Provost through Trinity College’s partnership agreements. July 2011 Students benefit from a scholar-teacher model where you have the opportunity of being taught by world-leading experts in their * Trinity College Dublin is ranked in 52nd position in the top 100 world field. Offering a unique educational experience across a range universities and 15th position in the top European universities by the QS of disciplines in the Arts, Humanities, Engineering, Science, World University Rankings 2010. In the Times Higher Education World Human, Social and Health Sciences, TCD’s curriculum is aimed University Rankings, TCD is ranked 76th in the top 200 world universities and 14th in the top European universities. not just at acquiring knowledge but at developing critical thinking and facilitating research at every stage of the undergraduate Fáilte ón bPropast

Tá súil agam go smaoineoidh tú ar theacht go Coláiste na Agus an Coláiste suite i gcroílár phríomhchathair ghnóthach na Tríonóide mar mhac léinn. hÉireann, is féidir le mic léinn teacht ar na háiseanna agus nithe spéise go léir atá ar fáil i mBaile Átha Cliath. I measc áiseanna Tá aitheantas idirnáisiúnta bainte amach ag Coláiste na úrscothacha an champais, tá ionad spóirt nua-aimseartha, an Tríonóide mar an ollscoil is fearr in Éirinn, agus mar cheann tÁiléar Eolaíochta (an chéad tionscnamh dá leithéid ar domhan), de na hollscoileanna is fearr ar domhan*. Bunaíodh Coláiste agus Leabharlann Choláiste na Tríonóide, an leabharlann na Tríonóide sa bhliain 1592. Is é an ollscoil is sine in Éirinn é. taighde is mó in Éirinn. Anuas ar bhailiúcháin éagsúla a cuireadh Tá pobal bríomhar 16,837 mac léinn againn, as gach contae le chéile thar 400 bliain, tá cnuasach dlíthiúil 200 bliain ag an in Éirinn, as 122 tír, agus ó chúlraí sóisialta agus aoisghrúpaí gColáiste, agus an ceart aige cóip a fháil de gach leabhar a éagsúla. Fuair roinnt de na daoine is iomráití i stair na hÉireann fhoilsítear in Éirinn nó sa Ríocht Aontaithe. Tá bailiúchán leathan a gcuid oideachais i gColáiste na Tríonóide – scríbhneoirí cosúil lámhscríbhinní sa Choláiste, ina measc an lámhscríbhinn is le Oscar Wilde agus Samuel Beckett, eolaithe cosúil le William cáiliúla acu, Leabhar Cheanannais. Rowan Hamilton agus E.T.S. Walton (a bhuaigh duais Nobel as an obair a rinne sé ar an adamh), maille le beirt d’Uachtaráin na Soláthraíonn Coláiste na Tríonóide deis iontach don fhorbairt hÉireann agus neart cinnirí tionscail. phearsanta. Tá a lán cumann agus clubanna spleodracha sa Choláiste, a chuireann go mór le saol agus le bríomhaireacht na Tá roinnt tosaíochtaí tábhachtacha againn dár gcuid mac léinn. háite. Tá breis agus 50 club spóirt agus nach mór 100 cumann Ceaptar Oide do gach mac léinn, ball den fhoireann acadúil a againn, agus ábhar spéise do chách iontu. chuirfidh comhairle ort agus a chuideoidh leat má bhíonn aon fhadhb phearsanta agat. Níl a leithéid le fáil in aon ollscoil eile Agus muid tiomnaithe don sár-chleachtas múinte agus taighde in Éirinn. Agus tá córas nua meantóireachta ‘mac léinn go mac araon, cuirtear eachtra fochéime den scoth ar fáil anseo, eachtra léinn’ againn, trína dtugann mic léinn eile treoir agus tacaíocht a athróidh do shaol. Mar mhac léinn sa Choláiste, braithfidh do mhic léinn úra. Tá an tSeirbhís Ghairmthreorach ar cheann tú an stair i do thimpeall agus tú ag leanúint lorg na gcéimithe eile de na seirbhísí ardchaighdeáin a chuirimid ar fáil do mhic cáiliúla a d’imigh romhat; céimithe a chuir (agus a chuireann) léinn. Tá féidearthachtaí ann freisin le staidéar a dhéanamh le stair na tíre seo agus le stair an domhain. Tá súil agam go thar lear i bpríomhollscoileanna eile a bhfuil comhaontú dtiocfaidh tú anseo mar mhac léinn, agus beidh mé ag súil le comhpháirtíochta acu linn. fáilte a chur romhat ar an gcampas agus tú ag cur tús le haistear iontach, a osclóidh d’intinn ar eispéireas nua, bealaí agus An cur chuige atá againn anseo i gColáiste na Tríonóide ná gur modhanna smaointe úra, agus a sholáthróidh deiseanna úra scoláire agus múinteoir gach léachtóir. Sa chaoi seo, bíonn deis cairdis duit, roinnt mhaith acu a rachaidh chun tairbhe duit ar foghlaim ó ard-shaineolaithe domhanda sna réimsí éagsúla. feadh do shaoil. I gColáiste na Tríonóide, cuirimid oideachas den scoth ar fáil thar réimse disciplíní: sna hEalaíona, sa Sruithléann, san Innealtóireacht, san Eolaíocht agus sna hEolaíochtaí Daonna, Sóisialta agus Sláinte. Ní ar bhailiú eolais amháin atá curaclam an Choláiste dírithe, ach ar an smaointeoireacht chriticiúil a Patrick Prendergast fhorbairt agus an taighde a éascú ag gach leibhéal den chlár Propast fochéime chomh maith. Foghlaimeoidh tú conas smaoineamh as do stuaim féin, conas foghlaim ó bhotúin, agus conas d’intinn Iúil 2011 a mhúnlú chun gach rud a thiocfaidh i do threo a láimhseáil. Is scileanna buana iad na scileanna seo. * Tá Coláiste na Tríonóide, Baile Átha Cliath sa 52ú háit i liosta den 100 ollscoil is fearr ar domhan agus sa 15ú háit san Eoraip de réir shraithliosta QS d’ollscoileanna an domhain, 2010. I sraithliosta Times Higher Education den 200 ollscoil is fearr ar domhan, tá TCD ar an 76ú hollscoil is fearr ar domhan agus sa 14ú háit san Eoraip. Contents

General information Courses

Welcome from the Provost 4 Trinity College’s Location Arts, Humanities and Social Sciences 5 Student Life at Trinity College 5 Student societies 35 Arts courses at Trinity College – an overview 5 Sport at Trinity College 36 Ancient and medieval history and culture 6 Students’ Union 37 Business, economic and social studies (BESS) 6 An Ghaeilge/The Irish language 42 Business studies and a language 7 Trinity Publications (French, German, Russian, Polish or Spanish) 7 Trinity College theatres 44 Classics 7 Gallery 46 Clinical speech and language studies 7 Restaurants and coffee shops 120 Computer science and business 8 Accommodation 48 Deaf studies 9 Student Support Services 51 Drama and theatre studies 9 Orientation for new entrants 53 Early and modern Irish 9 Personal tutor 55 Education 9 Peer mentoring programme 56 English studies 9 Careers Advisory Service 58 European studies 10 College Health Service 61 History General Information 10 Student Counselling Service 63 History and political science 10 Chaplaincy 65 Irish studies 10 Day nursery 68 Law 11 Mature students’ officer 71 Law with a language (French or German) 11 Access services 72 Law and business 11 Disability Service 74 Law and political science 12 Learning Supports 76 Music 12 Student Learning Development 78 Music education 12 Library 79 Philosophy 12 IT services for students 80 Philosophy, political science, economics and sociology 13 Optional courses 82 Political science 15 Find Out More About Trinity College 83 Political science and geography 15 Open days 2011 85 Psychology 15 Mature students information seminar 87 Social studies (Social work) 15 Mathematics/Physics open day 89 Sociology and social policy 15 Transition year programmes 90 World religions and theology 16 Nationwide careers fairs 16 School visits 92 Two Subject Moderatorship (TSM) – 16 Visiting Trinity College & Campus tours Choose two subjects 16 Trinity College websites 93 Ancient history and archaeology 17 Scholarships and Awards 95 Classical civilisation 19 How to Apply 51 Drama studies 24 Admission Requirements 2012 53 Early Irish Further Information 96 Economics 204 Index 56 English literature 207 Alert list – 2012 98 Film studies 208 Important dates for applicants 100 French

2 General Information 3 Admissions Office, Functional biology Genetics Geography Geology Immunology Microbiology Molecular medicine Neuroscience Physics Physics and astrophysics Physiology Plant sciences Zoology Occupational therapy Pharmacy Physiotherapy Radiation therapy Direct Entry (non-CAO): Bachelor in midwifery studies (part-time) Bachelor in nursing studies (part-time) Chemistry with molecular modelling Earth sciences Human genetics Mathematics Medicinal chemistry materials advanced of chemistry and physics Nanoscience, Theoretical physics Direct Entry (non-CAO): Information systems Dental hygiene Dental nursing Dental science Dental technology Human health and disease Human nutrition and dietetics Medicine Midwifery Nursing – general Nursing – general (Adelaide) Nursing – psychiatric Nursing – intellectual disability and general integrated Nursing – children’s Health Sciences Engineering, Mathematics and Science Engineering, Mathematics 192 194 196 198 199 200 160 161 163 164 166 167 169 171 173 174 176 178 179 180 181 186 188 188 188 188 188 147 148 149 150 151 152 153 154 155 155 157 158 159

Biochemistry Chemistry Environmental sciences Electronic engineering Electronic and computer engineering (joint programme) Mechanical and manufacturing engineering Civil, structural and environmental engineering Computer engineering Spanish religions and theology World Modern Irish Music Philosophy Psychology Russian Sociology History History of art and architecture Italian Jewish and Islamic civilisations Latin Mathematics Geography German Greek Science, with specialisations in: Engineering with management Mathematics and Science studies (MSISS) Engineering Engineering, with specialisations in: Computer science Computer science Computer science and business Computer science and language Management science and information systems Direct Entry (non-CAO): Acting Engineering, Mathematics and Science Engineering, Mathematics and Arts, Humanities and Social Sciences Arts, Humanities 90 79 85 53 76 61 119 116 113 115 112 110 144 146 139 143 135 136 131 132 133 126 129 122 124 120 164 106 107 109 103 104 101 This document is also available in alternative formats upon request. For further information contact the This document is also available in alternative formats upon request. For further College, Dublin 2. Phone: +353 1 896 4444, E-mail: [email protected] Regent House, Trinity Contents General Information Smithfield 4 minutes walkaway, Dublin’s maintwotrainstationsareinclose number ofDublin’s busroutes. The nationalbusroutesareafew lines, theDART line(Dublin’s suburbanrailsystem)andalarge for allformsofpublictransport,suchasLUAS(lightrailtransit) Trinity College’s centrallocationmakesithighlyaccessible of cobbledsquares,historicbuildingsandgreenplayingfields. Institute (seephotoonthispage),situatedina47-acrecampus centre, LongRoomHub,andthenewBiomedicalSciences the SportsCentre,ScienceGallery, Nanoscienceresearch Dublin’s citycentre.Itsstate-of-the-artmodernfacilitiesinclude Trinity CollegeDublin’s campusissituatedintheheartof Trinity College’s Location Four Courts 200 m 1000 ft DUBLIN CITY CENTRE The Four Courts Christchurch St. Patrick’s Cathedral Cathedral Dublin Castle Capel St Olympia Theatre

LUAS TO HEUSTON AND TALLAGHT Cineworld Cinema City Hall

TEMPLE BAR IFI Cinema

Aungier St Jervis

Sth Great George’s St Parnell St

Dame St Gaiety Theatre

Ambassador Theatre

Henry St

Abbey St LUAS TO SANDYFORD Savoy Cinema

Fleet St GPO SAINT STEPHEN’S

GRAFTON ST www.tcd.ie/virtualtour. Take avirtualtourof Trinity College’s campus: a wonderfulsociallifewhilestudyingat Trinity College. scene inthecityandoncampusensuresthatstudentsenjoy walking distanceoftheCollegegates. The vibrantsocial cultural, historicalandentertainmentcentresarewithineasy leading citiesfortourismandentertainment.Manyofitsbest Dublin hasawelldeservedreputationasoneofEurope’s is directlyaccessibleviabusortaxi. proximity, whileDublinairportis13kmfromthecampusand

GREEN O’CONNELL ST Abbey Theatre

Nassau St Nassau Abbey St Abbey

College St WestmorelandSt D’Olier St The ComedyTheatre

Dawson St

Cinema Screen

Talbot St

Trinity College’s newBiomedicalSciencesInstitute. Leinster St South St Leinster

Tara St

Kildare St Pearse St Pearse Leinster House Tara St Station Custom House

Gardiner St Townsend St Townsend Bus Station Busáras National Gallery

Amiens St Merrion St Connolly IFSC

Westland Row Station

MERRION SQUARE RIVER LIFFEY RIVER Station Pearse DART

General Information 5

Aikido, American Football, Badminton, Aikido,

Sport at Trinity College Sport at Trinity and develop communication, organisation, leadership, financial financial leadership, organisation, communication, develop and and administrative skills. Sport Clubs include: Basketball, Boxing, Camogie, Climbing, Cricket, Croquet, Cycling, Equestrian, Fencing, Gaelic Football, Golf, Handball, Athletics, Judo, Karate, Kayak, Kenpo, Lawn Harriers and Sailing, Snowsports, Netball, Orienteering, Rifle, Rugby, Tennis, Tennis, Table Aqua, Surfing, Swimming, Squash, Sub Soccer, Ultimate Frisbee, Volleyball Triathlon, Trampoline, Kwon Do, Tae and Windsurfing. +353 1 896 1502 Tel: E-mail: [email protected] www.tcd.ie/sport Website: For details of Sports scholarships see page 17. and personal development. It is a great way to meet people belonging and dedication while contributing to team success Trinity College now boasts a state-of-the-art Sports Centre on College now boasts a state-of-the-art Trinity The Sports number of outdoor sports sites. campus along with a array of facilities, including a swimming Centre includes a vast rooms, fitness theatre, holistic treatment pool, sauna and steam The main hall hosts a range of sports including rooms etc. volleyball and 5-a-side soccer. basketball, badminton, squash courts, tennis courts, a futsal pitch, Also on-campus are track in and cricket pitches and a grass athletics soccer rugby, the summer. vibrant programme of recreational classes is organised A enthusiasts can throughout the year in which all level of sports Power Pump, Pilates, take part. Options include Studio Cycling, a great opportunity to maintain a This is Circuits and much more. Trinity. at healthy and fun-filled lifestyle whilst studying miles upstream from the College is a boathouse Two Boat Clubs and at Santry and Mens’ accommodating the Ladies’ five miles north of the campus, there are additional Avenue, and gaelic games. hockey soccer, pitches for rugby, provides membership athletic club (DUCAC) The University’s DUCAC prides itself on clubs. to approximately 50 different and commitment to catering for everyone, whatever your level stars. sport, from beginners to international sports successful in teams were Trinity At intervarsity level last year, Fencing, Squash, a number of sports including Gaelic Games, winning third American Football, as well as Orienteering and In addition, level league titles in Badminton and Volleyball. Boat Club and Ladies Boat Club captured the ‘Best the Men’s title at the Irish University Championships and a University’ significant number of students achieved individual success at regional and national levels, in their chosen sport. intervarsity, Clubs are run by students and these give a sense of

Student Life at Trinity College Trinity Life at Student Student societies Find out more about Trinity Colleges student societies at: Colleges student Trinity Find out more about You can try your hand to everything from singing to sci-fi, can try your You and politics juggling to jazz, alternative music to amnesty society or de-stress in a Yoga to paintballing, relax with the way with the arts and craft activities run by the likes different the array of society stands in Front Square cannot miss You but never fear if you don’t make it during Orientation Week in – societies are open to new members throughout the year. There is something for everyone from societies like the There is something for and the College Historical Society with Philosophical Society tradition and impressive list of their established debating in the past year Michael Gambon, guest speakers (including Alastair Campbell, Rupert Everett, Gordon Brown Stephen Fry, society who hold to name but a few), to the Players (drama) most productive making it the approximately 50 shows a year, still organising theatre company in the UK and Ireland, while and the Fringe Festival Trinity large scale events such as the Society, can join the Filmmakers You Oscar Wilde Festival. who each have TV or the Photography Society Trinity FM, Trinity broadcast a studio on campus and hold regular screenings, weeks, exhibitions and classes respectively. and offers Joining societies is an ideal way to meet people life. Trinity to invaluable support as well as an introduction you, you if you don’t find a society that interests However, can always set one up yourself! There is more to the Trinity experience than lectures and study. experience than lectures and study. Trinity There is more to the of student life is the range of activities One of the core elements societies, Trinity Almost 100 for students. organised by students of interests, constitute the most dynamic covering a broad range student societies in Ireland. and active set of university Arts Workshop. Trinity of the www.trinitysocieties.ie General Information 6 For moreinformationvisit that youwilluseit! Times orbybeingontheEntscrew. It’s yourunion,sowehope easy togetinvolvedasaclassrep,bywritingfor The University All studentsareautomaticallymembersoftheunionandit’s very Students inIreland(USI). Council. The Students’ Unionisalsoaffiliatedtotheof College committeesincludingtheBoardandUniversity The officersoftheunionrepresentstudentsonmanyimportant and actingasalinkbetweenstudentsofficers. organises classpartiesaswellhelpingwithstudentproblems areas ofCollegeandeveryclasshasarepresentativewho Part-time officersworkonrepresentingandpromotingspecific international newsaswelllistings,reviewsandmore. Times –theunionnewspaperandsource of Trinity, nationaland publication anddistributionofthemulti-awardwinningUniversity officer. TheCommunicationsofficerisresponsibleforthe Welfare officer, CommunicationsofficerandEntertainments officers everyyear. Theseare:thePresident,Educationofficer, Five full-timesabbaticalofficersareelectedtoworkasunion the famous Trinity Ball. class parties,gigs,nightsout,mysterytours,comedyand organises acomprehensiveentertainmentprogrammeincluding assistance andadviceisavailabletostudents. The unionalso is aconfidentialwelfareserviceandacademic travel cardandinformationofficejoblistings. There of services,includingtwoshops,abookshop,café, of students. The Students’ Unionprovidesabroadrange all studentsin Trinity College.Itsroleistoworkonbehalf The Students’ Unionisthemainrepresentative bodyfor Students’ Union www.tcdsu.org

gaeloifig The IrishLanguageOffice/OifignaGaeilge(see programme ofsocialevents. Irish-language studentsocietiesinthecountry, withanexciting Gaelach (see see itinCollegeandstudentpublications.College’s Cumann You willhearitbeingspokenthroughoutthecampus andwill Irish isflourishingherein Trinity CollegeintheheartofDublin. eile. BainsultasdoshaoltríGhaeilgeigColáistena Tríonóide! imeachtaí, idirspóirt,díospóireachtaí,ceolchoirmeachaagus na Tríonóide –arsiúlfeadhseachtaine,leréimseleathan Sa daratéarma,bíonnféilemhórGaeilgeanCholáiste–Éigse nó níosairde). phríomhchampas anCholáiste,dodhaoineatásadarabliain tosú saCholáiste)agusScéimChónaitheanChampais(ar Chónaithe DhartraíiHallana Tríonóide (dodhaoineatáag dhá ScéimChónaitheGhaeilgeagainndomhicléinn: ag déanamhstaidéirarannGaeilgemarábharacadúil. Tá agus cuirtearfáiltearleithroimhmhicléinnúranachbhfuil Cuirtear rangannaGaeilgearfáilsaorinaiscedomhicléinn i Scéim Teanga anCholáiste. Leagtar amachgealltanaismaidirleseirbhísídátheangacha ó údaráisanCholáisteagusónÚdarásum Ardoideachas. Oifig agfeidhmiúigcomharleCoistenaGaeilge,tacaíocht comhairle athabhairtmaidirleisan Acht Teanga. Bíonnan an GhaeilgeachurchuncinnarfudCholáiste,maraonle Tá OifignaGaeilge(féach sóisialta arfáil. léinn isbríomhairesatír, achuireannclárspleodrachimeachtaí Gaelach (féach agus inuachtáinnamacléinn. Tá líonmórballsaChumann Choláiste. Tá sílefeiceáilibhfoilseacháinoifigiúlaanCholáiste gcroílár BhaileÁthaCliath,agusbíonnsíálabhairtarfudan Tá anGhaeilgefaoibhláthanseoigColáistena Tríonóide i experience! tours. EnjoytheIrishlanguage as partofyour Trinity College wide rangeofactivities–including sport,debates,concertsand Éigse na Tríonóide, takesplace. The programmefeaturesa In thesecondterm,College’s annualweek-longIrishfestival, the maincampus,forcontinuingstudents). for first-yearstudents)andScéimChónaitheanChampais(on residential schemes–ScéimChónaitheDhartraí(in Trinity Hall, academic course. Trinity CollegehastwoIrish-speakingstudent including thosewhoarenotstudyingIrishaspartoftheir Irish classesareavailablefreeofchargetoallstudents, out in TCD’s IrishLanguageScheme. Authority. Commitments inrelationtobilingualservicesareset the supportofCollegeauthoritiesandHigherEducation Gaeilge, Trinity College’s IrishLanguageCommittee,andwith Irish LanguageOfficeoperatesinconjunctionwithCoistena well asadvisinginrelationtotheOfficialLanguages Act. The An Ghaeilge/TheIrishlanguage ) promotestheIrishlanguageinCollegegenerallyas www.cumann.ie) isoneofthemostvibrant www.cumann.ie), ceanndenacumainnmac www.tcd.ie/gaeloifig www.tcd.ie/ ) annchun

General Information 7 www.tcd.ie/catering Restaurants and coffee shops Trinity College theatres College Trinity Gallery On-campus, students can choose from three restaurants (the historic Old Dining Hall, the modern Buttery Food Court and speciality coffee the Hamilton Restaurant) and three ‘Java City’ certified tea food outlets only serve ‘Fair-trade’ Trinity’s shops. For more information visit and coffee. wide selection of restaurants, cafés, In addition, Dublin city’s shops are within a few minutes walk of College. delis and coffee The Samuel Beckett Centre comprises the Samuel Beckett the Samuel Beckett Beckett Centre comprises The Samuel Players space), 208-seat black box performance Theatre (a a student drama society), studio theatre of the Theatre (the space, seminar rooms and offices. dance studio/rehearsal the Theatre showcases Samuel Beckett During term time the studies. It has also hosted visits from work of Drama and theatre dance and theatre companies from some of the most prestigious at and the United States. Regular events Ireland, Europe, Japan Theatre Festival, Theatre include the Dublin the Samuel Beckett series of lectures in contemporary theatre as well as an on-going by practitioners and scholars. Find out more at www.tcd.ie/Drama College, is Trinity within located The Douglas Hyde Gallery, The gallery art galleries. leading contemporary one of Ireland’s regularly hosts exhibitions from Ireland and by established artists abroad. at the Nassau The gallery was opened in 1978 and is located College. It is a non-profit making Trinity Street entrance to of Council Arts the and College Trinity by jointly funded company, whose reputation is firmly established in the The Gallery, Ireland. a diverse programme international contemporary art world, has distributed in of exhibitions, and its publications are widely and Activities such as tours, lectures Ireland and abroad. and discussion groups encourage audience participation also frequent film evaluation of the work on show; there are The Gallery has a small screenings and occasional concerts. magazines and bookshop which stocks a wide range of art catalogues of current and past exhibitions. can also be Admission to the gallery is free. Private tours arranged. Find out more at www.douglashydegallery.com or call +353 1 896 1116.

www.universitytimes.ie . www.universitytimes.ie Trinity Publications Trinity Find out more at http://trinitynews.ie We also welcome applications to start up new student We funding to cover print costs publications in College, and can offer software and the use of our industry-standard design and equipment. and www.trinitypublications.info The award-winning magazines and newspapers that constitute and newspapers that magazines The award-winning Trinity are supported by vibrant student media College’s Trinity TCD review), Icarus (literary These include Publications. Film Trinity The Piranha (satire), Miscellany (commentary), News (broadsheet newspaper), Trinity Review (film review), Trinity Publications celebrated alumni include author and Publications celebrated alumni include author and Trinity – McVey journalist Mark Little; Peter Murtagh and Eoin Paul McGuinness – Times; The Irish Managing Editors of Director of News Manager of U2; and Ed Mulhall – Managing 2011 was a successful year for Trinity Publications at the Publications Trinity a successful year for was 2011 Times with the University Awards, National Student Media of the year’winning ‘Newspaper for the second year in a row, Year’; of the Lowe, named as ‘Journalist Tom editor, and it’s of News won the ‘Editor Trinity editor of Aoife Crowley, while Publications included Trinity for award. Other awards Year’ the award Year’ of the ‘Best Magazine’, and the ‘Arts Feature Writer for Karl McDonald. to our publications. All students are encouraged to contribute The Attic, The Social and Political Review, and The Histories and The Social and Political Review, Attic, The to name but a few. and Humanities Journal, at RTÉ. General Information 8 Single en-suiteroom Single roomwithsharedbathroom Twin en-suite room Cost ofroomsinTrinity Hall2011/2012 more information. results arepublished.See afternoon andSaturdayin August aftertheLeavingCertificate Trinity HallOpenDaysin2012willbeheldontheFriday www.tcd.ie/gaeloifig/sceim-chonaithe/sceim-dhartrai Tuilleadh eolais/Forfurtherinformation,goto in Trinity Hall? speaking residentialschemeforJuniorFreshmanstudents you liketotakepartinScéimChónaitheDhartraí,anIrish scéim iHallana Tríonóide doluchtnachéadbhliana?Would Ar mhaithleatpáirtaghlacadhiScéimChónaitheDhartraí, a rangeofextra-curricularactivities. become membersoftheJuniorCommonRoomwhichorganises and arefittedonbedroomdoors.Residentsof Trinity Hallalso for security, electronicswipecardlocksareusedthroughout by lifts,electricappliancesaresuppliedinthekitchens,and room. All roomsarecentrallyheated,allfloorsserviced of singleandtwinen-suitebedroomswithalargekitchen/living typically accommodatingsixpersonsandconsistingofamix Rooms arearrangedinself-cateringapartments,witheach Trinity Hall number arereservedfornewentrantstoCollege. are over1,000residentialroomsat Trinity Hallandasignificant from Trinity CollegebybusandtheLUAStramsystem. There – about2.5milesfromthecitycentreandeasilyaccessible accommodated at Trinity HallwhichisinDartry, nearRathmines Hall ashortdistanceaway. Newentrantsarepredominantly There isaccommodationbothoncampusandat Trinity College isreceived. A supplementaryformwillthen besent Trinity College, Dublin2assoonanoffer toacourse at Trinity Registrar ofChambers, Accommodation Office, West Chapel, from studentswithspecialneeds shouldbeaddressedtothe applications willreceivespecial consideration. Applications College maybefacilitatedbytheprovisionofaccommodation, due tomedicalorotherparticularcircumstances,participation in difficulties andwhoarecapableofindependentliving.Where, rooms onthecampussuitableforstudentswhohavemobility year and Trinity Scholars(seepage17). There areanumberof Rooms oncampusaremostlyreservedforstudentsintheirfinal On-campus rooms accommodation/StudentsandStaff/Students/ApplyforaRoom may submitanapplicationfor Trinity Hallonlineat As soonasyouhaveacceptedaplacein Trinity Collegeyou How toapplyforTrinity Hall Accommodation www.tcd.ie/accommodation for

www.tcd.ie/ €5,061 €4,231 €3,882

PrivateRentedAccommodation accommodation/StudentsandStaff/UsefulInformation/ For furtherinformationandadvicesee lodgings (residinginaroomhousewithmealsprovided). Service mayalsobeabletogivesomeinformationondigsor so thatstudentsmaymakecontactwithlandlords. The Advisory guidance onwhattolookforwhenrenting.Phonesareprovided students wishingtosecurerentedaccommodationandoffers the Students’ Union.Itprovidesinformation andcontactsfor from late August tothebeginningoftermincooperationwith The Accommodation Advisory Serviceoperatesannually other students. accommodation, usuallysharinganapartmentorahousewith College accommodationthealternativeistoseekprivaterented For studentswhodonotapplyfororsecureaplacein Other optionsforfirst-yearstudents StudentsandStaff/Students/ApplyforaRoom Find outmoreatwww.tcd.ie/accommodation/ the web. relevant professionals,thisformcanalsobedownloadedfrom requesting informationfromamedicalpractitionerandother www.tcd.ie/ General Information 9 and , E-mail: [email protected], including support after graduation. programme offers The VACWORK further study options. during students the opportunity to secure work experience the summer before their final year. from our award- dedicated databases available exclusively winning website. completion application process including CV preparation, of application forms and the preparation of personal statements. abroad. Group and one to one guidance to help with career-planning Assistance with the search for internships, employment or Access to specialist careers information resources including Extensive training in all aspects of the further study or job Practice interviews on video. Development Ireland and of skills through volunteering in Peer mentoring programme Peer mentoring Advisory Service Careers

www.tcd.ie/careers Find out more at www.tcd.ie/careers . www.tcd.ie/community Phone: + 353 1 896 2438 n n n n n n The ‘Student 2 Student’ peer mentoring programme trains peer mentoring The ‘Student 2 Student’ with TCD students and then links them current undergraduate year students. groups of incoming first their ‘Peer Mentor’First-year students meet at the orientation in the first week of College, who are meeting in for their course support the academic year to offer then available throughout arise and assist students to integrate with any issues that may and enjoy College life. http://student2student.tcd.ie a range of services Advisory Service (CAS) offers The Careers making, and for, and resources to assist students in preparing future careers. implementing informed decisions about their

Student Support Services Support Student Personal tutor Orientation for new entrants Orientation for Find out more at www.tcd.ie/Senior_Tutor Tutors are members of the academic staff who are specifically of the academic staff are members Tutors appointed to tutorship to provide personal and academic support Their main function is to advise, to undergraduate students. listen to concerns, help tutees deal with issues as far as possible and refer more serious difficulties to the appropriate student students allowing provide a welcoming ear for Tutors services. them the freedom to talk confidentially about any issues which may arise. Each undergraduate student at Trinity College is assigned a Trinity Each undergraduate student at personal tutor on entry to College. at Trinity College. Also be sure to look up the Students’ Union Also be sure to look up the Students’ College. Trinity at the year. to find out what is happening throughout Trinity College has a vast array of clubs and societies for you to College has a vast array of clubs Trinity fantastic way to make They are a Week. join during Orientation a feel for the sense of community here new friends and to get During your first week in College (Orientation Week), Trinity Trinity Week), in College (Orientation During your first week to new a comprehensive orientation programme College offers meetings, The programme includes general orientation entrants. your course, library tours, sports tours, as specific meetings for about issues such as managing your well as advice sessions finances. 10 General Information n n n see www.hse.ie Executive foradviceregardinghealthcareprovision– a fulldegreeprogrammeshouldcontacttheHealthService All EUstudentsfromoutsidetheRepublicofIrelandpursuing Health careprovisioninIreland n n n registered students. The CollegeHealthServiceprovidesprimaryhealthcarefor Health ServiceExecutive–see

College HealthService Students without private health insurancewhowillbe Students withoutprivatehealth arenotentitledtofreenationalhealth Non-EU students themaEuropeanHealth shouldbringwith All EUstudents physiotherapy, clinicsin There arespecialised psychiatry, arefreeofchargewithmodestfees Student consultations andoccupational It alsofocusesonthepsychological to beassessedforentitlements. academic yearmayapplytotheHealthServiceExecutive resident inthecountryforaminimumperiodofone before leavingtheirhomecountry. cover forhospitalisationortoextendprivatehealthinsurance services inIreland,andareadvisedtotakeoutinsurance Insurance Cardissuedintheircountryoforigin. surgery. travel health,sexualeatingdisordersandminor aspects ofstudenthealthandeducation. for additionalservices. www.hse.ie

n n n n n n a rangeoffreeservicesto TCD studentsincluding: professional psychologistsandpsychotherapists.Itprovides The StudentCounsellingServiceisstaffed byqualified See www.tcd.ie/about/services/daynursery children ofdifferent agegroups. months to4.5yearsofage. There arefivedifferent roomsfor Trinity College’s daynurserytakescareofchildrenfrom3 n n n Find outmoreatwww.tcd.ie/Chaplaincy counselling For moreinformationandresources:

Chaplaincy Student CounsellingService Day nursery The ecumenical Chaplaincy team workcloselytogetherand Chaplaincyteam The ecumenical servicerunbystudents An after-hoursNitelinetelephone a HealthPortal, The OnlineMental TCD webcommunity Wellbeing Workshops e.g.self-esteemandresilience. Groups e.g.foranxiety, depressionandbereavement. forpersonaland Short-term individualcounselling During termtime,teaandcoffee areavailablealldayinthe A& eventsareorganisedduring variety ofworshipgathering It’smembers oftheCollege aplaceofhospitalityforall Catholic, Anglican, PresbyterianandMethodist. represent fourofthemainChristiantraditionsinIreland: counselling support: for obtainingselfhelpinformationandgettinganonymous psychological issues,includingadailyemergencyslot. always full! invited tocallinforlunchon Tuesdays –Comeearly, it’s Chaplaincy CommonRoom(House27)andstudentsare take placeweeklyinCollege. the year– Traditional, andnon-traditional,Christianservices community; studentsofallfaithsornonearewelcome. 9pm-2.30am. for students.Free-phone:1800793793, Thurs-Mon, https://mymindmatters.ie www.tcd.ie/student_ for furtherdetails.

General Information 11

, e-mail [email protected] www.tcd.ie/disability www.tcd.ie/disability/services/Unilink/index. ), a practical occupational therapy service available for php), a practical occupational therapy service who may be students registered with the Disability Service have a physical experiencing mental health difficulties or disability or a significant on-going illness. Syndrome. is available from life. Study skills and assistive technology solutions for Leavinglife. Study skills and assistive www.tcd.ie/pathways-to-trinity Certificate students: learning requirements. College libraries. programme materials. and outside Accommodation, Buildings, Examinations agencies. or by phone directly on +353 1 896 3111. UNILINK ( Asperger’s Specialist support service for students with Comprehensive information about of services the full range Pre-entry advice on admissions, course choices and College Needs assessment to determine any additional on entry Assistive technology training and technology rooms in Liaison with your tutors/lecturers to help arrange accessible An e-mail distribution list to keep you in touch. Extended library loans. Liaison with other University services such as Disability Service Disability

Students with a disability should follow the application process detailed on page 19. n n n Trinity College is committed to a policy of equal opportunity in to a policy of equal College is committed Trinity have as students with a disability and to ensuring that education life as can to all facets of College equitable access complete and This includes students with a physical, reasonably be provided. learning medical, mental health condition or specific sensory, on their ability to achieve academic goals. difficulty that impacts students includes: Support available to n n n n n n n

mature.student. www.tcd.ie/Trinity_ e-mail [email protected] or by phone a TAP scholarship, supported childcare scheme and the TAP TAP scholarship, supported childcare scheme and the TAP a hardship fund. (first-year) student is linked to a member of TAP staff, their staff, TAP (first-year) student is linked to a member of Advisors meet with students regularly and offer advisor. TAP advice, guidance and support and assist students with any also runs a number of TAP personal or academic issues. social activities throughout the year for students. (the week before Orientation Week). service, a writing resource centre and maths help room, and studio – a designated study space equipped with IT TAP the resources. to the start of term in September. students. applicants. each July. successful mature applicants Financial support (when available and applicable) including Academic supports including extra tuition, a laptop lending Social and personal supports – each Junior Freshman A tailored week long pre-university orientation programme A A week long orientation programme for mature student prior A student support drop-in clinics for registered mature Weekly One-to-one guidance support and for prospective mature Further Education visits College and presentations. An informationon preparing morning for College for all Access services Mature students officer Mature

Comprehensive information about the full range of TAP services TAP Comprehensive information about the full range of and supports is available from: web Access/current +353 1 896 2751 / 3598. [email protected] or visit www.tcd.ie/maturestudents For further information on studying in TCD as a mature student For further information on studying in please phone +353 1 896 1386, e-mail: n n n n These supports include: TAP (the Trinity Access Programmes) provide a range of Access Trinity (the TAP Progression supports and services through their Post-Entry These supports are available to students who Programme. TCD through the Higher enter undergraduate programmes in Young Access Route (HEAR), Foundation Courses for Education Access University Adults and Mature Students, and the CDVEC Plunkett College Courses (in partnership with Pearse College, and Liberties College). n n n n Supports include: n current mature students. Trinity College recognises the unique contribution and the unique contribution College recognises Trinity make to College academic that mature students commitment officer provides full-time mature students A life. and social to both prospective applicants and guidance and support 12 General Information n n n n n n n students reachtheiracademicpotential. The supportsinclude: Student LearningDevelopmentprovideslearningsupporttohelp n n n n

Library Student LearningDevelopment Learning Supports The Berkeley/Lecky/Ussher library complexcontains the library The Berkeley/Lecky/Ussher The library’s inanumberofbuildings, readingroomsare All ofthelibrary’s accessible by collectionsare Trinity printedvolumes,almost include4.5 million The collections Trinity College’s researchlibraryin libraryisthelargest ofthemodernlanguage isavailableinseveral Peer Learning include: Other supportsforlearninginCollege For moreinformationpleasevisit A includingpodcasts, arangeofresources websitewith yearonavarietyoftopicsfor throughoutthe Free workshops andself-helpliterature supportsessions Individual learning geology, andnursing, togetherwiththeMapLibrary. collections forarts,humanities, socialsciences,geography, right. All haveaccesstotheCollege wirelessnetwork. many ofwhicharearchitecturally distinctiveintheirown seeking specificadvice. workshops aswellareferenceserviceforindividuals Library staff offer programmesoftours,seminarsand courses aswellforpersonalresearchandinterests. College’s students,providinganunparalleled resourcefor largest collectionofmapsandprintedmusic. including theBookofKells. The library hasthecountry’s collection ofliterary, historicaland politicalmanuscripts, 300,000 electronicbooksandjournalsanextensive years. Legal DepositforUKandIrishpublicationsover200 foundation inthesixteenthcenturyandsupplementedby Ireland, withcollectionsbuiltupsincetheUniversity’s us forfurtherinformation:[email protected] the mostfromyourcoursetoimproveperformance.E-mail departments. Itinvolvesworkingwithotherstudentstoget l l skills, exams,academicwriting,presentationskillsandmore. support tostudents. Topics includetimemanagement,study downloads andinteractiveworkshopsthatprovideacademic postgraduate students. students fromalldepartments,includingundergraduateand on manylearningandstudystrategies. tcd.ie

The Programming Support Centre isavailabletoall SupportCentre The Programming provides informalhelp The MathsHelpRoom,which programming courses.See computer scienceandengineeringstudentstaking Monday-Friday, from1-2pm. Room, 2ndFloor, 18Westland Rowandisopenon from Trinity students.ItislocatedintheMathsSeminar www.scss.tcd.ie/misc/psc http://student-learning. Information SystemServicesdepartment. These include: wide rangeofcomputerfacilitiesandservicesprovidedbythe Undergraduate studentsat TCD areprovidedwithaccesstoa n n n n n n n n n n n

IT servicesforstudents Find out more about the Library at abouttheLibrary Find outmore isdelivered rangeoflibraryresources An increasing Ireland’s (1732)isoneof The OldLibrary greatestbuildings, isheldattheJohnStearne sciencematerial Clinical health holds thecollectionsfor ScienceLibrary The Hamilton Find out more at Find outmore All studentshaveaccesstotheISServices’ Helpdeskwhere roleinthelearning playsanimportant E-learning now At registrationeachstudentisissuedwitha Trinity College toprovideafast All studentresidencesarenetworked computerslocatedinover Access tohundredsofpersonal from home. electronically andstudentscanaccessthisoncampusor (entrance isfreefor Trinity Collegestudents). as providingapublicexhibitionspacewiththeBookofKells rooms formanuscriptsandearlyprintedbooks,aswell in theworld(seeinsidebackcover).Itcontainsreading and theLongRoomisoneofmostfamouslibraryspaces library atthe AMNCH Hospital, Tallaght. Medical LibraryatSt.James’s Hospitalandinthehospital sciences. engineering, mathematics,scienceandsomehealth a teamofIT professionals. queries regardinganyoftheaboveservicesaredealtwithby management system. many coursesareavailableintheCollege’s learning experience ofstudentsin Trinity College.Resourcesfor leaving Trinity College. hosted byGoogle.Studentsretainthisaccountforlifeafter e-mail account,togetherwitharangeofotherapplications, standards. to thisnetworkwhichisdesignedthehighestsecurity network. Studentsregistertheircomputerstogainaccess areas ofthecampus,haveWi-FiaccesstoCollege broadband service.Inaddition,someresidences,andmany lectures. students tochecktheire-mailandusethewebbetween web stationslocatedclosetolargelecturetheatresenable support particularcoursesorprojects.Dedicatede-mail/ Office, somecomputerroomshavespecialistsoftwareto In additiontothestandardsoftwarepackagessuchasMS of theseroomsareopenona24hour, 7dayweekbasis. twenty studentcomputerroomsacrossthecampus.Many isservices.tcd.ie www.tcd.ie/Library General Information 13 Optional language courses Optional (for students language courses in optional evening Some places are as part of their degree) studying a language who are not for Language take place at the Centre The courses available. to and are designed Studies (CLCS), and Communication communication skills for study or work help develop practical language modules may also be taken experience abroad. CLCS undergraduate students under the Broad for credit (5 ECTS) by Curriculum. modules are available: The following language (B1, B2); Spanish (A1, B1); Italian (A1, Irish (A1, B1); French A2); Korean (A1); (A1, Turkish B1, B2); A2, A2); German (A1, A2 classes are for for complete beginners; A1 level classes are and B2 level classes, the minimum entry post-beginners. For B1 qualification requirement is a Leaving Certificate (or equivalent) of places available for The number in the relevant language. may apply for optional first-year students is limited, but students College and credit-bearing language courses in subsequent years. Find out more at www.tcd.ie/slscs/undergraduate/clcs- language-modules Optional courses Optional Find out more at www.tcd.ie/Broad_Curriculum At the time of publication, Trinity College offers 17 broad College offers Trinity At the time of publication, language and curriculum modules in literature, film studies, political science, psychology, society (2 modules), philosophy, criminal law, development economics, living sustainably, and technology, business, planet earth, art in Ireland, science (2 modules). and history gender and society, To assist with the development of these qualities, Trinity College Trinity of these qualities, assist with the development To outside the opportunity to study one module students offers These Broad via the Broad Curriculum. their chosen course, are usually available to students in the Curriculum modules (third) year. Senior Freshman (second) or Junior Sophister for approximately The chosen module would typically account 10% of the teaching for the year. Broad Curriculum for the internationally of Dublin is renowned The University College is Trinity the degrees it awards. breadth and depth of the following qualities in its students dedicated to encouraging and analytical ability; creativity and graduates: inquisitiveness adaptability; breadth of reading; ethical and reflectiveness; outlook; articulacy; literacy; and responsibility; international numeracy. OPENOPEN DAYSDAY 2010 2011

FridayWednesday 2nd and 1 DecemberSaturday 3rd 9.00am December to 3.00pm2011

TheThe exciting and and informative informative programme programme of events ofwill events include: will include: n• CoursePresentations specific covering presentations most of Trinity College’s courses n Individual stands for each course, where • youPresentations can meet about our academicstudent sports, staff societies and current studentsand the Students’ to obtain Union detailed course information • Specific sessions for mature students, access n Demonstrations and laboratory tours students, parents, and guidance counsellors n• PresentationsIndividual stands about for each student course, sports, where you societies andcan meetthe Students’ academic staffUnion and current students and obtain detailed course information n Specific sessions for mature students, access • students,Demonstrations parents, and laboratoryand guidance tours counsellors n• Campus tours tours and and tours tours of College of College facilities, facilities, including the the sports sports centre centre

FullFull details details will will be be available available at at www.tcd.ie/Admissions/undergraduate www.tcd.ie/Admissions/undergraduate in late November.in late November. WEWE LOOK LOOK FORWARD FORWARD TO TO MEETING MEETING YOU YOU AT OUR ON OPENOPEN DAYS! DAY! General Information 15

for further details. ). Details on the various www.tcd.ie/Chemistry www.tcd.ie/Botany [email protected]. More information about the Physics outreach events The School of Physics hosts a number of Physics Year Transition The popular during the academic year. March of each Experience (TYPE) is held in November and Information is sent to all secondary schools academic year. inviting them to submit applications for selected students. Public lectures for secondary school students are also held The details are posted on the Science during Science Week. website (www.scienceweek.ie Week events can be found on the School of Physics website: Zoology Programme Year Transition a The Department of Zoology offers to introduce secondary school students to the exciting world of scientific research and teaching in our department. During your students and post- week with us you will get to meet our staff, graduates in a friendly and structured week of laboratory and related activities. See www.tcd.ie/Zoology/TY/index.php Botany hosts transition year students for The Department of Botany in a range of activities. Students week-long work experience what happens behind the scenes have the chance to experience environment, working alongside technical in an active research In students and professional scientific researchers. PhD staff, Botanic Gardens, students Trinity the addition to working at out various analytical techniques in have the chance to carry in the to extract DNA laboratory, the Environmental Sciences processing to assist with ecological sample molecular laboratory, soils, pollen, seeds, insects…) and to work (including samples of important Herbarium. In addition, transition in the internationally lectures students have the opportunity to attend selected students. Students and practicals with current undergraduate the Department seeking further information should contact directly via e-mail: Department can be found at Chemistry programme aimed The School of Chemistry hosts a week long The programme involves a series at transition year students. tours of the facilities. of lectures, practical work and interactive a unique opportunity for interaction with This course offers schools and for hands-on exposure to students from different Dates for advanced methodology in world-class laboratories. www.tcd.ie/Physics/outreach the 2011-12 TY programme will be announced on the School programme will be announced TY the 2011-12 of Chemistry website in autumn:

or www.physics.tcd.ie www.maths.tcd.ie www.tcd.ie/Biochemistry Find Out More About Trinity College About Trinity Out More Find Transition year programmes Transition Mathematics/Physics open day Mathematics/Physics open Mature students information information students Mature Open days 2011 seminar Biochemistry and Immunology The School of Biochemistry and Immunology runs two separate work-experience weeks for transition year students each There are 16 year – one in November and one in February. transition year interns in each cohort. Interns are selected from schools in order to maximise school participation and different geographical spread. Each intern spends half of the week in one laboratories, under the supervision of one of the of the School’s researchers, participating in the research activities that are lab’s group involves week the of rest The time. the at lab the in current activities with talks, quizzes and visits to other scientifically available on the Application forms relevant sites on campus. School website: for maths and physics graduates. We will also provide lunch for maths and physics graduates. We The Schools of Mathematics and Physics also organise a The Schools of Mathematics and Physics every year on a specific Mathematics/Physics open day This is a as part of ‘Science Week’. Saturday in November, maths or special event for students interested in studying welcome to attend. physics, parents and teachers are also very and lecturers on There are interesting talks by our professors complex numbers, topics like particle physics, string theory, lots of useful nanophysics or the physics of the sun, and opportunities information on how to apply and about career (a great time to meet the lecturers and students currently (a great time to meet the lecturers and students laboratories and College) and a tour of the Trinity studying in other facilities. See for more details closer to the date. A seminar providing advice and information on making an A mature students will take TCD for prospective application to This Thursday 12 January 2012 from 5 pm to 6 pm. place on Please visit the seminar will be repeated from 6 pm to 7 pm. information: more for 2011 December in website students mature . www.tcd.ie/maturestudents The staff and students of Trinity College would like to invite all College would like Trinity and students of The staff parents/guardians, mature students, final-year students, their counsellors to attend our Open Days, teachers and guidance 2 and Saturday 3 December 2011. which take place on Friday for further details. See the preceding page 16 General Information n n n To requestavisitpleasecontact: available. Statistics, Nursing&Midwifery, andEngineeringarealso Specific visitsfromourSchoolsofComputerscienceand [email protected] by telephoneat+35318963992ore-mail: your schoolpleasecontactthe Admissions LiaisonOfficer our rangeofcourses.Ifyouwouldliketorequestavisit of schoolstoprovideapresentationabout Trinity Collegeand Staff from Trinity Collegeareavailabletovisitalimitednumber see www.qualifax.ie. Counsellor inyourschool,localadulteducationcollege,or For detailsofcareersfairsinyourareacontacttheGuidance specific entryrequirementsandstudentlifeat Trinity College. prospectus andcanfindoutabout Trinity College’s courses, At theseeventsprospectivestudentscanobtaincopiesofthe careers fairsandatmanyotherregionaleachyear. Trinity Collegeisrepresentedatallofthe major nationwideIGC

School visits Nationwide careersfairs Tel: +35318961142 The School of Nursing and Midwifery (JeniRyan): NursingandMidwifery The Schoolof Engineering:E-mail: The Schoolof andStatistics: ComputerScience The Schoolof E-mail: [email protected], Tel: +35318963665 E-mail: [email protected], Tel: +35318963860 . [email protected]

, College’s applicationprocedures. applicants aremorethanwelcometodropindiscuss Trinity Monday-Friday from10.00-12.45and2.00-4.00.Potential inside thefrontentranceof Trinity College)andisopendaily, The Admissions OfficeislocatedinRegentHouse(whichjust book inadvance–pleasecontact+35318962320. and libraryexhibitionfreeofcharge.Itisadvisedthatgroups Library andsecond-levelstudentsmayvisittheBookofKells welcome atalltimes. The BookofKellsisondisplayintheOld The Trinity Collegecampusisanopenandvisitorsare +353 18963665. by e-mail:[email protected]: contact theSchoolofComputerScienceandStatisticsdirectly of theirteachingstaff on-campus.Forfurtherinformationplease offer smallgroupsofstudentstheopportunitytomeetmembers In addition,theSchoolofComputerScienceandStatisticsalso contact details. presentations arelimitedsopleasebookinearly!Seeabovefor visiting 5thand6thyearschoolgroups).On-campustours and acampustourfromthe Admissions LiaisonOfficer(for Guidance counsellorsmayrequestanon-campuspresentation Twitter: YouTube: www.youtube.com/trinitycollegedublin iTunesU: http://itunes.tcd.ie Facebook: www.facebook.com/trinitycollegedublin StudentsandStaff/Students/TrinityHall Accommodation: Student societies:www.trinitysocieties.ie Sports clubs:www.ducac.tcdlife.ie Student life:www.tcdlife.ie Virtual tour:www.tcd.ie/virtualtour Admissions: www.tcd.ie/Admissions/undergraduate Courses: www.tcd.ie/courses Main website: Trinity Collegewebsites tours Visiting Trinity College&Campus http://twitter.com/#!/tcddublin www.tcd.ie www.tcd.ie/accommodation/

General Information 17

training. Physiological assessment/fitness testing and follow-up to include Nutrition, etc. Psychology Workshops Financial grant. Foundation scholarships Foundation Sport scholarships

n n awarded to first- Scholarships are open to all sports and are they may however, year students and are tenable for one year, additional years. be renewed (on a yearly basis) for up to three the website listed Application forms may be downloaded from The closing date for applications is Friday 6 July 2012. below. further information For a full list of current sports scholars and Students in the Senior Freshman (second) year may compete Students in the Senior Up to seventy foundation scholars for a foundation scholarship. on the basis of performance in the are elected annually which is usually held in the week scholarship examination, term. Foundation scholars are entitled before the start of Hilary which include having their course fees to certain privileges, students pay EU fees), Commons paid by the College (non-EU an entitlement to College rooms free of (evening meal) free and Foundation scholarships are year. charge during the academic normally held for a term of five years. to sportsmen and Every year sports scholarships are awarded who come to sportswomen of national/international standard The scholarships provide College. Trinity study and compete for the following benefits: n on the programme, please contact the Department of Sport: +353 1 896 1502 Tel: E-mail: [email protected] www.tcd.ie/sport Website: www.tcd. . Sizarships are Scholarships and Awards and Scholarships Sizarships Entrance exhibitions Recipients of 2010 sports scholarships. Sizars are Entrance Exhibitioners of limited means who have Sizars are Entrance Exhibitioners of limited to be Application Commons (evening meal) free of charge. be made to considered for the award of a sizarship should Admissions Office on or before 1 October of the year of the Application forms may be downloaded from entry. ie/Admissions/undergraduate/apply/forms an undergraduate normally tenable for the first two years of course. Entrance Exhibitions are awarded to Junior Freshmen (first year) are awarded to Junior Freshmen (first year) Entrance Exhibitions is shown in public new entrants provided that sufficient merit the form of a book examination results. Each exhibition is in and their parents/ prize worth €300 over two years. Exhibitioners term. guardians are invited to attend a ceremony during their first their post-primary The schools in which exhibitioners received education are informed. students of limited means. Although financial assistance is not students of limited means. students, there are exhibitions that normally given to first-year For students in later years provision is you may be entitled to. should You Assistance Committee. made through the Financial College for more Trinity you come to consult your tutor when information. Since its foundation in 1592, Trinity College has sought to assist College has sought to Trinity in 1592, Since its foundation 18 General Information (c) (b) (a) Students noteligiblearethosewho: public examinationresultsandaretenablefortwoyears. They aregrantedtoqualifiedcandidatesonthebasisoftheir the highereducationgrantandwhoarenativesofcountyKerry. open onlytostudentsoflimitedmeanswhoarenoteligiblefor sizarships. The awards,whichdonotexceedfiveinnumber, are testament ofthelateRichard Touhill Reidtofoundadditional In 1888,thesumof£6,200wasreceivedunderwilland Tel: +35318964444,E-mail: the Admissions Office,RegentHouse, Trinity College,Dublin2. all theawardsavailablein Trinity Collegemaybeobtainedfrom Booterstown and Alexandra School,Dublin. A bookletsettingout Mount Temple Comprehensive,Dublin;St. Andrew’s College, Abbey School, Tipperary; PortoraRoyalSchool,Enniskillen; Prizes areavailabletostudentsfromthefollowingschools: than 31Mayoftheproposedyearentry. addressed tothe Admissions Officetoarrivenotlater Admissions/undergraduate/apply/forms andshouldbe Application formsmaybedownloadedfrom further years. sufficient merit,mayhavetheirexhibitionsextendedfortwo to obtainsuchscholarships,butaredeemedhaveshown normally competeforFoundationscholarships. Those whofail During theSeniorFreshman(second)year, exhibitioners supplied withalaptopandreceivesalaryof€6,000perannum. Exhibitioners havetheirCommons(eveningmeal)free,are Reid entranceexhibition School prizes have completed their nineteenth yearbefore1May theirnineteenth have completed OR ofanychartereduniversity are graduates OR Freshman(firstyear) standingofJunior are abovethe of theyearinwhichtheycompete. [email protected] www.tcd.ie/

week ofteachingterm. There isnopre-applicationprocess. informed ofthedecision committee bytheendoffirst before theselectioncommittee is thenmade. All candidatesare Square duringOrientationWeek; anappointmentforaudition Application ismadeinpersonattheChapelChoirdeskFront their homeuniversities. opens upanelementofUniversitylifenotavailabletothemin International studentsfindthatmembershipoftheChapelChoir is anadvantageandtheabilitytoreadmusicessential. scholarship shouldnotethatsomepreviouschoralexperience or nonearewelcome. Those considering applyingforachoral a religiousorganisation:applicantsofanyfaith,denomination College andUniversityservices.However, thechoirisnotitself services duringeachweekoflecturetermandvariousspecial performs inaliturgicalcontext. The choirsingsattworegular Choir: amixed-voicechoirofabouttwenty-fivesingerswhich The choralscholarsformthecoreandleadershipofChapel for allvoicestheyear2012/13. Eight choralscholarshipsvaluedat€1,300areavailable in consultationwiththeDepartmentofMusicCommittee. year foratwo-yearperiodatthediscretionofHeadMusic Taylor toprovideanEntranceExhibitionbeawardedeach This exhibitionwasfoundedin1978byagiftfromMrs.Eileen Trinity College ChapelChoir Choral scholarships – – scholarships Choral Taylor exhibition

General Information 19

order to seek supporting documentation regarding their order to seek supporting status (EU/non-EU). changed during a programme for which he/she is registered. changed during a programme The Admissions some applicants in Office may contact The registered status (EU/non-EU) cannot be student’s A All other applications are considered to be non-EU All other applications 23 for further information). applications (see page a quota of places allocated to applicants on a reduced points All applicants must meet the Irish College Dublin. Trinity basis in Leaving Certificate (or equivalent) matriculation/minimum entry and subject requirements, see page 24. and universities as clear evidence shows that disability can have a negative impact on how well a student does at school and whether they go on to college. School leavers who meet the eligibility criteria compete for Tel: +353 1 896 4444, Fax: +353 1 872 2853 Tel: E-mail: [email protected] www.tcd.ie/Admissions/undergraduate Website: Applicants with a disability Students may require particular supports or reasonable accommodations due to a disability or specific learning difficulty; has notification College Trinity therefore it is important that of these requirements in advance of admission to College. Disclosure of a disability or specific learning difficulty will not your application in any way. adversely affect Access Route to Education (DARE) Disability Access Route to Education (DARE) is a The Disability supplementary admissions scheme for school leavers with disabilities. DARE has been set up by a number of colleges 5 6 EU enquiries applicants concerning undergraduate All enquiries from EU addressed to: admission should be Trinity College, Dublin 2 Admissions Office, Regent House, The

for three Member 2 2 2 2 www.cao.ie state and has received

2 in the EU 3 in the EU 4 1 official refugee status been granted humanitarian leave to remain in the State who will have received full-time post primary education who has worked full-time OR AND/OR

all full-time post primary education in the EU of the five years immediately preceding admission to Trinity of the five years immediately preceding admission to College in lieu of full-time employment. receipt of social welfare payments this may be taken State for three of the five years prior to the student’s entry State for three of the five years prior to the student’s College. Trinity to been allowed to come to Ireland as part of the family re-unification scheme may also be eligible. also have been ordinarily resident (that is – principal residence for the purpose of taxation) in an EU n n to Trinity College Trinity to n n or Switzerland. Applicants who have written confirmation that they have EU or EEA countries (Norway, Iceland and Lichtenstein) Iceland countries (Norway, EU or EEA Where an applicant can show that they have been in For students aged under 23, the student’s parent(s) must For students aged under 23, the student’s who has and who has been ordinarily resident in the EU OR who holds a passport from an EU OR AND admission for three of the five years immediately preceding who is ordinarily resident How to Apply to How EU applicants Notes: 4 3 2 1

3

2

Am I an EU applicant? An EU applicant is a person: 1 Applications may be submitted online: Applications may be Office (CAO) Applications The Central Applications to Medicine must be submitted online. Note: Application for admission (except where otherwise stated) Application for admission See page 208 Applications Office. Central the made to should be for application deadlines. application forms may be obtained from Alternatively, your school or from: House, Eglinton Street, Galway Tower +353 91 509 800, Fax: +353 91 562 344 Tel: 20 General Information for furtherdetails.Pleasenote: See www.tcd.ie/Admissions/undergraduate/apply/eu/disability of theirintendedcourse. mathematics, wheremathematicsdoesnotformanycomponent exemption fromthematriculationrequirementofapassin In addition,studentswithdyscalculiamaybeeligibletorequest may applyforawaiverofthemodernlanguagerequirement. Students withspecificlearningdifficultiesandhearingdisabilities Language ormathematicswaiver contact theDisabilityServiceon018963111. Building, Trinity CollegeDublin. To reserveaplaceplease Wednesday 25January2012,from6pm–8pminthe Arts In addition,aDARE Application Clinicwillbeheldon eu/disability www.cao.ie; www.tcd.ie/Admissions/undergraduate/apply/ Information canalsobefoundon: Guidance CounsellorortheDisabilityOffice(seebelow). More InformationonDAREisavailablefromyourschool More Information service. Disability Serviceandagreeonascheduleofmeetingswiththe Students whoreceiveaDAREoffer mustregisterwiththe Condition ofaDAREOffer 3. 2. 1. How to Apply toDARE? page 25. students havedifferent admissionsroutes,seebelowand course duetotheimpactofadisability. MatureandFETAC education butwhomaynotmeetthepointsfortheirpreferred 2012) whohavetheabilitytobenefitfromandsucceedinhigher DARE isforschoolleavers(under23yearsoldasof1January Who Should Apply toDARE? 2. 1. Instructions will be given about thecompletionandreturn Instructions willbegivenabout 2012,youmustdisclose No laterthan17:15on1March Apply toCAOby17:15on1February2012. Students should be aware that thecriteriaforwaiving the beawarethat Students should theDAREsupplementary applicationto This isaseparate on 1 April 2012. of SectionsBandCtheSIFtoarriveatCAOby17:15 automatically eligiblefortheDARE scheme. of alanguagewaiverdoesnotmean thatastudentis required fortheDAREscheme. Therefore thegranting language ormathematicsrequirement aredifferent tothat before 1Julyoftheyearentry. the Admissions Office,RegentHouse, Trinity CollegeDublin admissions processandwrittenapplicationmustbemadeto completed SIFby17:15on1March2012. scheme, youmustindicatethisonSection A ofthefully CAO application).IfyouwishtobeconsideredfortheDARE Supplementary InformationForm(theSIFisapartofyour application andfullycorrectlycompleteSection A ofthe your disabilityand/orspecificlearningdifficultyinCAO www.accesscollege.ie ,

you must: In ordertoapply Trinity Collegeasamatureapplicant and knowledgeoftheircoursechoice(s). In addition,allapplicantsshoulddemonstrateaninterestin to thecourse(s)thattheywishpursue. how relevanttheirlife,workandeducationalexperiencesare points), butareconsideredinthefirstinstanceonbasisof meet competitiveacademicentrylevels(e.g.LeavingCertificate the normalmatriculationrequirementsandarenotrequiredto applicants. Maturestudentapplicantsarenotrequiredtosatisfy All undergraduatecoursesin Trinity Collegeareopentomature Mature students Website: www.tcd.ie/disability E-mail: [email protected] Phone: +35318963111 member oftheDisabilityServicestaff byphoneore-mailat: on professionalpracticeafterqualification,pleasecontacta in relationtoyourdisabilityandthedemandsofacourse,or If youwishtoclarifyanyissuesorconcernsmayhave Further information available, placesareawardedonmerit. Where demandforplacesexceedsthenumberof Allocation ofplaces n n n n April. Interviews areusuallyheldbetweenmid-Marchandtheendof Applicants toallcoursesmayberequiredattendaninterview. maturestudents/apply The formsarealsoavailabletodownloadat Regent House, Trinity College, Dublin 2. Tel: +353 1 896 4444. be obtainedfromandreturnedtothe Admissions Office, Mature StudentSupplementary Application Formsshould CAO applicationsmaybemadeonlineat please retainproofofpostage. students. IfpostingyourapplicationformtoTrinity College Late applicationswillnotbeconsideredfrommature

submit a Trinity StudentSupplementary CollegeMature totheCentral submit aCAOapplicationform Applications be atleast23yearsofageon1January2012. 19). (seepage be anEUapplicant 2012. exception ofnursing)tothe Admissions Officeby1February Application Form(requiredforallCAOcourseswiththe Office (CAO)by1February2012. www.cao.ie. www.tcd.ie/

General Information 21 . . . www.cao.ie 1 March 2012 1 February 2012 Step 3 Submit relevant evidence in support of your application to arrive . April 2012 at CAO by 17:15 on 1 HEAR applications can only be made online at The Higher Education Access Route (HEAR) is a third-level Access Route (HEAR) is The Higher Education 23 years of admissions scheme for school leavers (under backgrounds. age), from socio-economically disadvantaged of Higher Education HEAR has been established by a number Institutions based on clear evidence that socio-economic educational achievement on negative impact a disadvantage has at school and progression to higher education. supporting financial School leavers who provide the necessary circumstances and documents relating to their socio-economic entry meet the Irish Leaving Certificate matriculation/minimum are eligible requirements and any course specific requirements to compete for a quota of places allocated to applicants on a TCD. reduced points basis in Who should apply to HEAR? HEAR is for school leavers (under 23 years old as of 1 January admission, students have different 2012). Mature and FETAC see pages 20 and 25. How to apply to HEAR? Step 1 Apply online to CAO by 17:15 on Step 2 Indicate that you wish to apply to HEAR and finalise all elements of your HEAR online application by 17:15 on Access initiatives Access to initiatives co-ordinates Programmes (TAP) Access Trinity The whose at third-level of students participation facilitate increased prevented experiences have and educational social, economic potential. realising their full academic them from partnerships with designated has developed TAP Since 1993, and second-level schools in the Inner- disadvantaged primary Through a variety of pre-entry area. City and greater Dublin to promote positive attitudes to aims TAP outreach initiatives, and the community at large, and to education within families of students who complete their second- increase the number proceed to third-level education. level education and who activities for students, also organises over thirty annual TAP including summer programmes, teachers and parents awards, maths and science exploration educational achievement evenings and programmes, student shadowing days, parents’ College, as well as preparatory foundation Trinity early visits to courses for third-level. of all ages a range of application routes to students offers TAP a writing resource and various post-entry supports including and a designated centre, peer tutors, a laptop lending service resources. study space equipped with IT Route (HEAR) Access Higher Education

Nursing Careers Centre written assessment Nursing Careers Centre ). (see www.nursingboard.ie to the first year of the five-year full-time degree programme. to the first year of the five-year full-time complete the Mature applicants will also be required to period – Ireland admissions test within the 2-year HPAT Additional criteria will immediately preceding admission. apply. aptitude test. management and Computer science courses are required courses are required and Computer science management or mathematics HC3 in Leaving Certificate to present equivalent. information for further details). entrance test (see course Mature applicants for Medicine admission are considered for Applicants to Music will be requiredApplicants to Music will to attend a written will be requiredApplicants to Nursing to sit the will beApplicants to Psychology required to attend an Applicants to Engineering, MSISS,Applicants Engineering with may be requiredApplicants to English to write an essay.

Mature Student information seminar: see page 15. For further information on studying in TCD as a mature student For further information on studying in +353 1 896 1386, phone please contact the mature student officer, e-mail: [email protected] or visit www.tcd.ie/ maturestudents An information session on preparing for College will take place An information session on preparing for College An orientation 2012. for all successful mature applicants in July will take place in programme for all successful mature applicants September 2012. Trinity College will inform mature applicants of the outcome College will inform mature applicants of the outcome Trinity to allow successful of their application before the end of May prepare for the start of applicants the maximum time possible to to successful applicants the academic year 2012. Official offers secure your place To are made through the CAO in early July. to the CAO by the you must return a formal acceptance notice specified reply date. Please refer to the Mature Students Guidelines booklet, Please refer to the Mature Students Guidelines on additional available with the application form, for information assessments for specific courses. n n n n n n Certain courses may also require applicants to meet other applicants to meet may also require Certain courses criteria: assessment 22 General Information phone +35318962751. Find outmoreatwww.tcd.ie/Trinity_Access Applications Office. office. StudentsarenotrequiredtoapplytheCentral Access/prospective/access/mature.php Application formsareavailablefrom proficiency, seepage26. you willberequiredtoprovideevidenceofEnglishlanguage is essential.Inaddition,ifEnglishnotyourfirstlanguage interest instudyingatuniversityandstrongpersonalmotivation standard educationalrequirementsbutevidenceofaparticular Trinity Collegeandotherthird-levelinstitutions. There areno proposed yearofentry)forentrytoundergraduatestudiesat who areovertwentythreeyearsofageon1Januarythe This one-yearcoursepreparesmaturestudents(EU TAP foundationcourseformaturestudents +353 18962751. Find outmoreatwww.tcd.ie/Trinity_Access Applications Office. are applying.StudentsnotrequiredtoapplytheCentral are normallysubmittedinFebruaryoftheyearwhichyou Trinity_Access/prospective/access/young.php. Applications or GuidanceCounsellorsinschoolsonlineat Application formsareavailablefrom TAP LiaisonOfficersand/ considered. FETAC andLeavingCertificate Appliedqualificationsarealso above infivesubjectsandgradeHC3oronesubject. prior tothat.MinimumentryrequirementsaregradeOD3or Certificate intheyearofapplicationornotmorethantwoyears access programmes. Applicants shouldhavetakentheLeaving in theGreaterDublinareawhichareaffiliatedtothird-level course. ItisopentoLeavingCertificatepupilsfromschools will needtobenefitfromandparticipateinathird-leveleducation This one-yearcourseaimstoequipstudentswiththeskillsthey TAP foundationcourseforyoungadults at www.accesscollege.ie andwww.tcd.ie/trinity_access supports forHEARentrantscanalsobefoundonp.11, and while studyingatthirdlevel.Detailsofpost-admission offered avarietyofacademic,personalandsocialsupports Students whoacceptplacesin TCD throughHEARare can alsobefoundon: Guidance Counselloror Trinity Access Programmes.Information More informationonHEARisavailablefromyourschool Admissions/undergraduate). level mayfluctuate(seethe2011 entrylevelsatwww.tcd.ie/ for 2012. Applicants areadvisedthat thecompetitiveentry may giveanindicationofthelevel ofachievementrequired results; however, thelevelatwhichentrywas grantedin2011 make conditionaloffers priortothepublicationofexamination Certificate andGCE A-Levelresults. TheUniversitydoesnot through theCAOin August followingthepublicationofLeaving Offers toallsuccessfulEU applicants(schoolleavers)aremade Receiving anoffer www.accesscollege.ie www.tcd.ie/Trinity_ or fromthe TAP orphone , www.cao.ie; or www.tcd.ie/

.

in full,therightisreservedtocanceloffer. Please notethatifanapplicantdoesnotfollowtheinstructions in timetheoffer willlapse. within thespecifiedtimeperiod.Ifanacceptanceisnotreturned formal acceptancenoticetoCAO,eitheronlineorinhardcopy, Applicants whowishtoacceptanoffer ofaplacemustreturn Accepting anoffer 6 5 4 3 2 1 Offer Notice: their entryto Trinity Collegeforoneyear. OnreceiptofaCAO Students whohavereceivedanoffer noticemayapplytodefer Deferred entry CAO inearlyJuly. who havedeferredentryfromthepreviousyearwillbeissuedby Offers tosuccessfulmaturestudentapplicantsandcandidates A placemaybedeferredforoneacademic yearonly. an offer ofaplaceonthecourseinJulyfollowingyear. Students whowerepermittedtodefertheirplacewillreceive After re-applying, the applicant mustsendtheirnewCAO After re-applying,theapplicant place,theapplicantmust In ordertotakeupthedeferred The lettermustarriveinthe Admissions Officeatleasttwo The partoftheOffer Noticerelatingtotherelevant Trinity Write IMMEDIATELY tothe Admissions Officer, Regent Do NOT accepttheoffer. E-mail: [email protected]. application numberto The Admissions Office writing. Trinity Collegewillnotifytheapplicantofdecisionin days beforethe‘ReplyDate’ shownontheOffer Notice. College coursemustbeattachedtotheletter. for therequest. House, Trinity College,Dublin2settingoutthereason(s) on thisapplication. deferred coursemustappearasthefirstandonlychoice re-apply throughtheCAOby1February2013and

General Information 23

www.tcd.ie/ . www.tcd.ie/admissions/undergraduate/fees Applicants’ appeals process Applicants’ Applying for accommodation Applying for Fees information Application forms and further information are available from the are available forms and further information Application for contact details). Office (see above International 2012. received by 1 March applications must be Completed of all fees due. Free Students eligible for inclusion in the Irish government’s Contribution (€2,000 Fees Initiative will be liable for the Student The Student previously known as the Student Charge. in 2011), In addition Contribution is payable in full prior to registering. Students in Ireland students are required to pay the Union of and the Student Sports (USI) membership levy (€8 in 2011) will not be liable for tuition but Centre charge (€77 in 2011), Authority/VEC Grants Local will be liable only for Students eligible for a local authority grant levy (€8 in the Union of Students in Ireland (USI) membership and the Student Sports Centre charge (€77 in 2011). 2011) The above information was correct at the time Please note: after publication Any changes to this information of publication. will be listed at Further information on the above is available at: Admissions/undergraduate/fees Applications are assessed on the basis of criteria listed in this This is also Admissions Office website. publication and on the the case in categorising students for the purposes of tuition fees. Where an applicant appeals a decision the initial appeal is If the applicant wishes to Admissions Officer. considered by the appeal the matter further it is passed to the Senior Lecturer for consideration. Applicants may only apply for accommodation in Trinity Hall after Trinity apply for accommodation in Applicants may only College. Trinity a place on a course at they have been offered details. See page 8 for further be of a place via CAO will an offer Students who accept Fees Office with regard to payment contacted by the College fees if approved for the Free Fees scheme. in the Free Fees EU students who are not eligible for inclusion the other charges scheme pay the EU portion of the fees plus referred to above. should pay Students who are classified as Non-EU students the Non-EU fee.

www.tcd.ie/ and return it to the www.tcd.ie/Admissions/ [email protected] One-year and one-term students Non-EU applicants A limited number of places are available for EU and non-EU limited number of places are available for A students who are already enrolled in another university and do College. While Trinity not wish to undertake a four-year course in preference students may wish to be admitted for one term only, is given to those who wish to attend for a full academic year, particularly in the case of EU visiting students. Non-EU students applying for deferred entry should contact the Trinity College, Dublin 2 in Regent House, Admissions Officer, writing prior to the deadline for acceptance of their offer. Deferred entry Receiving an offer and accepting a place Trinity Successful non-EU applicants will be notified in writing by of a place in the College. Students who wish to accept an offer College will be required to return an acceptance fee within a specified time. Details of the due date and method of payment letter. will be included in the offer Non-EU applicants to Medicine and/or Dental science should Non-EU applicants to Medicine and/or Dental download the non-EU application form from Tel: +353 1 896 3150, Fax: +353 1 677 1698 +353 1 896 3150, Tel: E-mail: [email protected] www.tcd.ie/international Website: Admissions/undergraduate/apply/forms Dublin 2 Trinity College, Admissions Office, Regent House, placements Due to restrictions on the number of clinical non-EU available in the School of Nursing and Midwifery, places. students may only be considered for vacant In order to be considered for admission all applicants are In order to be considered for admission all requirements required to satisfy the University matriculation any specific course (see page 27) and, where relevant, meet requirements (see pages 28-33). The International Office, East Theatre, Trinity College, Dublin 2 Trinity College, Theatre, East The International Office, 1 February 2012. The normal closing date for applications is other than Late applications may be considered for courses Medicine and Dental science. Enquiries from non-EU applicants concerning undergraduate Enquiries from non-EU other than Medicine and/or Dental science admission to courses to: should be addressed Admissions Office may be contacted by: The +353 1 896 4444, E-mail: Tel: by 1 February 2012. Transferring course and Advanced entry Advanced and course Transferring third- a course in another to transfer from Students seeking College Trinity third year in to the second or level institution entry) should consult: (Advanced undergraduate/apply/transferred/from-third-level 24 General Information 2 1 n n n n To beconsideredforadmissiontotheUniversityyoumust: (iii) (ii) (i) must: To qualifyforadmissiontoadegreecourseattheUniversityyou 4 3 Notes: The sixsubjectsabovemustinclude:

Irish LeavingCertificate Matriculation requirements: requirements: Matriculation Admission Requirements2012 Irish at foundation-level is not acceptable formatriculation, isnotacceptable Irish atfoundation-level A onordinaryorhigher pass meansgradeDorabove OR competitionforplaces,havegoodenough where thereis (whereapplicable). satisfy coursespecificrequirements meet thematriculationrequirements. Combinations of Leaving Certificate subjectsnotpermitted: ofLeavingCertificate Combinations achievedindifferentStudents maycombinegrades sittings A subjectotherthana pass inLatinandapass A mathematics) pass inmathematics(orfoundation-level A pass inEnglish. Present sixsubjects,threeofwhichmustbeatgradeCor n n n permitted forMedicine–seenote3onpage32. requirements, butnotforthepurposesofscoring. This isnot for thepurposeofsatisfyingmatriculationand/orcourse of theirLeavingCertificate/Matriculationexaminations only. at foundation-levelisacceptableformatriculationpurposes course requirementsorforscoringpurposes.Mathematics University matriculationexamination. papers in the Leaving CertificateandgradeD oraboveinthe language. and apassinlanguageotherthanEnglish C intheUniversitymatriculationexamination. above onhigherLeavingCertificatepapersoratleastgrade or Advanced GCE(A-level)scoringsystem). offers aremade(seetheLeavingCertificatescoringsystem examination resultstobeincludedamongthosewhom

Art andmusicmaynotbeoffered astwoofthethree maybothbeusedfor science Biology andagricultural Physics/chemistry maynotbepresentedwithphysics purposes butboth maybeusedforscoringpurposes. higher Leaving Certificate gradesformatriculation required formatriculationpurposes. presented astwoofthethreeHC3 (orabove)grades addition, Biologyandagricultural sciencemaynotbe Medicinal chemistry, PhysiotherapyorScience.In required forDentalscience,Earthsciences,Medicine, agricultural scienceasthetwohigherlevelsubjects scoring purposesbutbiologymaynotbepresentedwith or chemistry.

n Leaving Certificatescoringsystem

www.tcd.ie/Admissions/undergraduate The minimumentrylevels(points)for2011 areavailableat following points:Distinction70,Merit50,Pass30. accepted forscoringpurposesonlyandareawardedthe Leaving Certificate Vocational ProgrammeLinkModulesare purposes. College matriculationexaminationofthesameyearforscoring combine resultsfromtheLeavingCertificateand Trinity Certificate willbecountedforscoringpurposes. Applicantsmay An applicant’s sixbestresultsfromonesittingoftheLeaving

Students presenting Leaving Certificate Mathematicsat Students presentingLeavingCertificate Bonus points forhigherlevelMathematics achieving agradeHD3orabove. honors levelwillbecreditedwithanadditional25pointsfor Grade D3 D2 D1 C3 C2 C1 B3 B2 B1 A2 A1 Higher Level 100 45 50 55 60 65 70 75 80 85 90 Ordinary Level 10 15 20 25 30 35 40 45 50 60 5

General Information 25

studies are not acceptable. Physical education, General studies and Media

or Biology. art may be presented. Vocational A-level, National Vocational and Key Skills A-level, National Vocational Vocational or qualifications are not accepted for matriculation scoring purposes. recognised examination boards are, in principle, acceptable for consideration with the following exceptions. l Admissions Office. should contact the language. Biology or Geography. Science may not be presented with Chemistry, Physics Science may not be presented with Chemistry, Not more than one specialised in endorsed programme Applied A-level, Vocational Advanced Subsidiary, Advanced Subsidiary, A-level, Vocational Applied set by GCSE/Advanced GCE (A-level) subjects Applicants who require advice about subject eligibility Art may not be presented with History of art. Biology may not Zoology. be presented with Botany or English literatureEnglish may not be presented with Environmental science may not be presented with Film studies may not be presented studies. with Media

n n n n n matriculation or scoring purposes: n n n n n Advanced Subsidiary GCE (AS) papers. Two of these Two GCE (AS) papers. Advanced Subsidiary Advanced GCE C or above on subjects must be at grade (A-level) papers. language. Subsidiary GCE (AS) papers. Advanced GCE (A-level) examinations sittings of their and/or course for the purpose of satisfying matriculation This is scoring. requirements, but not for the purposes of page 32. not permitted for Medicine – see note 3 on than English Present six subjects at grade C or above on GCSE or Present six subjects pass in English. A and a pass pass in mathematics in a language other A pass in Latin and a pass in a a subject other than A GCE (A-level) grades for matriculation purposes but both may be used for scoring purposes. Art and Music may not be offered as the two Advanced as the two Art and Music may not be offered Acceptable subjects: A-level subjects not permitted for Combinations of OR Advanced pass means grade C or above on GCSE or A Students may combine grades achieved in different Matriculation requirements: GCSE/Advanced GCE (A-level) GCE GCSE/Advanced

The six subjects above must include: The six subjects above Notes: 5 3 4 To be considered for admission to the University you must: to the University you for admission be considered To n n n n 1 2 From 2012 there will be an entry route to a number of degree degree of number a to route entry an be will there 2012 From College for applicants presenting Trinity programmes in presenting Applicants qualifications. 5) (level FETAC appropriate distinctions in five modules can be considered for admission TR093); to Science (TR071); General Nursing (TR091 & Psychiatric Nursing (TR095); Intellectual Disability Nursing (TR097) and Midwifery (TR913). Further details may be found at www.tcd.ie/Admissions/undergraduate/requirements/ matriculation/fetac. Entry Route for students presenting qualifications FETAC 26 General Information ^ 2 1 n for examstakenin2010,2011 &2012 Advanced GCE(A-level)scoringsystem the basisofranking withinthatgroup. coming fromeachrespectiveexamination systemgroupon places onthecourseinquestion willbeoffered toapplicants equivalent EUsystems.Oncethese proportionsaredetermined, A-level examinationsystemsor, inasmallnumber ofcases, eligible applicationscomingfrom theLeavingCertificateand courses willthenbedetermined basedontheproportionsof be comparedwithLeavingCertificateapplications.Placeson points to A-level gradesinorderthat A-level applicationscan whereby it,inthefirstinstance,allocatesrangesofCAO Trinity Collegeappliesatwo-stageadmissionsprocedure Allocation ofplaces • Notes: www.tcd.ie/Admissions/undergraduate The minimumentrylevels(points)for2011 areavailableat of thesameyeararecountedasasinglesitting. of scoring.However, examinationstakeninJanuaryandJune of theirGCE Advanced level(A2)examinationsforthepurpose Students maynotcombinegradesachievedindifferent sittings of thefollowing: An applicant’s scorewillbecalculatedonthebasisofeither

their best3GCE (A2)subjectsfromone Advanced level OR their best4GCE (A2)subjectsfromone Advanced level Students presenting A-Level Mathematics,Further Cambridge Pre-U: Principle subjects willbeaccepted Principlesubjects Cambridge Pre-U: undergraduate/requirements/matriculation/gcse results isavailableat requirements. The scoring schemeforPrinciplesubject as alternativesto A-Levels inmeetinggeneralentry awarded 145points. with theexceptionofpre-2010 A grade,whichwillbe will bescoredbasedonthe2010/2011/2012 schemeabove, year only. a different subjectfromthesameorprecedingacademic academic yearplusone Advanced Subsidiarylevel(AS)in academic year an additional25pointsforachievingagradeEorabove. Mathematics orPurewillbecreditedwith Bonus points forMathematics: Applicants presenting Applicants presenting frompre-2010 A-level examinations A* D C E B A www.tcd.ie/Admissions/ AS 20 35 50 60 65 – 135^ 100 120 150 A2 40 75

n provide evidenceofEnglishlanguageproficiency. If Englishisnotyourfirstlanguageyouwillberequiredto matriculation andcourserequirements. the Admissions Office(seepage19)fordetailsoftherelevant undergraduate/requirements/matriculation/other) orcontact consult the Trinity Collegewebsite( than LeavingCertificateor AdvancedGCE(A-level)should Applicants whoarepresentingasecond-levelqualificationother n n n n in allmatterspertainingtotheadmissionsprocess. Trinity Collegereservestherighttomake the finaldecision requirements/matriculation/gcse available at against LeavingCertificatestudents.Furtherdetailsare These pointswillnotbeusedtocompare A-level students grades forthepurposeofdeterminingstudent’s rankingonly. Trinity Collegewillcontinuetoallocatefixed pointsto A-level Note thatexaminationresultsareonlyvalidfor2years.

English languagerequirement Other schoolleavingqualifications TOEFL Pearson Test –PTE ofEnglish(Academic) Academic: a IELTS (academicversion)6.5(noindividualbandbelow6) Cambridge Advanced Grade A C Grade Cambridge Proficiency minimum scoreof63(withnosectionbelow59) l l l

Internet-based 90(withawrittenscoreof21) Internet-based of4.5inessay) 233(withascore Computer-based 570 (witha Paper-based TWE score of4.5) www.tcd.ie/Admissions/undergraduate/ www.tcd.ie/Admissions/

General Information 27

[email protected] Additional requirements University matriculation examination University matriculation Age requirement Precautions against infectious diseases of admission to a number of Health sciences courses are Offers made subject to certain vaccination requirements and/or certain negative test results. See page 202 for further details. Professional courses demand that certain core competencies are met by students in order to graduate and practice professionally after qualification. College has special responsibility to ensure that all students admitted to all professional programmes will be eligible for registration by the relevant professional body upon graduation. It is important to us that our students are able to fulfil the rigorous demands of professional courses and are fit to practice. Fitness to practice Garda vetting forms will be distributed (as part of the student a place in orientation pack) to students who have been offered The completed forms must be returned to the College. Trinity Admissions Office prior to registration. Garda vetting professional Students on courses with clinical or other vetting placements may be required to undergo Garda If, as a result procedures prior to commencing placements. a student of the outcome of the Garda vetting procedures, other professional is deemed unsuitable to attend clinical or from his/ placement, he/she may be required to withdraw Ireland for a her course. Students who have resided outside be required to consecutive period of 6 months or more will the country in provide police clearance documentation from which they resided. Tel: 01 896 4444, E-mail: Tel: A matriculation examination, graded in equivalent terms to matriculation examination, A Leaving Certificate examination papers, grades used in higher is 1 March. The closing date for application for the examination from the Application forms and a syllabus can be obtained Dublin 2, Trinity College, Admissions Office, Regent House, is held in Trinity College every year, usually in April. The subjects subjects The April. in usually year, every College Trinity in held is are Biblical studies and of the matriculation examination available, may take one or both of the subjects You Geology. the range of University matriculation but you should note that available is not sufficient for the fulfilment examination subjects of all matriculation requirements. Applicants seeking admission in 2012 must have a date of birth 2012 must have a date seeking admission in Applicants 1996. before 15 January 28 General Information ** Theminimumpointsrequired dependonwhichtwosubjectsarechosen. * Notallapplicantsatthislevel were offeredplaces. for Science. ‡ Geographymayalsoberead aspartofamoderatorshipcourseinscience–TR071.Seepage 139forspecificcourserequirements Certificate paperorequivalent. Spanish within TSM arerequiredtopresentatleastoneofthechosenlanguagesgradeC3orbetteronahigherlevelLeaving Note: Studentsarenotpermittedtocommencetwonewlanguages.wishingcombineof:Greek,Italian,Latin,Russian, only isstudiedinthefourthandfinalyear. Anhonorsdegreeisawardedinbothsubjects. combinations seenextpage)andpursuebothtohonorsdegreelevel.Usuallysubjectsarestudiedforthreeyearsonesubject The two-subjectmoderatorship(TSM)isajointhonorprogramme.Studentsselecttwosubjectsfromthelistbelow(forpermitted for A-level applicantsforsome TSMcombinations. all combinations ofsubjectsisavailableat MU GG GK GE DR CC RU MT PH AR HS EN EC SC AH PS FR SP FS BT JS MI LT EI IT Level 8(HonorsDegrees) Course requirements 2012: Two-Subject Moderatorship (TSM/TR001) – (TSM/TR001) Moderatorship Two-Subject 2012: requirements Course Psychology Philosophy Music Modern Irish Mathematics Latin Jewish andIslamiccivilisations Italian History ofartandarchitecture History Greek German Geography‡ French Film studies World religionsandtheology Spanish English literature Economics Early Irish Drama studies Sociology Classical civilisation Ancient historyandarchaeology Subject Name Russian www.tcd.ie/Admissions/undergraduate. Notethatthere aredifferentminimumentrylevels none none see note5 C3 inIrish B3 inmathematics C3 inLatinoralanguageexcludingEnglish none C3 inItalianoralanguageexcludingEnglish none none C3 inGreekoralanguageexcludingEnglish C1 inGerman none C1 inFrench none none C3 inalanguageexcludingEnglish C3 inEnglish see note1 C3 inIrish see note12 none none none GCE (A-level)grades) higher levelLeavingCertificateor Advanced Specific SubjectsRequired(referenceisto C3 inalanguageexcludingEnglish A griddisplayingtheminimumpoints requiredin201 Available Places in 2011 43 10 30 25 10 10 30 40 40 32 45 84 30 24 41 85 43 10 24 59 29 23 36 17 8 440*-535* 400*-535* Minimum 425*-570 425-535* 400*-570 455*-555 535*-555 470-535* 445-535* 525*-570 415-535* 450*-570 410-535* 425-535* 555-570 410-555 525-570 425-570 445-570 425-570 450-555 415-570 450-570 440-555 Range Points 2010** 570 Page 164 109 107 106 104 103 101 100 110 115 113 112 1 for 79 76 53 61 98 56 90 96 53 51 95 93 85

General Information 29 – – – – – – – SP 123 543 318 785 483 562 363 213 153 183 573 393 723 513 453 273 753 303 – – – – – – – – – – SC 753 542 755 482 561 362 212 152 662 332 692 512 452 272 302

– – – – – – – – RU 211 511 723 121 541 317 725 560 361 151 661 181 571 391 451 271 301 – – – – – – – – – – – – – – PS 630 540 559 210 150 660 330 270 692 600 300 – – – – – – PH 629 539 479 558 359 209 149 329 179 660 569 389 661 509 449 269 662 599 299 – – – – – – – – – – – – – – – MU 320 635 478 629 630 508 448 268 598 298 – – – – – – – – – – – – – – – – – MT 598 357 207 599 327 600 267 297 – – – – – – – – – MI 511 508 505 315 515 556 354 144 509 174 506 444 264 512 294 513 – – – – – – – – – – LT 116 536 575 476 557 146 569 576 176 571 506 446 266 296 573 – – – – – – – – JS 547 319 555 552 558 549 548 559 557 553 560 556 554 550 561 551 562 – – – – – – – – IT 115 316 545 475 355 539 175 540 536 385 541 505 445 265 542 295 543 – – – – – HS 112 445 443 554 352 202 142 449 322 456 172 446 382 451 444 262 452 292 453 448 – – – – – – – – – – – – – – GK 110 395 553 140 389 170 391 382 260 385 393 – – – – – – – – – – – – – – – – – – GG 321 198 329 330 322 332 327 – – – – – – – – GE 314 366 353 552 199 139 359 321 361 354 352 259 362 357 355 289 363 – – – – – – – – – – – – – – FS 311 319 314 310 317 315 312 316 313 318 320 – – – – – FR 107 306 293 551 289 137 299 167 300 296 301 294 292 257 302 297 295 303 313 298 – – – – EN 106 276 263 550 259 136 269 166 270 266 260 271 264 262 272 267 265 257 273 312 268 – – – – – – – – – – – – – – – – – – – – EI 486 549 156 576 456 – – – – – – – – – – – – – – – – EC 211 199 209 198 210 202 212 207 213 – – – – – – – – – – – DR 311 485 366 185 575 395 725 515 276 755 545 306 785 635 – – – – – – – – – – – CC 173 548 133 179 176 170 185 181 174 172 166 175 167 183 – – – – – – – – BT 102 143 139 149 156 133 150 146 140 151 144 142 136 152 137 153 310 – – – – – – – – – AR 113 555 353 143 479 486 173 476 485 443 263 482 475 293 483 478 – – – – – – – – – – – – – – AH 113 116 110 112 115 547 102 121 106 107 123 Two-Subject Moderatorship (TSM/TR001): Permitted combinations and CAO course codes and CAO IT EI MI LT JS FS SP BT PS FR EC PH HS EN SC AH AR GE CC DR RU MT GK GG MU The absence of a code in a grid position indicates that the corresponding combination of subjects is not permitted. combination of subjects is not in a grid position indicates that the corresponding The absence of a code Each possible combination of two subjects has a unique three-digit code. TR followed by the three-digit code of your chosen TR followed by the three-digit code. of two subjects has a unique three-digit Each possible combination TR289. French and German be entered on the application form, e.g. TSM combination should TR001 must NOT be entered on the application form. entered on the application be NOT TR001 must 30 General Information TR071 TR056 TR055 TR054 TR053 TR052 TR051 TR027 TR025 TR024 TR023 TR022 TR021 TR020 TR019 TR018 TR017 TR016 TR015 TR012 TR009 TR008 TR007 TR006 TR005 TR004 TR003 TR002 TR039 TR038‡ TR035‡ TR034 TR033‡ Code Course TR032 TR031 TR029 TR028 Course requirements2012:Level8(HonorsDegrees) ‡ Human healthanddisease Radiation therapy Occupational therapy Physiotherapy Dental science Medicine Drama andtheatrestudies European studies English studies Early andmodernIrish Classics Law andpoliticalscience Law andGerman Law andFrench Law andbusiness Deaf studies and sociology Philosophy, politicalscience,economics History andpoliticalscience Music education World religionsandtheology Clinical speechandlanguagestudies Psychology Philosophy Law History Music Computer scienceandlanguage Engineering withmanagement Theoretical physics systems studies Management scienceandinformation Computer science Name Science Engineering Mathematics Political scienceandgeography Ancient andmedievalhistoryculture Irish studies see note18 see note14 see note7 see notes1and6 see note3A see notes3A and3B see note12 see note8 C3 inEnglish C3 inIrish C3 inGreekorLatin none C1 inGerman C1 inFrench see note1 See note20 see note1 none see note5 none see note4 none none none none see note5 see note22 C3 inmathematics B3 inmathematicsandphysics C3 inmathematics C3 inmathematics or Advanced GCE(A-level)grades) is tohigherlevelLeavingCertificate Specific SubjectsRequired(reference see notes1and 2 C3 inmathematics B3 inmathematics none none See note21 Available Places in 2011 123 340 155 33 30 40 40 32 17 45 40 15 15 20 15 15 25 20 25 24 15 29 34 31 17 90 38 20 15 20 40 40 80 30 20 15 20 see p. 122 Minimum points in 2010** 505* 515* 530* 580* 731* 505* 560* 510* 555* 510* 475* 545* 510* 470* 500* 455* 465* 430* 395* 495 500 520 345 425 550 335 515 340 525 430 480 390 380 355 405 330 Page 179 198 192 196 176 181 122 136 169 124 139 126 164 119 51 58 56 53 44 74 71 71 72 48 80 63 78 90 46 85 79 68 61 76 83 36 65 General Information 31 37 89 87 42 42 42 42 42 163 160 166 167 161 188 188 188 188 188 188 188 186 186 120 188 188 188 194 Page 520 400 410 455 174 153 151 179 168 375 445 465 505 440 410 420 475 380 475* 360* 360* 480* 435* 475* 400* 166* 540* 2010** points in Minimum 5 4 5 7 5 15 28 10 12 20 25 17 13 15 25 15 30 28 45 15 15 10 92 14 29 75 236 2011 Places in Available Available

see notes 1 and 10 see note 11 see notes 1 and 2 see note 13 see notes 1 and 2 see note 1 See note 15 See note 17 See note 15 See note 17 See note 15 See note 17 See note 15 See note 17 Specific Subjects Required (reference Subjects Required (reference Specific level Leaving Certificate is to higher grades) GCE (A-level) Advanced or see note 19 none none C1 in French and see note 1 C1 in German and see note 1 C3 in a language excluding English and see note 1 C3 in a language excluding English and see note 1 C1 in Spanish and see note 1 See note 15 See note 17 See notes 15 and 16 See notes 16 and 17 see notes 1 and 9 see notes

. www.tcd.ie/Admissions/undergraduate Earth sciences and social studies Business, economic Nanoscience, physics and chemistry Nanoscience, physics Human genetics modelling Chemistry with molecular Medicinal chemistry of advanced materials Psychiatric nursing Psychiatric nursing (mature applicants) Intellectual disability nursing Intellectual disability nursing (mature applicants) and general integrated nursing Children’s and general integrated Children’s nursing (mature applicants) Midwifery Midwifery (mature applicants) Name Computer science and business Computer science and Sociology and social policy Social studies (Social work) Business studies and French Business studies and German Business studies and Russian Business studies and Polish Business studies and Spanish General nursing General nursing (mature applicants) Adelaide School General nursing – of Nursing General nursing (mature applicants) – Adelaide School of Nursing Pharmacy ‡ ‡ ‡ ‡ TR074 TR075 TR076 TR077 TR081 TR095 TR096 TR097 TR098 TR911 TR912 TR913 TR914 Code Course TR082 TR083 TR084 TR085 TR086 TR087 TR089 TR090 TR091 TR092 TR093 TR094 TR072 TR073 These courses are funded by the Irish government under the National Development Plan 2007-2013 and aided by the European Social Fund (ESF) under the Capital Investment Programme Operational Human 2007-2013. * Not all applicants at this level were offered places. ** Note that there are different minimum entry levels for A-level applicants for some courses, see the minimum entry points document at Courses are funded by the Irish Government under the National Development Plan, 2007-2013. ‡ 32 General Information 4 3B 3A 2 1 Notes 5

A mathematics requirementofgradeDontheordinaryor * mustsatisfymatriculationandspecific A-level applicants This isarestrictedentrycourse,therefore,applicationsmust and ahigherlevelgradeC At leastahigherlevelgradeB Two gradeCsfromthefollowingsubjects: higherlevel A mathematicsrequirementofgradeContheordinaryor This isarestrictedentrycourse,therefore,applicationsmust will bemade. further tests)in late April/early Maywhenthefinal selections be calledforinterview(andinthe caseof TR009 applicants, and backgroundanessay paper. Someapplicants will paper, aneartest,apaperongeneral musicalknowledge 2012 (provisionaldate). This willincludeasimpleharmony of entry. You willbecalledforanentranceteston24March be submittedtotheCAOby1Februaryofproposedyear French, German,Irish,Italian,Russian,Spanish. mathematics andagradeBatGCSElevelinoneofEnglish, a gradeCat A-level inoneofphysics,chemistry, biology, level inoneofphysics,chemistry, biology, mathematics;or Irish, Italian,Russian,SpanishandagradeBatGCSE at A-level isrequiredinoneofEnglish,French,German, If youarepresenting Advanced GCE(A-levels),agradeC chemistry, biology, physics/chemistry, agriculturalscience. level inoneofmathematics,appliedphysics, Irish, Italian,Russian,SpanishandagradeCathigher A grade CathigherlevelinoneofEnglish,French,German, higher LeavingCertificatepaperorgradeCatGCSElevel. e.g. GCSE(2010), AS (2011), A-levels (2012). course requirementswithinthreeconsecutiveyears, application forMedicinemustbemadeonlineat Office: +35318964444. Applicantsshouldnotethat are availableat valid fortwoyears.Furtherdetailsontheselectioncriteria ireland.acer.edu.au by20January2012. Test resultsare 2012. Applicants mustregisterforthetestatwww.hpat- test (HPAT –Ireland)whichwilltakeplaceon25February addition, allapplicantswillberequiredtosittheadmissions in thesamesitting*ofLeavingCertificateexamination.In and meetthematriculationspecificcourserequirements of entry. Applicants mustachieveaminimumof480points be submittedtotheCAOby1Februaryofproposedyear Leaving CertificatepaperorgradeBatGCSElevel. ordinary LeavingCertificatepaper, gradeDonthehigher in physics,youmustpresentmathematicsatgradeConthe presented withbiology. Ifyoudonothavesomequalification with physicsorchemistry. Agricultural sciencemaynotbe agricultural science. Physics/chemistry may not be presented in twoofphysics,chemistry, biology, physics/chemistry, presented withmathematics. presented withbiology. Applied mathematicsmaynotbe physics orchemistry. Agricultural sciencemaynotbe science. Physics/chemistrymaynotbepresentedwith geology, geography, appliedmathematics,agricultural physics, chemistry, biology, physics/chemistry, mathematics, at GCSElevel. grade DonthehigherLeavingCertificatepaperorB www.tcd.ie/courses orfromthe Admissions www.cao.ie

. 9 8 7 6 14 13 12 11 10 A andahigherlevel gradeCinchemistry higher level willstudytwolanguages Students enteringthisprogramme One higher level grade C from the following subjects: physics, Two gradeCsfromthefollowingsubjects: higherlevel One higher level grade C from thefollowingsubjects: gradeCfrom One higherlevel Two gradeCsfromthefollowingsubjects: higherlevel This is a restricted entry course; therefore, applications must A andahigherlevel gradeCinmathematics higher level Two gradeCsfromthefollowingsubjects: higher level geography, appliedmathematicsandagriculturalscience. grade Cinoneofphysics,biology, mathematics,geology, Leaving Certificate,orequivalent. they achieveahigherlevelgradeBinthelanguage may alsobeadmitted,subjecttotheaboveregulations,if who haveonlyonelanguage(otherthanEnglishorIrish) and C2inthecaseofSpanishifnon-beginner).Students Russian, Spanish(C1inthecaseofFrenchandGerman, or equivalent,intwoofFrench,German,Italian,Polish, have at least ahigherlevelgradeCintheLeavingCertificate programme, subjecttotheaboveregulations,willnormally language asabeginner. Studentsacceptedontothis beginner level.Nostudentmaystudymorethanone Italian, Polish,RussianandSpanishareavailablefrom from French,German,Italian,Polish,RussianandSpanish. chemistry, biology, physics/chemistry, agriculturalscience. may notbepresentedwithbiology. presented withphysicsorchemistry. Agricultural science agricultural science.Physics/chemistrymaynotbe physics, chemistry, biology, physics/chemistry, mathematics, physics, chemistry, biology, physics/chemistry. with appliedmathematics. chemistry orphysics.Mathematicsmaynotbepresented C at A-level. Physics/chemistrymaynotbepresentedwith present mathematicsatGrade A atGCSElevelorGrade at higherlevelgradeC3,while A-level applicantsmust must presentmathematicsatordinarylevelgrade A2 or mathematics, mathematics.Leavingcertificateapplicants physics, chemistry, biology, physics/chemistry, applied final selectionsaremade. attend aworkshopandinterview(during April/May) before completed questionnairesomeapplicantswillbecalledto questionnaire tocompleteinMarch.Onthebasisof theatre studiesasachoiceofsubject,youwillbesent year ofentry. IfyouindicateDramastudiesorand be submittedtotheCAOby1Februaryofproposed or biology. grade Cinoneofphysics,chemistry, physics/chemistry be presentedwithappliedmathematics. presented withchemistryorphysics.Mathematicsmaynot and appliedmathematics.Physics/chemistrymaynotbe biology, chemistry, physics,physics/chemistry, mathematics General Information 33

174 173 178 Page 360 355* 440* 2010 points in Minimum 8 6 25 2011 Places in Available Available must be received by the CAO by 1 February of the proposed proposed the of February 1 by CAO the by received be must or Nursing are applicants to Midwifery Mature year of entry. supplementary a mature-student required to submit NOT you indicate Midwifery College. If Trinity form to application Centre the Nursing Career as a mature student, or Nursing assessment. will invite you to a written or higher level in a language other than English. higher level in French or German if selecting French or German, German, or French selecting if German or French in level higher Irish. or a grade B3 at higher level in Irish if selecting and/or placement) in any Nursing or Midwifery programme or and/or placement) in An their registration with would affect have any issues which be considered for re-entry to Nursing Altranais will only Bord appeal basis to the relevant or Midwifery on a case-by-case applicants should make their case Programme Board. Such Officer and include any relevant Admissions in writing to the circumstances. details of extenuating mathematics. Irish or grade attain at least grade HC3 in Leaving Certificate specific course requirements There are no A-level Irish. C in for Strand B. C in one of physics, chemistry or physics/chemistry. A higher level grade C3 in mathematics. Also, a grade C1 at at C1 grade a Also, mathematics. in C3 grade level higher A This is a restricted entry course,This is a restricted applications therefore, previously been unsuccessful (academicApplicants who have higher levelbiology grade C in and a higher level grade A A2 in higher level grade C3 or an ordinary level grade A higher level grade C in English and grade D at ordinary A must (see p. 65) A Applicants who wish to choose Strand 22 17 18 19 20 21 Specific subjects required See note B and C + Restricted entry and C + Restricted entry A See notes See notes A and C A See notes Name Dental hygiene (diploma) Dental technology (ordinary degree) Dental nursing (diploma) Applicants are required to present six subjects, including English, mathematics and one of physics, chemistry, biology, physics/ biology, Applicants are required to present six subjects, including English, chemistry, mathematics and one of physics, four subjects must be presented to a standard of at least grade D3 on ordinary Leaving Certificate papers. four subjects must be presented to a standard of at least grade D3 on ordinary Leaving demonstrate appropriate experience relevant to the course. four subjects must be presented to a standard of at least grade D3 on ordinary Leaving Certificate papers. four subjects must be presented to a standard of at least grade D3 on ordinary Leaving chemistry or agricultural science. chemistry or agricultural science. be submitted to the CAO by 1 February of the proposed year be submitted to the CAO which is a voluntary Adelaide Hospital Society, The of entry. applicants charitable organisation, nominates suitable Adelaide School of Nursing. In selecting each year to the obligation applicants, the Society has regard to its particular and also to to applicants from the Protestant community be sent an Applicants will members of inter-church families. Adelaide to the additional application form, to be returned of information provided, On the basis Hospital Society. final selections applicants may be called to interview before are made. (academic and/or placement) in any Nursing or Midwifery any Nursing or Midwifery and/or placement) in (academic their issues which would affect programme or have any will only be considered for Altranais An Bord registration with Midwifery on a case-by-case appeal re-entry to Nursing or Programme Board. Such applicants basis to the relevant Admissions in writing to the should make their case any relevant details of extenuating Officer and include circumstances. and in one of biology, physics, chemistry, physics/chemistry physics/chemistry physics, chemistry, of biology, and in one science. or agricultural st grade C3 on higher Leaving Certificate papers. The remaining Of the six subjects presented, two must be of a standard of at least grade C3 on higher Leaving Certificate papers. Applications may also be considered from mature applicants who requirements but can do not satisfy the academic entry st grade C3 on ordinary Leaving Certificate papers. The remaining Of the six subjects presented, two must be of a standard of at least grade C3 on ordinary Leaving Certificate papers. physics/ biology, Applicants are required to present six subjects, including English, chemistry, mathematics and one of physics, This is a restricted entry course, therefore; applications must This is a restricted entry Applicants whoApplicants have previously unsuccessful been A grade D on the ordinary or higher grade D on paper in mathematics A Course requirements 2012: Ordinary degree and diploma courses Course requirements 2012: Course Code TR802 TR803 TR801

Applications for restricted entry courses must be submitted to the CAO by 1 February of the proposed year of entry. Applications for restricted entry courses must be submitted to the CAO by 1 February C

B A 16

15 Notes 34 Arts, Humanities and Social Sciences Arts coursesat Trinity College–anoverview World religionsandtheology Sociology andsocialpolicy Social studies(Socialwork) Psychology Political scienceandgeography Political science sociology Philosophy, politicalscience,economics and Philosophy Music education Music Law andpoliticalscience Law andbusiness Law withalanguage(FrenchorGerman) Law Irish studies History andpoliticalscience History European studies English studies Education Early andmodernIrish Drama andtheatrestudies Deaf studies Computer scienceandbusiness Clinical speechandlanguagestudies Classics Russian, PolishorSpanish) Business studiesandalanguage(French,German, Business, economicandsocialstudies(BESS) Ancient andmedievalhistoryculture Arts, HumanitiesandSocialSciences 120 90 89 87 85 83 82 80 79 78 76 74 72 71 68 65 63 61 58 56 55 53 51 48 46 44 42 37 36 35 Two SubjectModeratorship(TSM)– Choose twosubjects Acting Direct Entry(non-CAO): World religionsandtheology Spanish Sociology Russian Psychology Philosophy Music Modern Irish Mathematics Latin Jewish andIslamiccivilisations Italian History ofartandarchitecture History Greek German Geography French Film studies English literature Economics Early Irish Drama studies Classical civilisation Ancient historyandarchaeology

164 109 107 106 104 103 101 100 115 113 112 110 116 92 90 85 79 76 53 61 98 56 96 53 51 95 93 Arts courses at Trinity College – an overview

While the arts subjects cover a very wide range, they have in common the study of the human mind and its historical, cultural and linguistic manifestations.

Some of the arts courses offered in Trinity College have a strong vocational element, for example Music education, Drama studies and Law. Many arts courses do not have a vocational focus but provide an excellent preparation for a wide variety of careers.

All are designed to develop high levels of analytic and communication skills: the ability to understand unfamiliar ideas and to look at familiar ideas in a new light, to work out your own ideas and express them lucidly and convincingly are skills you will acquire through an arts course.

Three types of Arts courses:

Single honor courses

In a single honor course one subject is studied almost Arts, Humanities and Social Sciences exclusively for the four years; however many subjects offer students a wide range of module choices, particularly in the third and fourth years.

Joint honor two-subject moderatorship (TSM) programmes You choose two subjects from a list of possible combinations (see page 92 for possible combinations and page 29 for CAO course codes). In most combinations both subjects are studied equally for the first three years and one subject only is studied in the fourth year. The two subjects are taught as separate disciplines and both are taught to honors degree level. The combined workload from two TSM subjects is similar to that of a single honor course.

Specially designed ‘packages’ of different subjects These may be organised around a particular theme, as in History and political science, or European studies; or around the development of a particular skill, as in the moderatorship in Music education, or Law and a language.

Arts: what comes after graduation?

A high proportion of vacancies for new graduates are open to students of any discipline and while an arts degree may not lead directly to one profession, arts graduates can be found in everything from accountancy to voluntary organisations (see the individual course entries for further details about career opportunities). The arts graduate has no shortage of choices! Details of first destinations for graduates of all disciplines are available on the Careers Advisory Service website: www.tcd.ie/Careers/students

35 36 Arts, Humanities and Social Sciences then thistooisthecourseforyou. political issueshavebeenconfrontedbysocietiesinthepast, a particularcuriosityaboutthewayinwhichcultural,socialand it istoday, thenthiscoursewillbeofinterest. Also, ifyouhave If youwanttounderstandhowEuropebeganbecomewhat art oftheperiodanddocumentarysourcesintranslation. approach toyourstudies,aswellappraisecriticallythe mentalities. You will be encouraged to pursue an interdisciplinary worlds, familiarisingyourselfwithkeyevents,issuesand study oftheart,cultureandhistoryancientmedieval be abletotracethisextraordinaryprocessthroughanintensive medieval world(2000B.C.-1500 A.D.). Inthiscourseyouwill focusing onthefascinatingtransitionfromancientto to investigatetheculturalandpoliticalgenesisofEuropeby Ancient andmedievalhistoryoffers youauniqueopportunity week dependingontheoptions chosen. there areapproximatelytwelve hours oftimetabledstudyper dividing yourtimeequallybetween thethreedisciplines.Intotal, courses in Ancient history, Art historyandMedievalhistory, In theJuniorFreshman(first)yearyouwilltakeamixtureof The JuniorFreshmanyear hope lively)discussionandindependentresearch. specialised, withanincreasingemphasisonintensive(butwe studies progress,yourcoursesbecomemorethematically by amixtureoflecturesandtutorialdiscussiongroups. As your disciplines willbeintroducedtoyouinfirst-yearcourses,taught their art,architecture,archaeology, cultureandhistory. These of theancientandmedievalworldsthroughananalysis Over thefouryearsyouwilldevelopabroadunderstanding history andculture Course content Is thistherightcourseforyou? Course overview medieval and Ancient TR012: Historyandpoliticalscience,page63 TR003: History, page61 TR001: TSM, page92 See also: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: B.A. 395* 15 TR028

Renaissance; andMedievalreligion,c.1215-1517. Florence, c.1348-c.1527;PaintingandsculptureintheItalian Art inthe Age ofChivalry; The Hundred Years War; Renaissance Charlemagne; The Crusades;Romanesqueartandarchitecture; Roman archaeology;Britain;Viking raiders; The reignof offered includes: The Aegean Bronze Age; Greekarchaeology; each ofthethreemainsubjectareas. The selectioncurrently The remainingmodulesmustincludeatleastonemodulefrom on Rome, which is taught by specialists from all three disciplines. In theirthirdyearallstudentstaketheinterdisciplinarymodule history, Latin,architecturalhistoryandarchaeology. including possibilitiesinIrish,BritishandEuropeanmedieval modules maybetakenfromanyofthethreedisciplines– module fromarangeofmodulesoffered. The remaining choose atleastone Ancient historymoduleandone Art history Europe, 1250-1500:Religion,deathandculture. They also In thesecondyearallstudentsarerequiredtotakecourse The secondandthirdyears n n n Age. Medieval Dublin;warfare;andIrishartintheGolden Edward I,IIandtheConquestofBritain,1286-1328; Archaeology of food; Empire andpapacyinthe eleventh century; in ancientEgypt;Sportandspectacletheworld; The courses acrossthedisciplines.Offerings currentlyincludeJews particularly intereststhemortomaintainabroadbaseof courses taken,studentsarefreetospecialiseinanareathat you andtodevelopindependentresearchskills.Oftwofurther both toinvestigatethoroughlyanareathatparticularlyinterests dissertation onatopicoftheirchoice. This givesyouachance In theirfourthyearallstudentsarerequiredtowritea The SeniorSophister Year

of themedievalworld–includingCrusades. importance ofkingsandkingdoms,themanyconflicts cultural developmentsoftheperiod,includinggrowing 1000 and1250,coveringthekeypolitical,social a surveyofEuropebetween Medieval historybeginswith Book ofKellsin TCD itself. cathedral ofChartresinFrance–butnotforgettingtoo The from themosaicsinItaliancityofRavennatogreat and architecture. You willbeintroducedtotopicsranging sculpture Art historysurveyskeydevelopmentsinpainting, language optionforthosewhowishtolearnLatin. the mythsandreligionsofancientworld. There isalsoa colonisation; thesocialcontextofartandarchitecture; Rome’s emergenceasanimperialpower;war, conflictand Topics coveredincludethe Athenian inventionofdemocracy; Roman art,archaeology, architecture,historyandmythology. Ancient history introduces key aspectsofGreekand introduces key

Arts, Humanities and Social Sciences 37

Mathematics Mathematics

TR081 236 475* B.A. or Bachelor in Business Studies (B.B.S.) Grade B OC3/HD3

COURSE CODE: PLACES 2011: POINTS 2010: AWARDED: DEGREE Special Entry Requirements: Leaving Certificate GCSE See also: TSM, page 92 TR001: page 79 TR005: Philosophy, 63 TR012: History and political science, page economics political science, TR015: Philosophy, page 80 and sociology, TR017: Law and business, page 72 TR020: Law and political science, page 74 page 83 TR029: Political science and geography, TR090: Business studies TR089, TR087, TR086, TR085, and a language, page 42 page 120 TR082: Computer science and business, page 89 TR083: Sociology and social policy, Political science: page 82 Course overview Is this the right course for you? Business, economic and and economic Business, common entry programme entry programme common leading to 10 degree options leading to 10 social studies (BESS) studies social BESS is a uniquely flexible programme offering 10 different 10 different BESS is a uniquely flexible programme offering degree options: Business (B.B.S.) and nine other (single honor and joint honor) possibilities, in the disciplines of Business, Economics, Political science and Sociology (see Degree options, below). It provides students with a broadly-based education, a high level of flexibility in two very important ways from offering the second year onwards: (a) in choosing the specific degree you wish to read; and, (b) in choosing individual modules. The common first year of BESS introduces you to a broad range of disciplines that will help you make sense of the complex world It gives you the freedom to discover and in which we live today. develop interests that you may not be aware you have until you From the second year onwards, the flexible enter university. structure of the BESS programme allows you to pursue these specific interests in greater breadth and depth while still retaining considerable freedom over the selection of individual modules. Graduates of former years invariably tell us that it is this broad flexible approach that allowed them build the knowledge and insights that they rely on progressively as they advance to more senior positions in their careers. Further information Career opportunities Study abroad Assessment www.histories-humanities.tcd.ie/amhc +353 1 896 2625 Tel: Graduates in the disciplines studied on the course have entered Graduates in the disciplines studied on the including university, an exciting variety of fields after leaving art restoration, business, advertising, archaeology, accountancy, museum work, civil service, diplomatic corps, heritage and publishing and human resources, journalism, management, to postgraduate study teaching. Several others have progressed America. at universities across Ireland, Europe and Trinity College maintains a wide range of international links College maintains a wide range Trinity Europe – from France to Cyprus. Many with universities across teach courses in English too and foreign universities now exchange programme it is possible to through the Erasmus (second) year abroad. spend the Senior Freshman A combination of end-of-year examination and continuous and continuous of end-of-year examination combination A team presentations and (e.g. essays, seminar assessment written in texts), and a thesis is commentaries on projects and the final year. 38 Arts, Humanities and Social Sciences Features oftheBESSdegreestructure: 10 degreeoptions. After thecommonfirstyear, BESSleadstothefollowing Degree options n n n n n n Students takesixmodules: The commonfirstyear n n n then analysedindetailsmallgroups. lectures deliverauthoritativesummariesofmaterialwhichis way BESSstudentsareprovidedwiththebestofbothworlds: in whichyouwillworkthroughouttheacademicyear. Inthis Lectures arecomplementedbysmallertutorial/seminargroups * French,German,Spanish,RussianorPolish

and Business Sociology Economics Business and four disciplines) Joint honordegrees(combininganytwooftheabove (B.B.S.) Business Single honordegrees Course content Introduction to Central,EastEuropeanandRussian Introduction to Area Mathematics andstatistics Sociology and management Organisation Political science Economics Consultations with your personal tutor, withyourpersonal Consultations lecturersandthe andassociated choiceofsubjects Through judicious iscompletelyopenand Access toall10degreeoptions Studies ORLawSocialPolicyalanguage* choices aremade. Careers Advisory Servicehelptoensurethatinformed interests, aptitudesandemergingcareeraspirations. programmes inaccordancewiththeiracademicresults, therefore haveanopportunitytoadjusttheirstudy final choiceuntilthebeginningofthirdyear. Students the secondyear, thusfacilitatingthepostponementofa open uptothreeofthetenBESSdegreeoptionsthroughout modules afterthecommonfirstyear, itispossibletokeep unrestricted attheendofcommonfirstyear.

Economics Political science Business and Political science Economics and science Political and Sociology Economics and Sociology Political science Sociology

Arts, Humanities and Social Sciences 39

International economics Monetary thought and policy Economic and legal aspects of competition policy Economics dissertation Contemporary political theories Political parties Issues in contemporary politics Contemporary international relations African politics Research seminar Sociology dissertation Economic sociology of Europe Conflict studies Popular culture and digital lives Migration inequality and Poverty, redistribution Strategic information systems International business International Exploring organisational experiences analysis Financial reporting and the Financial markets and corporate sector theory Advances in marketing and practice Managing non-profit organisations and risk International finance management Entrepreneurship: a commercial and social perspective Economic theory economy The World Development economics Economics of financial markets economics Transport Quantitative methods Year 4 (4 modules) Year n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n Information systems and technology Economics of policy issues Industrial economics Mathematical economics Econometrics Research methods for political scientists Irish politics Government and politics of the United States Democracy and development European Union politics Social theory and social inequality Globalisation and development Researching society Race, ethnicity and identity Comparative welfare states Crime and social policy Company law Commercial law International law Financial and management Financial and accounting Applied finance Marketing management Human resource management change Organisation theory and Operations management Business in Society Economic analysis Money and banking European economy Economics of less developed countries Investment analysis Year 3 (6 modules) Year n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n

www.tcd.ie/bess/downloads/Booklet.pdf Central problems in philosophy History of philosophy Logic and philosophy of science Social security policy Health policy Housing policy Crime and Irish society Language option (1 of 5) Law Broad Curriculum options International relations Comparative politics culture and society Gender, European societies Introduction to social research (see p. 13) Economy of Ireland Economics of public policy Mathematics and statistics History of political thought Introduction to accounting Financial analysis Introduction to finance Introduction to operations management Intermediate economics Organisational behaviour Organisational Principles of marketing n n n n n n n n n n n n n n n n n n n n n n n n Year 2 (6 modules) Year n n Political science Sociology Complementary modules (available as electives) Economics Business BESS at a glance BESS Full module details are available via 40 Arts, Humanities and Social Sciences oneself for a career in a specific sector or for postgraduate study. at thesametimeprovidinganexcellentopportunitytoposition research aparticularsubject,issueorcompanyingreaterdepth, a dissertationorpreparecasestudy. This allowsstudentsto In thefinalyear, studentsmayberequiredorpermittedtowrite Final-year dissertation/casestudy: and modulechoice. exceptionally highflexibilitywithregardtoprogrammedesign available intwodisciplines,jointhonourprogrammesoffer Since modulechoicesmaybemadefromamongthefullrange of theirmodulesfromeachthetwodisciplinestheyselect. Throughout years2-4,jointhonorstudentstakeabouthalf Choosing modules–jointhonordegrees: range ofspecialistsubjectsthatbecomeavailable. choose thosemoduleswhichappealmostfromtheincreasing BESS philosophyofflexibility, thereissignificantscopeto modules fromtheirchosendisciplinebut,inkeepingwiththe In thethirdandfourthyears,studentstakemajorityoftheir three disciplinesandfromthesetofcomplementarymodules. choose theirremainingmodulesfromoneormoreoftheother module loadfromtheirpreferreddiscipline,leavingthemfreeto In thesecondyear, studentstakeapproximatelyhalfoftheir degrees: honor single – modules Choosing for thatdegree. for particulardegreeoptionsandaredesignatedasmandatory number ofthesemodulesareconsideredtobe‘coresubjects’ specialised modulesthatareavailableinthelateryears. A small This growingportfolioofmodulesillustratestherangemore Year 4:40modules. is roughlyasfollows: Year 2:20modules, Year 3:30modules, The totalnumberofmodulesavailabletochoosefromeachyear complementary modulesoffered byotherdisciplines. within BESSinthesecond,thirdandfourthyears,including of therichnessanddiversitymodulesthatareavailable The table‘BESSataglance’ (seeabove)givesyouasense Years 2-4 examinations. The remainderisbasedonresultsofwrittenend-of-year contributing upto50%oftheoverallgradeforyear. assessment, research-basedessays,projectsandpresentations Most BESSmodulesinvolveasystemofcontinuous Assessment postgraduate qualificationfrom therelevantpartnerinstitution. in BusinessStudies(B.B.S.)from Trinity CollegeDublinanda award ofthedegreeB.A.(Moderatorship) ortheBachelor Haute EtudesCommerciales(HEC). These leadtothe the ÉcoleEuropéennedes Affaires (EAP) ortheÉcoledes programmes involvinganextendedperiodofstudyateither There arealimitednumberofplacesavailableontwodegree America, Australia andin Asia (China,HongKongandJapan). programmes toprestigiousuniversitiesinEurope,North BESS alsooffers English-speaking internationalexchange or Spain. university in Austria, Belgium,France,Germany, Italy, Russia will meanspendingallorpartofthethirdyearabroadata apply toparticipateinanErasmusexchangeprogramme. This Students whohavetheprerequisitelanguageproficiencymay option tostudyFrench,German,Spanish,RussianorPolish. their thirdyear. FirstandsecondyearBESSstudentshavethe Many studentsinBESShavetheopportunitytostudyabroad Languages andstudyabroad through ourstudyaboardprogramme. in-company projectsandaninternationaldimension you leavewithacoreknowledgeoftherealworldthrough to hearsometheworld’s leadingexpertsinbusiness;and universities intheworld;yougiveyourselfopportunity give yourselfawonderfuleducationinoneofthetop So byjoiningthe Trinity CollegeSchoolofBusinessyou non-profit businesses,bothinIrelandandinternationally. government, entertainment,technology, innovationand students arenowleadersintheworldofbusiness, business world.Past Trinity CollegeSchoolofBusiness challenge themandguideintotoprolesintheglobal leading businesspeoplewhoengagewiththestudents, We haveahostoftopinternationalprofessorsand School wetakethebeststudentsandmakethembetter. innovative, dynamicandthoughtinspiringBusiness in Ireland is ranked76thintheworld and mostwidelyrecogniseduniversities(Trinity College you needtoalignyourselfwithoneoftheworld’s best open thebusinessworldtoyouonyourgraduation. Thus, first classeducationandanetworkofglobalcontactsto a globallyrecognisedqualificationthatprovidesyouwith to performthehigheststandards.Italsoincludeshaving This includesthequalityofyoureducationtoenableyou ensure thatyouhavethebestpreparationtosucceed. When youdecideonacareerinbusinessneedto School ofBusiness? College Trinity the choose Why 2 1 1st inIrelandand15thEurope The Trinity CollegeSchoolofBusinessisranked University Rankings. 2010 Eduniversal GlobalTop2010 Eduniversal 100BusinessSchoolRankings. Times (THES)2010World Supplement HigherEducation 2 . 1 ) andthetopBusinessSchool 2 . Here atthisunique, double

Arts, Humanities and Social Sciences 41

Susan Murray stressful enough without having “Leaving cert year is The degree options career path! to decide on a future and at best, confused my intentions available dazzled me vocation. It was then I decided not towards any particular soon, and make the decision at a to close my options too later stage. me with this option. I was confident BESS afforded informed decision if I sampled I could make a better the faculties before making different several subjects from business, but choice. I fancied myself studying ‘ultimate’ international politics, and even was always curious about in BESS gave accounting seemed enticing! My first year of business me an invaluable insight into a multiplicity to social and related subjects as well as an introduction political science. my surprise, my original intentions of pursuing business To would have altered through trying other subjects I never mainly how BESS That’s thought to do before university. me – it set ended up being such a great decision for a degree in me in the right direction. I chose to follow related business intertwined with similarly Sociology, resource subjects (e.g. Industrial relations, Human labour management, Management and the European This combination would never have appealed market). but was positively the right choice to me before university, for me career wise. It The world is your oyster being a BESS graduate! The Europe. does not confine you to Ireland, or indeed of degree prepares you well. My extensive knowledge presentedinternational markets and international relations professional me with many opportunities to experience be living life abroad. Who would have thought I would and working in Russia?” Student Profile Student www.tcd.ie/Careers/students/

Further information Career opportunities Career E-mail: [email protected] www.tcd.ie/BESS +353 1 896 1840 Tel: Accountancy, Banking & corporate finance, International Banking & corporate finance, International Accountancy, Marketing, Management Law, organisations, Journalism, Policy bodies, Teaching, service, consulting, Politics, Public See organisations. Voluntary BESS is your roadmap to a wide and varying career. About About and varying career. roadmap to a wide BESS is your and to further study in masters graduates proceed 50% of our The remaining and abroad. both in Ireland doctoral programmes range of employment opportunities in areas 50% enter a diverse such as: approach will help you build valuable The BESS multidisciplinary work the ability to communicate effectively, career skills such as analyse complex in and lead teams, conduct research and rapid advancement problems – all of which will prepare you for the hallmark of within the flexible career structures that are modern employment. degree for further details. 42 Arts, Humanities and Social Sciences a language Polish orSpanish) Russian, German, (French, Business studies and and studies Business Advanced GCE(A-Level) TR082: Computerscienceandbusiness,page120 TR081: BESS,page37 TR017: Lawandbusiness,page72 See also: GCSE Leaving Certificate Special EntryRequirements: DEGREE AWARDED: COURSE CODES:

Grade C OC3/HD3 Grade B Grade C Grade C Grade C HC1 HC3 HC1 HC1 B.B.S. (Lang.) (10 places,points2010:475) TR090: Spanish (5 places,points2010:420) TR089: Polish (7 places,points2010:410) TR087: Russian (15 places,points2010:440) TR086: German (15 places,points2010:505) TR085: French French (TR085) Mathematics (TR087 & TR089) other thanEnglish TR090) TR087, TR089 & (TR085, TR086, (TR087 & TR089) other thanEnglish Mathematics Spanish (TR090) In alanguage German (TR086) Spanish (TR090) In alanguage German (TR086) French (TR085) TR090) TR087, TR089 & (TR085, TR086,

their businessandlanguageskillsinaprofessionalsetting. placement inthetargetcultureordertoapplyanddevelop specialist fieldofstudy;and(d)studentscompletea experts whoarecontinuouslyconductingresearchintheir society andcultureoftherelevantcountryareprovidedby speakers; (c)lecturesontheeconomy, businessenvironment, for businessandeconomics’ lecturers,mostofwhomarenative language instructionisprovidedbyspecially-trained‘language under jointsupervisionbybusinessandlanguageprofessors;(b) students writealengthycasestudyintheforeignlanguage, especially duringtheyearabroadandinfinalyear, when and languagedimensionsinallyearsoftheprogramme, centres onthefollowing:(a)thereisintegrationofbusiness The distinctivenessof Trinity College’s B.B.S.(Lang.)degrees economy). of whicharehighlyrelevantinIreland’s exceptionallyopen intercultural negotiationandinternationalmanagement,all situations (e.g.workinginmulti-disciplinary/multi-culturalteams, are increasinglyrequiredinavarietyofcareersandemployment developing awiderangeofgenericandtransferableskillsthat your linguisticcompetence. At thesametime,youwillbe command ofbusinesstheoriesandpracticesdevelops course simultaneouslybroadensanddeepensyouracademic the thirdofwhichisspentstudyingandworkingabroad, society, cultureandbusinessenvironment.Overitsfouryears, comprehensive mannerwithanothercountry’s language,its of subjectareasaswellgettingtogripsinanin-depthand mainstream businessconcepts,theoriesandmodelsinavariety The programmeoffers anexcitingwayoflearningabout or Polish). speakers orthosewhohaveanentrancequalificationinRussian knowledge ofRussianorPolish(heritagespeakers,near-native * Specialprovisionscanbemadeforstudentswithprior sought afterbyemployers. that masteryofthesechallengesbuildsskillsareparticularly learning stylesonthepartofstudent,buttheyalsostress employing different teachingapproaches andrequiringdifferent challenges associatedwiththestudyoftwodisparatedisciplines language learning.Educationalexpertsemphasisethespecial (see thetableBESSataglance,page39)andtoallaspectsof motivation andcommitmenttomasteringcorebusinessmodules Spanish), youwillberequiredtodemonstrateahighlevelof streams) orasmoreadvancedlearners(inFrench,German whether asbeginners(ontheabinitioRussianandPolish* a highlevelofproficiencyinlanguage.Fromstarttofinish, balanced interestsinlearningaboutbusinessanddeveloping Students onallfivestrandsofthisprogrammemusthavewell- Course overview Is thistherightcourseforyou? work Arts, Humanities and Social Sciences 43

work placement of approximately two work placement of approximately See p. 40 Why choose the Trinity College School of Business? Career opportunities Assessment by consultancy organisations, embassies and public sector bodies. Many are working in marketing or international management roles while others occupy more specialist business international in research and study further undertake to at postgraduate level. high-level of competence in the language you have studied. Recent graduates are employed in Ireland and abroad by leading international companies such as Google, Whirlpool, AIB Capital Markets and Goldman Sachs, as well as KPMG, positions (e.g. as analysts or researchers). Several proceed On graduation you will have a strong academic knowledge On graduation you will have a strong academic together with a of international business and management, The Sophister years The Sophister or is spent at a university Sophister (third) year The Junior studying. are you language the of country the in school business a range of agreements with College has exchange Trinity Europe. schools throughout and business leading universities and examinations taken during The vast majority of modules be through the medium of your chosen your year abroad will experience of of the academic year, language. On conclusion in the country of your chosen language the business culture is gained through a duration. months’ studies are divided more (fourth) year, In the Senior Sophister business modules and more advanced or less evenly between two integrate the To in the language. study of and practice write a major case you will research and areas effectively, foreign language). study (approx 10,000 words, written in the enterprise based in This will involve the analysis of a business will be linked to the the country of your chosen language and theory mandatory business module Strategic management: and practice. on the normal The evaluation of the year abroad is based The university. assessments and examinations of the host of Trinity College consists evaluation of the final year in (e.g. group a range of continuous assessment exercises and end-of-year projects, essays, term tests), the case study written, oral, aural examinations. In the language area, regular the year. and presentation exercises are required throughout

but want to be sure, you are most welcome to sample welcome to sample be sure, you are most but want to during the participating departments lectures in also discuss your options may You teaching terms. Contact either the teaching staff. with a member of the the language department/s by School of Business or below). e-mail or phone (see If you are considering studying BSL at Trinity College, College, Trinity at studyingIf you are considering BSL

oral and aural proficiency) country of your chosen language General language and language for business (written, institutions and culture Contemporary society, Overall economic and business environment of the region/ Economics Mathematics and statistics Law Accountancy and financial analysis Finance Operations management Organisational behaviour Management and organisation Marketing n Course content Did you know? Did you

n n n There is also the option to attend modules in areas such n n Language n n n politics and economics in the second year. as sociology, n n Business studies n n Modules in the first and second years include: The Freshman years (years 1 & 2) The Freshman years (years and tutorials There are approximately 18-20 hours of lectures This are chosen. per week depending on which subject options study. should be matched by a similar level of personal Teaching is specifically geared to the everyday needs, both Teaching Accordingly, formal and informal, of business managers. will have a the language components of the programme orientation, contemporary socio-economic and business perspective. as distinct from a historical or literature-based the target language, Much of the teaching is provided through knowledge relevant simultaneously building language skills and to managing across cultures. This programme aims to provide you with the knowledge This programme aims to communicate internationally and to and skills necessary contexts of markets, understand the social, political and cultural In addition organisations and management across countries. and social studies, to studying modules in business, economic culture and civilisation institutions, you will study the society, associated with your chosen language. 44 Arts, Humanities and Social Sciences Tel: +35318961376/1257 E-mail: [email protected] Dr. Grace Magnier: Business studiesandSpanish: Tel: +35318962416/1896 E-mail: [email protected] Dr. Dmitri Tsiskarashvili: Business studiesandRussian: Tel: +35318961291/1896 E-mail: [email protected] Dr. Ewa Stanczyk: Business studiesandPolish: Tel: +35318962329/1373 E-mail: [email protected] Dr. GillianMartin: Business studiesandGerman: Tel: +35318962313/1553 E-mail: [email protected] Dr. ClaireLaudet: or Tel: +35318961472 E-mail: [email protected] Dr. PauleSalerno-O’Shea: Business studiesandFrench: Tel: +35318962707/1027 E-mail: [email protected] www.tcd.ie/business/bsl Business School: Further information

College isuniqueinhavingChairsbothGreekandLatin. College sinceitsfoundationjustover400yearsago,and Trinity language asabeginner. Classicshasbeentaughtin Trinity studied eitherGreekorLatinatschool,youcanlearntheother approach totextualandmaterialculture.Ifyouhavealready a thoroughknowledgeoftheclassicalworldandcritical examination ofkeyaspectsancienthistory, youwilldevelop reading ofliteratureintheoriginalGreekandLatin history andthoughtofancientGreeceRome. Through the The studyofClassicsisconcernedwiththelanguage,literature, independent thinking. lively discussion,analyticskills,andthedevelopmentof language-based coursesthegroupswillbesmall,stimulating interdisciplinary perspectiveonclassicalculture.Forallofyour history, mythandreligion, youwillacquireacomprehensiveand into cultureandthought. Through the criticalstudyofancient engage withancienttextsbothasliteratureandagateway or takinguponeofthelanguagesasabeginner, youwill letter writing. Whether you are continuing your language studies genres, includingepicpoetry, drama,philosophy, historyand Over thefouryearsyouwillreadtextsinawidevarietyof this course. two civilisationsthatshapedthewesternworld,youwillenjoy imagination, thedepthsofthoughtandhistoricalvalue If youareinterestedinstudyingthelanguages,poetic Course overview Classics Course content Is thistherightcourseforyou? Latin, page110 Greek, page104 Classical civilisation,page95 (TSM subjects): Ancient historyandarchaeology, page93 See also: Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

HC3 Grade C B.A. 425 15 TR021 Greek orLatin Greek orLatin

Arts, Humanities and Social Sciences 45

Study abroad Career opportunities Further information Assessment to an in-depth study of topics in Greek and Roman literature, Greek and Roman literature, study of topics in to an in-depth in their your analysis of texts will refine You culture. history and skills and more specialised cultural context through literary and as textual criticism, linguistics and literary methodologies, such may include Polybius and the Hellenistic theories. Greek topics and Hellenistic poetry. Greek comedy, Archaic poetry, Empire, Latin historians, poetry, Augustan Latin topics may include (third) In your Junior Sophister body. Satire, Desire and the while separate to study ancient history, year you will continue additional assistance in improving language classes provide in reading and interpretation. In the your fluency and accuracy year you will write a thesis on a subject Senior Sophister (fourth) which will This is an opportunity to do research of your choice. independent ideas and acquire critical allow you to develop area that particularly skills, while investigating in great depth an interests you. College has strong links with many classics departments Trinity Erasmus exchange abroad, including active participation in the Cyprus. and Switzerland France, in universities with programme their Senior This allows students the option of spending Freshman (second) year abroad. has a long tradition of Classics graduates College Trinity who have continued onto postgraduate study and successful America. Recent academic careers both in Europe and graduates have also taken up careers in journalism, public relations, translation and teaching, and with employers such as the Sunday Independent, the European Commission and merchant banks. www.tcd.ie/Classics E-mail: [email protected] +353 1 896 1208 Tel: The Sophister years The Sophister years you will progress (third and fourth) In the Sophister combination of end-of-year examination and continuous A and other assessment (e.g. essays, unseen translations presentations) language tests, textual commentaries, seminar and a thesis in the final year.

– an introduction to the major – text-based courses introduce you to the be at the same level as those who have studied Greek or Latin before entering university. the language. By the end of the year you will be ready to read original texts and your command of the language will Elementary Greek or Latin – an intensive introduction to Latin language – this course allows you to practiceLatin language your translation skills and to study the language of authors not covered in the text-based courses. Latin authors critical reading of Latin literature through a close examination and contextualisation of Roman poetry and prose from the early republican to the imperial period: the comedies of famous speech On Behalf of Cicero’s Terence, Plautus and Ovid, and Catullus of poems love the Aeneid, Virgil’s Caelius, Younger. and the letters of Pliny the Greek language – this course allows you to practice your of authors not translation skills and to study the language covered in the text-based courses. Greek authors – text-based courses introduce you to a close the critical reading of Greek literature through and most examination and contextualisation of the oldest influential works in western literature: Homer’s Iliad and the Histories of Herodotus, the tragedies of Odyssey, prose Euripides and Sophocles, and the philosophical of Plato. Mythology and religion Mythology and – an introductory survey of – an introductory survey Greek and Roman history Archaic age world, from the Greek the Greek and Roman such The course covers topics to the early Roman Empire. the conquests democracy, Athenian as politics and power, of Rome as a major imperial the emergence Alexander, of colonisation, war and conflict. power, using both literary myths and religions of the classical world also explores theories The course and material evidence. of myth and the functions of myth within society.

Greek or Latin for beginners n n Latin for non-beginners n n Greek for non-beginners n n n The Freshman years The Freshman to you will be introduced Freshman (first) year In the Junior The and literature. culture study of ancient history, the critical have you whether on depend take you courses language-based of the or are taking one Greek and Latin before studied both your Senior Freshman (second) In languages as a beginner. the study of Greek and Latin language, year you will continue and small- Courses are taught by lectures literature and history. hours per There are twelve to fourteen contact group seminars. week. 46 Arts, Humanities and Social Sciences difficulties. They alsoassess,diagnoseand treatpeoplewithswallowing maximise theirspeech,language andcommunicationskills. communication difficulties,helping themtofindways Speech andlanguagetherapists workwithpeoplewhohave language studies language studies? Clinical speechand What is Clinical speech and and speech Clinical is What Advanced GCE(A-Level) Advanced GCE(A-Level) GCSE GCSE Either In addition: In addition: Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: See page27forfurtherdetails. Students willberequiredtoundergoGardavetting. Garda Vetting: See Precautionsagainstinfectiousdiseases,page202. GCSE Or

Grade C Grade C OD3/HD3 Grade B Grade B Grade C HC3 HC3 B.Sc. (Clin.Lang.) 525 34 TR007 In oneofphysics, In oneofEnglish, Mathematics Spanish Russian or Irish, Italian, French, German, mathematics chemistry, biology, science or agricultural physics/chemistry chemistry, biology, physics, mathematics, applied mathematics, Spanish Russian or Irish, Italian, French, German, In oneofEnglish, In oneofphysics, Mathematics In oneof In oneofEnglish, or mathematics chemistry, biology Spanish Russian or Irish, Italian, French, German,

adaptable andenjoycollaborativeproblem-solving. language isimportant,itcriticalthatyouarepeople-oriented, with parentsand/orfamilies.Whileaninterestinscienceand In almostallinstances,youwillalsofindyourselfdealing schools, communityclinics,specialistclinicsandhospitals. people ofallagesandwillworkinarangesettings,including speech andlanguagetherapist,youwillcomeintocontactwith approach tolearning? Are youflexibleandadaptable? Asa Do youenjoyworkingwithpeople?haveaquestioning Theory andClinicalpractice. The componentcoursesaregrouped undertwoheadings: in theJuniorFreshman(first)year (includingclinicalvisits). There areapproximatelytwenty-fourteachinghoursperweek so thatyoucancontinuedevelopingyourknowledgebase. the course. You willalsogainexperienceinresearchtechniques, psychology andbiomedicalsciencesaremajorcomponentsof difficulties tomanagethose effectively. Linguistics, placed toassistthosewhohavecommunicationandswallowing communication developmentanddisorders,sothatyouarewell you willbeexpectedtodevelopanin-depthunderstandingof of SpeechandLanguage Therapists. Overthefouryears, option. ItisrecognisedandaccreditedbytheIrish Association This isafour-yeardegreeandcanonlybetakenasfull-time projects. an on-siteclinicwhereyoumaybeinvolvedinclinicalresearch ensure thatstudentsgetabroadrangeofexperience,aswell the start.We haveaccesstoawiderangeofclinicalsettings, Clinical placementsareanimportantlearningcontextrightfrom that mirrortheproblemspeopleencounterinaclinicalsituation. stages inthecourse,youwillbeinvolvedsolvingproblems This courseisforstudentswhoenjoylearningbydoing. At all within specialistclinics. clinics, inschoolsand/ordaycarecentresormaybesituated in communitysettingssuchasprimaryandcontinuingcare social workeramongothers. Therapists mayworkinhospitals, teacher, psychologist,doctor, occupationaltherapist,nurseand work aspartofamultidisciplinaryteamthatmayinclude dyslexia) andpeoplewithmentalhealthdisorders. They often with theirvoice,peoplewrittenlanguageproblems(e.g., impairment, autism),peoplewhostutterorhaveproblems (e.g., cerebralpalsy),learningdifficultiesintellectual who havehadastroke,peoplewithphysicalimpairments development ofspeechsounds. They alsoworkwithpeople who aredelayedintheirearlylanguagedevelopmentand/or Speech andlanguagetherapistscommonlyworkwithchildren at birth,othersareduetoaccidentsorillnesslaterinlife. life andtheyhappenforavarietyofreasons.Somearepresent Communication difficulties can occur at any stage in a person’s Is thistherightcourseforyou? Course overview

Arts, Humanities and Social Sciences 47

. Graduates of the course who wish www.hpc-uk.org Further information The Trinity College degree and Career opportunities Assessment professional practice contact the American Speech-Language-Hearing Association Association American Speech-Language-Hearing contact the Association of Speech- or the Canadian at: www.asha.org Audiologists at www.caslpa.ca/ Language Pathologists and english www.tcd.ie/slscs/clinical-speech-language/ +353 1 896 1496 Tel: On graduation, your qualification from Trinity College Dublin is Trinity On graduation, your qualification from and Language recognised as a licence to practice as a Speech the degree are eligible to Those holding Therapist in Ireland. of Speech and Association apply for membership of the Irish . Graduates who www.iaslt.com Therapists (IASLT) Language Health Professionals wish to work in the UK should contact the Council, to apply for to work in another European country will have If you are considering government approval in that country. applying for professional recognition to work as a Speech- Language Pathologist in the US or Canada, you should For more detailed information on your career prospects, visit and websites at www.iaslt.com the professional associations’ www.rcslt.org The Sophister years The Sophister years the theoretical (third and fourth) In the Sophister on therapy more specifically of the course focuses component approaches. takes on greater significance in The clinical component by a combination of theoretical knowledge is assessed Your examinations. continuous assessment and written end-of-year College Trinity both in Practical clinical examinations take place on placement. and in the clinics that you have been attending basis by Clinical placements are examined on a continuous There are additional practice educators who work with you. observed in assessment procedures where students are examination to practice, and present their clinical work for College mentors. the final two years of the course. By the end of the Senior the final two years of you will be expected to participate fully Sophister (fourth) year as well as in therapy planning and in assessment and diagnosis, work is supervised, with students learning implementation. Such skills during the process. self-evaluation and reflective

swallowing – You will learn about possible frameworks and You swallowing – tools for assessing skills in each of these areas, as well as how to ensure individuals with communication difficulties can participate in society and CHILDES Psychology Clinical and experimental phonetics Linguistics General and neuro-anatomy Physiology – organisms the study of the functions of living Disorders of speech, language and and communication Speech and hearing syntax Linguistics – introduction to language study, Phonetics – the study of vocal sounds Psychology Clinical practice Pre-clinical skills

n n n In the Senior Freshman (second) year, theoretical courses move In the Senior Freshman (second) year, to more specific areas and you will study: n n n n n n n n n In the Junior Freshman (first) year you will be introduced to the In the Junior Freshman (first) year you will These courses will be area of language acquisition and speech. the foundation for later years of study. of the problems are assessed through group oral presentations presentations oral group through assessed are problems the of students feedback guides Tutor and/or written assignments. The Freshman years – theoretical component: PBL provides studentsProblem-based or problem-centred learning objectives. with structured problems for specified learning to research how Students work in groups (under supervision) to ‘solve’ the problem set. They share their information with the problem set. to ‘solve’ teamwork. Many each other and develop important skills in at every stage. Clinical practice of one day per week is reserved During term time an average will also be required to undertake You for student clinical work. term time: a three-week block in the clinical practice outside a four-week block in the year, Senior Freshman (second) year and a one-week block in the Junior Sophister (third) six- to eight-week block is A Senior Sophister (fourth) year. Sophister year. also organised within term time in the Senior Ireland, it may While you will generally attend clinics around clinics in other be possible, by special arrangement, to attend countries. Teaching methods include lectures, tutorials and case-based methods include Teaching work in small teams to address learning, as well as group learning approach. problems set in the problem-based Theoretical component Theoretical and language pathology, areas include speech Major subject physiology, anatomy, discourse analysis, psychology, linguistics, and audiology. neurology 48 Arts, Humanities and Social Sciences developing valuableresearchskillsaspartofthiscourse. public informationservicedelivery. There arealsooptionsfor hearing people,openingupopportunitiesinsubtitlingand in developingaccessiblemultimediaforDeafandhard-of- Ireland. Those specialising inDeafstudieswilldevelopskills of professionalISL/EnglishinterpretersandISL teachersin a secondlanguage. There iscurrently asignificantshortage their familiesathome,andwithadultswhoarelearningISL as learning inarangeofcontexts,workingwithDeafchildrenand employment relatedsettings.ISL teachersdeliverlanguage including legal,medical,educational,socialservices,and communication in a range of community and conference settings or asgeneralistsinDeafstudies.ISL interpretersfacilitate Sign Languageinterpreters,Irishteachers Sign Language(ISL)andmaychoosetospecialiseasIrish historical perspectives.GraduateswilldevelopfluencyinIrish of theDeafcommunityfromsocial,educational,policyand Deaf studiesisadisciplinethatencompassesanunderstanding What isDeafstudies? Deaf studies may beeligibleforinclusioninthescheme. this course.EUstudentsregisteredforDeafstudies The Government’s FreeFeesInitiative DOEScover See p.27forfurtherdetails. Students willberequiredtoundergoGardavetting. GARDA VETTING: studies iftheyholdaII.2orabove. may applyforentrytoyear3oftheBachelorinDeaf Sign Language(ISL)teachingandISL/Englishinterpreting Graduates oftheCentre’s DiplomasinDeafstudies,Irish Entry to Year 3ofBachelorinDeafstudies GCSE Advanced GCE(A-Level) Leaving Certificate ENTRY REQUIREMENTS: AWARD: POINTS 2010: PLACES 2011: COURSE CODE:

Grade C HC3 Grade C OD3/HD3 B.A. 335 20 TR016 English literature English other thanEnglish language (A or B) (A orB)English other thanEnglish In alanguage In alanguage ISL/English interpretingorISL teaching. culture, andforthosefollowingspecificpaths,theprofessionof competencies relatedtotheDeafcommunity, itshistoryand equip studentswithabroadspectrumofknowledge,skillsand involves anintegratedprogrammeofstudywhichisdesignedto those wishingtoworkinorwiththeDeafcommunity. The degree comprehensive introductiontotheDeafcommunityandISL for No priorknowledgeofISL isrequired. The courseprovidesa Deaf studiesisafour-yearfull-timehonorsdegreecourse. and societybeopentousingtechnologyinyourlearning. You shouldhaveaninterestinlearningaboutlanguage,culture to becapableofworkingindependentlyandaspartateam. that youareadaptableandpeople-oriented. You willalsoneed of Deafandhard-of-hearingpeople.Itisimportant,therefore, many instances,youwillalsofindyourselfdealingwithfamilies communities andbridgingcommunicationculturalgaps.In settings. You willbeworkingbetweenDeafandhearing clinics, hospitals,legalcontextsandawiderangeofcommunity of settings,whichmayincludeeducationalcommunity with peopleofallagesandwillberequiredtoworkinarange Working intheareaofDeafstudiesyouwillcomeintocontact Language, Theory andPractice. The componentcoursesaregrouped underthreeheadings: of directteaching. Freshman (first)year, thereareapproximately 17hours Erasmus links)acrosstheEuropeanUnion.InJunior working with/fortheDeafcommunityinIrelandor(through three andfourincludepracticeplacementswithorganisations project, whichculminatesinadissertation.Forallstudentsyears for Deafandhard-of-hearingpeopleorcarryingoutaresearch options relatingtothedevelopmentofaccessiblemultimedia performance. ForthosetakingtheDeafstudiesroute,thereare planning andimplementingacurriculumassessingstudent psychology ofeducationareintroducedalongwithguidanceon four. ForstudentstakingtheISL teachingroute,aspectsofthe guided byethicalpracticeareemphasisedinyearsthreeand students, translation theory and the practical skills of interpreting, explored inyearsoneandtwo.ForISL/Englishinterpreting acquisition ofasignedlanguageforDeafchildrenarealso structure ofISL,thesociolinguisticcontextandpathto public healthservicesareexplored.Understandingofthe political standingofsignedlanguagesandaccesstocritical the representationofDeafpeopleinmedia,legaland while inyearsoneandtwo,themessuchasDeafeducation, society. ISL isstudiedacrossthefouryearsofprogramme, of Deafpeopleinternationally, historicallyandincontemporary of understanding theIrishDeafcommunityandof the experience This four-yearfull-timedegreecoursegivesyouanin-depth Course overview Is thistherightcourseforyou? Course content

Arts, Humanities and Social Sciences 49

– including issues – including issues – focusing on experiences – focusing on experiences Interactive discourse analysis Deaf education the Deaf community with Working Ethics 1 Sociolinguistics and signed languages – introduces the and signed Sociolinguistics context impacts on language use in ways in which the social generation, reference to gender, signed languages, including the impact of educational policy and regional variation and Also looks at issues of use. the media on sign language and language planning. language recognition deafness Perspectives on society of being a deaf/deafened person and how to deaf (contemporary and historically) has responded This course has a strong international dimension people. culture, Deafhood and looks at the issues of community, and what it means to be deaf in Europe today). and deafness Language acquisition of of “home signing” and the impact of late acquisition children. languages – spoken and/or signed – for deaf Language processing Deaf community of mental health and mental illness in the and interpreting: Philosophy and practice Translation or strand) (for those aiming to pursue the interpreting – introduces aspects – introduces aspects linguistics to sign Introduction languages including phonology, of the grammar of signed syntax, semantics, and pragmatics. phonetics, morphology,

Students can step out of the programme on successful Students can step out of the programme on studies or may completion of year 2 with a Diploma in Deaf continue on to degree level. in the language. n n n n The Sophistor years In years 3 and 4, you will opt to follow one of three strands: teaching or (iii) Deaf studies. (i) Interpreting, (ii) ISL components are shared across all courses, in the While the ISL Sophistor years, you will take specific theoretical and practice- based courses to support professional skill development in your specific area of interest. In order to opt for the interpreting or will need to have achieved a II.2 in the Senior route, you ISL Freshman (second) year. The Sophistor years – Language component courses: ISL5, In years 3 and 4, you will complete four more ISL fluency where you a level of bringing you to ISL7 and ISL8, ISL6, will be able to understand an academic lecture delivered in ISL, and interact with confidence make formal presentations in ISL The Freshman years – theoretical – theoretical years The Freshman component: area of Deaf be introduced to the years you will In the Freshman be the foundation for These courses will linguistics. studies and are: These of study. later years n n n n n

Developing multimedia for the Deaf community Ethics and Philosophy interpreting: and practice Translation Methods of assessment Curriculum planning methods Teaching Interactional discourse analysis Language acquisition and deafness Language processing Deaf education with the Deaf community Working Deaf people and the media An Introduction to sign linguistics Sociolinguistics and signed languages Perspectives on deafness Equality studies

Courses taken in the Freshman (first two) years are ISL1, ISL2, ISL3 and ISL4. Nine hours of contact time per week with ISL lecturers in an immersion setting facilitates rapid development The cornerstone of working with the Deaf community is fluency at ab initio (beginner) level. is introduced in ISL. ISL The Freshman years – language The Freshman years – language component: of ISL skill. of ISL Practical components are introduced in the Sophistor (third Practice component n the Broad Curriculum Students can also select one course from in both years one and two (see p. 13). n n n organisations. with placements include will and years fourth) and These will include a six-week block placement in the Junior Sophistor (third) year and an eight week block in the Senior attend placement While you will usually Sophistor (fourth) year. in an Irish organisation, it is possible, by special arrangement, n n n n n n n n n n to arrange a placement abroad. In previous years, students have undertaken placements with a wide range of Irish organisations Kerry Deaf Resource DeafHear, including the Irish Deaf Society, Centre, SLIS, Bridge Interpreting and the Conroy School of ISL. n n Theoretical component introduce you to aspects of language Theoretical courses will equality sociolinguistics, social policy, acquisition, linguistics, Each theoretical course involves two studies and social studies. per week plus an expectation of self study. hours of lecture time Theoretical courses include: so you will be able to map your progress against your knowledge map your progress against your knowledge so you will be able to have approximately nine hours of of other languages. Students week over the four years. lecturers each class contact with ISL Language component Language you will be introduced four years of the degree, Across the to ISL and language skills will be developed to a high degree. will be developed to and language skills to ISL to the Common European teaching is mapped Our language Europe), (Council of of Reference for Languages Framework 50 Arts, Humanities and Social Sciences professional practice. professionals inthefieldwhocanoffer guidanceonyourpathto Deaf communityinauthenticsettings,andengagementwith interpreters orISL teachers,theactiveengagementwith core competenciesthathavebeenidentifiedforprofessional The objectivesofplacementsincludethedevelopment or abroadtosupportyourprofessionalskilldevelopment. In years3and4,youwillundertakeplacementsinIreland The Sophistoryears–Practicalcomponent n n n n (iii) Deafstudies n n n n n n n (ii) ISL teaching n n n n (i) Interpreting practice ineachofthethreestrands,asoutlinedbelow: components inyears3and4arecloselyalignedtoprofessional theoretical courses(suchasEthics2),butgenerally, theoretical In theSophistoryears,youwillundertakesomecommon The Sophistoryears–Theoreticalcomponent in theCivilService andotherpublicservicebodies. studies, law, etc.Graduateshavealso goneontowork communications, anthropology, multiculturalism,gender for continuingtofurtherstudyin areassuchaslinguistics, ISL teacher, or as anISL interpreter. There isalsoscope as teaching,childcare,socialwork, media,etc.,workasan a resourceofficer)orcombined withanotherskillset,such Graduates frequentlyworkinDeaforganisations(e.g.as allowed furtherplacementexperience. placement performanceisconsideredunsatisfactorymaybe practice placement,andfinalexaminations. A studentwhose Award ofthedegreeisbased oncontinuousassessment,a

Career opportunities Assessment or Dissertation Equality studies, Colonialism and theDeafcommunity Colonialismand Equality studies, community2orResearch fortheDeaf Creating multimedia community1 fortheDeaf Creating multimedia themedia Deaf peopleand Teaching ISL asL2(asecondlanguage) Teaching ISL asL1(afirstlanguage) Teaching ISL forthenationalcurriculum Methods ofassessment Theories ofeducation Teaching methods Curriculum planning interpreting2 Simultaneous interpreting1 Simultaneous Liaison interpreting Consecutive interpreting methods

College Dublin. Communication Sciences,4thFloor, Arts Building, Trinity Centre forDeafStudies,School ofLinguistic,Speechand E-mail: [email protected] Fax: +3538301211 Tel: +3538301252 www.tcd.ie/slscs/cds Further information Did youknow? n

Irish Sign Language is the second indigenous isthesecond Irish SignLanguage was introducedasaprogrammein2002. Deaf Studies was established in 2001 andDeafstudies collaboration withBristol University). The Centre for and ISL teacherswasestablishedherein1992(in first professionaltrainingforISL/Englishinterpreters of Irelandoffering aDeafstudiesprogramme. The Trinity Collegeistheonlyuniversityonisland and hasbeenformallyrecognisedinNorthernIreland. languages recognisedbytheEuropeanInstitutions Centre forDeafStudies.ISL isoneofthemanysigned language ofIrelandandistheworkingat

Arts, Humanities and Social Sciences 51 Is this the right course for you? Is this the right course for Course overview The Freshman years The Junior and Senior Freshman (first and second) years will provide you with the skills of the theatre historian, analyst During these years, the course provides an and practitioner. is Teaching introduction to drama, theatre and performance. by lecture, seminar and practical workshop and is arranged in a series of three-week intensive modules over each of the two semesters. Courses cover defined historical periods, genres and movements, such as ancient Greek theatre, Shakespeare, These courses provide students with a broad foundation in all These courses provide students with a broad They allow students to aspects of theatre and performance. theatre and are specialise in one or more practical areas of and further training in designed to prepare students for careers developmental nature of The strong theatre and related fields. addition to a high level Drama and theatre studies means that, in to possess resourcefulness, you will need of analytical ability, self-motivation and good time-management skills. By its nature, practical theatre work calls for full-time commitment to rehearsal will also need to You and production at certain times of the year. have the ability to work as a member of a team to succeed on this course. Both these courses aim to enable you to explore the relationship between the theory and the practice of theatre, to discover They do this by uniting elements how and why theatre works. cultural, historical and sociological studies with a of literary, practical understanding of the various performing arts.

440-555 TR001 (TSM) 24 500 B.A. See note on page 28 TR025 17 COURSE CODES: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE TSM points: These are restricted entry courses. These are restricted be submitted by 1 February of Applications MUST a Applicants will receive entry. the proposed year of to be completed and returned. questionnaire in March On the basis of the completed questionnaire, some On the basis of the completed and applicants will be called to attend a workshop selections April and May), before final interview (during See also: Acting, page 116. are made. honor TR025 – Drama and theatre studies is a single is read almost course where Drama and theatre studies exclusively for four years. studied as a TR001 – Drama studies (TSM) cannot be with one other single honor course. It must be combined (TSM) subject within the two-subject moderatorship TSM is a joint honor programme. Both programme. and one subjects are normally studied for three years honors degree An subject only is studied in the fourth year. is awarded in both subjects. see page 92. For subjects that combine with Drama studies Drama studies (TSM joint honors) Drama and theatre studies Drama and theatre studies – TR001 (single honor) – TR025 & Drama studies & Drama The TSM course explores theatre and drama mainly from a The theoretical and historical perspective. It combines library-based courses with training in critical and analytical skills. While it follows a similar format to its single honor equivalent – Drama and theatre studies (TR025) – the practical content is limited in the first two years, but allows for the taking of practical TSM students there are modules in third and fourth years. For approximately 7 hours per week of classes plus rehearsals. Students in this course devote their full time to the history, Students in this course devote their full time to the history, and practice of theatre and performance studies. It is theory, those who already have experience in particularly appropriate for school or youth theatre, and it includes considerable community, work in practical theatre activities. For single honor students there are approximately 14 hours per week of classes plus rehearsals. 52 Arts, Humanities and Social Sciences dissertation. a memberofstaff andculminatinginsubmissionofa you willundertakeanindividualresearchprojectguidedby technology. Inyourfinalyear, inadditiontocourseoptions, history, performancestudies,acting,and devising, directing,theatremanagement,filmtheoryand Asia, andtheUSA,stage,costumelightingdesign, includes coursesinthetheatrehistoryofIreland,Europe, some balanceisrequired. The rangeofoptionsisvastand and theoreticalfieldsorinpracticalaspectsoftheatre,although The rangeofcoursesallowsyoutofavourstudyinhistorical in Drama. between Singlehonorstudentsand TSM studentswhomajor Sophister (fourth)year, thereisnodifference incurriculum of coursesrequiredSinglehonorstudents.IntheSenior is noprioritisation),with TSM studentstakinghalfthenumber treated equally in the Junior Sophister (third) year (meaning there range ofoptionalmodules. TSM andSinglehonorstudents are curriculum isconstructedbyeachstudentviaselectionfroma Irish Theatre inContext”forallstudents. The remainderofthe courses. There is a compulsory course entitled “Contemporary performance historywithmorepracticalworkshop-based the curriculumoffers library-basedcoursesintheatreand In theJuniorandSeniorSophister(thirdfourth)years, The Sophisteryears the SamuelBeckett Theatre. experience oftheatreinafullyear-endensembleproduction students, bothSingleHonorand TSM) supplementtheirpractical skills andmultimediatechnology. SeniorFreshmen(second-year supplemented forallstudentsbyclassesinstudyandwriting In theJuniorFreshman(first)yearthesecoursesare the Freshmanyears. Technical theatre). These practicalcoursesrunthroughbothof (Introduction toperforming,Introductiontheatremakingand of thecoursesabovetakeinpracticalareastheatre Classical Asian theatre.Singlehonorstudents,inadditiontoall Melodrama, Genderandperformance,Postmoderntheatre Holloway College(Universityof London). Glasgow, Goldsmith’s College(UniversityofLondon)andRoyal National KapodistrianUniversity of Athens, theUniversity of de Paris-Nanterre(ParisX),theFreieUniversitätBerlin, University ofCalifornia,theHelsinki,Université programme. Dramahasexchangeagreementswiththe at aEuropeanuniversityaspartoftheErasmusexchange You mayapplytospendtheJuniorSophister(third)year and, inyourfinalyear, adissertation. assignments, classpresentations,writtenandoralexamination Assessment isbyacombinationofessays,journals,practical Assessment Study abroad

Tel: +35318962266 www.tcd.ie/Drama careers beginningwithfurtherstudyatpostgraduatelevel. theatre, film,ortelevision.Othershavechosenresearch companies, havewonawards,oractivecareersin number ofrecentgraduateshaveformedtheirowntheatre writing, management,communitydramaandteaching). A of theatre,film,ortelevision(suchasdirecting,acting,design, to takefurthertrainingorapprenticeshipsinspecialistareas seek employmentintheatreorrelatedprofessions.Manyopt Most graduatesofboththesinglehonorand TSM course Career opportunities Did youknow? Graduate Profile Further information n n n London. National Theatre andseveralWest End theatresin television roleshehasalsoperformedattheRoyal as anactoraftergraduation. As wellasmanyfilmand at Trinity College,Dominicwentontotrainprofessionally department productions.LikemanyotherDramastudents English in1992,havingplayedleadrolesDrama from Trinity CollegewithaB.A.inDramastudiesand critically acclaimedHBOseries The Wire.Hegraduated Dominic playsleaddetectiveJimmyMcNultyinthe Dominic West

Contemporary playwrights, directors, actorsand playwrights,directors, Contemporary Drama at Trinity inthepurpose- Collegeishoused Since itsestablishmentin1592, Trinity Collegehas Palmstierna-Weiss, Yong LiLan,andPhillipZarrilli. Mason, Harold Pinter, Fiona Shaw, Jim Sheridan, Gunilla Stafford-Clark, GarryHynes,PamelaHoward,Patrick Bogdanov, GabrielByrne,Sue-EllenCase,Max years, visitorshaveincluded Augusto Boal,Michael work andgiveworkshopsorcourses.Inrecent designers oftenvisit Trinity Collegetodiscusstheir and offices. a dancestudio/rehearsalspace,seminarrooms theatre of Trinity College’s studentdramasociety), performance space,thePlayers Theatre (thestudio the SamuelBeckett Theatre, a208-seatblackbox built SamuelBeckettCentre.Withinthecentreis and Beckett. theatre, fromCongreveandGoldsmithtoSynge educated someofthegreatestdramatistsinworld

Arts, Humanities and Social Sciences 53 Course content Course The Sophister years horizons are In the Sophister (third and fourth) years the language will take expanded; your study of the history of the to the dawn of Modern you back to its Celtic origins and forward At this stage you will be reading prose and poetry as well Irish. and a special course as law and history in the original language, the manuscripts in palaeography will teach you how to read students may opt to themselves. Junior Sophister (third year) Aberystwyth learning Medieval and Modern spend a term in Welsh. The Early Irish course, which is taught through the medium taught through the medium Irish course, which is The Early its the Irish language from covers the history of of English, of the inscriptions at the dawn on the Ogam first appearance language to the highly polished century, Christian era in the fifth texts preserved in the medieval manuscript of the sagas and law Academy TCD, the Royal Irish libraries of collections held in the of the all within a five-minute walk and the National Library, of Irish will The Celtic and Indo-European origins Arts building. to know the great characters of will come You be investigated. including the tragic Deirdre, the doomed Early Irish literature, but irritable Cú Chulainn, the hopelessly Conaire, the irresistible and/ The Pagan and many more. infatuated Muirchertach of the literature will be investigated as or Christian character and the will topics such as kingship, the heroic biography sovereignty goddess. The Freshman years of Old Irish. In the first two years you will study the basics but you will At this stage most literature is read in translation and you will see be introduced to the original texts gradually through the early how the language emerged and developed Christian period. TR001 (TSM-MI) 30 410-555 Irish Irish TR001 (TSM-EI) 10 415-535* HC3 Grade C

See note on page 28 TR022 15 345 B.A.

TSM points: Special Entry Requirements: Leaving Certificate See also: page 122 TR013: Computer science and language, TR027: Irish studies, page 65 Advanced GCE (A-Level) Students may study: EITHER Early and Modern Irish (TR022) OR subject Early Irish (EI) in combination with one other (TR001/TSM) OR other subject Modern Irish (MI) in combination with one (TR001/TSM) honor course. TR022 – Early and Modern Irish is a single TR001 (TSM) Early Irish or Modern Irish can be In studied with one other subject within the two-subject TSM is a joint honor moderatorship (TSM) programme. for three programme. Both subjects are normally studied fourth year. years and one subject only is studied in the An honors degree is awarded in both subjects. and with Modern For subjects that combine with Early Irish Irish see page 92. PLACES 2011: POINTS 2010: AWARDED: DEGREE COURSE CODES: COURSE Is this the right course for you? Irish (Early Irish and and (Early Irish Irish Modern Irish) Modern If you are interested in acquiring a reading knowledge of Medieval Irish, in which the great saga literature of our will enjoy You manuscripts was written, this is the course for you. small class sizes and a friendly atmosphere, work with scholars publishing in the field and may avail of the option to study in your third year. in Wales Medieval and Modern Welsh Early Irish component Early Irish can be studied either in combination with one other subject as part of a two-subject moderatorship (TSM) programme or in the single honor Early and Modern Irish TSM programme, both programme. When studied as part of a subjects are studied for three years and one subject only is An honors degree is awarded in both studied in the fourth year. subjects. 54 Arts, Humanities and Social Sciences príomhchathrach sinn. sa Choláiste.Saniomlán,isgealllemionGhaelachtilárna ar fad;táscéimchónaithelánGhaelachabhfuilan-tóiruirthi ar achéile. Tá CumannGaelachnamacléinnan-ghníomhach go leorlenachmbíonnsédeacairagnamicléinnaithneachur Roinn seoasabheithcairdiúil.Bíonnlíonnamacléinnbeag an GhaeilgeteangaoibreRoinnnaGaeilge. Tá an-cháilaran chumas snaréimsísin,beidhancúrsaseooiriúnachduit.Isí is aléamh,agusmásmianleatbarrfeabhaischurardo Má bhaineanntútaitneamhasGaeilgealabhairt,scríobh bliain. Bronntarcéimonórasadáábhar. agus roghnaítearceannamháindendáábhardoncheathrú chóras seodéantarstaidéararandáábharfeadhtríbliana Ghaeilge saMhodhnóireachtaon-onóra(EMI TR022). Sadá sa MhodhnóireachtDháÁbhar(TR001)nóidteanntaleLuath- Is féidirNua-Ghaeilgeadhéanamhidteanntalehábhareile An Nua-Ghaeilge of paststudents. business, interpretingandtranslationallfigureintheprofiles related media.Libraryarchiving,thepublicservice,marketing, a careerinteachingorjournalism,especiallyIrish-language the subjectwithaviewtoteachingatthird-level.Mostfollow Some studentsofEarlyIrishpursueindependentresearchin must alsoresearchandwriteadissertation. year, aswellend-of-yearexaminations.Inthefinalyearyou Assessment isbyexercisesandessayssubmittedduringthe nGaeltacht nahAlban. Beidh seansagat,másmianleat, tréimhseachaitheamhi seans agmicléinntríblianaachaitheamh leGaeilgenahAlban. Ghaeilge igColáistena Tríonóide náguranseoamháin abhíonn mar chuiddenchúrsa.Sainghné speisialtadechúrsanaNua- aon mhacléinndhámhíachaitheamhsaGhaeltachtinÉirinn leis anbhfiannaíochtagusnualitríocht.Nímórdogach shóisialta nateanga,leisanmbéaloideas,lefilíochtscol, na Gaeilge.Chomhmaithleissin,pléannléachtaílestair chúrsa iseaanstaidéarfoirimiúiladhéantararcheartúsáid bhéim ingachaonbhliain.Marsin,cuidthábhachtachden ar anteangaféin,idirlabharthaagusscríofa,aleagtar sa 13úhaoisgodtíanCaighdeánOifigiúil21úhaois.Is an cúrsa:óGhaeilgeChlasaiceachnaNua-GhaeilgeMoiche Nua-Ghaeilge. Ar thréimhseiomlánnaNua-Ghaeilgeadhíríonn Is trímheánnaGaeilgeamhúinteargachgnédechúrsa An éseoancúrsaduitse? Career opportunities Assessment Ábhar anchúrsa

déanamh agustráchtaslescríobh. ag deireadhnabliana.Sacheathrúbliain,bíonntaighdele scríobh gotráthrialta,agusbéaltriailscrúduithescríofa seachtain marchuiddenmheasúnúleanúnach;bíonnaistíle Bíonn argachmacléinncleachtaíscríofaadhéanamh Ghaeilge nahAlban. sa litríochtbhéil,inualitríochtnaGaeilgeagus/nó sin, déanannmicléinnroghacúrsaísaNua-GhaeilgeMhoch, ar anbpailéagrafaíocht(léamhlámhscríbhinní).Inatheannta níos airde,agusGaeilgenahAlban.Déantarstaidéarfreisin scríofa, ancheapadóireachtagust-aistriúchánagleibhéal hábhair seoaleanas:ardscileannateanga,idirlabharthaagus Sa tríúbliainagussacheathrúbliain,díríonnancúrsaarna na hAlban. na Gaeilge,anGhaeilgeChlasaiceach,nualitríocht,Gaeilge scríofa, ancheapadóireacht,t-aistriúchán,stairshóisialta hábhair seoaleanas:scileannateanga,idirlabharthaagus Sa chéadbhliainagussadarabliain,díríonnancúrsaarna Tel: +35318961450 www.tcd.ie/Irish tseirbhís phoiblí,margaíochtagusgnófreisin. le gairmeachaéagsúlacosúilleisanleabharlannaíocht, agus lehaistriú. Tá iarmhicléinnleNua-Ghaeilgetaréisdul meáin Ghaeilgeachgoháirithe),cuiddíobhlehateangaireacht na macléinnlemúinteoireachtagushiriseoireacht(sna teagaisc agantríúleibhéalabhaintamach. Téann tromlach Déanann micléinnáirithetaighdesaNua-Ghaeilgechunpost bliain Measúnú An tríúbliainagusanceathrú dara an agus bhliain chéad An Further information Did youknow? Postanna n

Trinity ishometothetwelfth-centuryBook College medieval period. Irish literatureandlearningtohavesurvivedfromthe of Leinster, oneofthemostimportantmanuscripts

Arts, Humanities and Social Sciences 55

CE001 Ireland Church Of Education (CICE) College Of Mhuire, CM001/002 Coláiste Marino B.Ed.

COURSE CODES: COURSE AWARDED: DEGREE is a restricted entry course. CE001 (CICE): This submitted by 1 February of the Applications must be proposed year of entry. requirements of the Department Candidates must satisfy and the requirements of the of Education and Science, (see below for contact details). College of Education CM001/002 (Marino): Candidates must satisfy the Education and Science, Department of the requirements of (see and the requirements of the College of Education below for contact details). See also: TR009: Music education, page 78. Coláiste Mhuire, Marino Further information Education Church of Ireland College of Education (CICE) The degree of Bachelor in Education (B.Ed.) is a professional The degree of Bachelor in Education (B.Ed.) academic and degree which is intended to provide for the The teachers. professional requirements of primary school University of Dublin. degree is accredited and awarded by the College Trinity of Students of CICE are also registered students available directly from Dublin. Details of the course structure are . CICE: www.cice.ie B.Ed. (Bachelor in Education) B.Sc. (Education Studies) These degrees are accredited and awarded by the University on both courses is delivered in its entirety Teaching of Dublin. Church of Ireland College of Education 96 Upper Rathmines Road, Dublin 6. www.cice.ie + 353 1 497 0033 Tel: Coláiste Mhuire Marino Avenue, Dublin 9. Griffith www.mie.ie + 353 1 805 7700 Tel: by Coláiste Mhuire, Marino.

“Being part of Scoil na Gaeilge in Trinity provided me Trinity Gaeilge in “Being part of Scoil na Christina Cleary Christina with some of the most valued years of my life. When I with some of the most my path towards third level education first embarked upon quite daunting, yet within a few I found the whole task The staff completely enveloped. weeks of lectures I was the most learned academics in the itself boasts some of to support and help each individual field who are prepared their full potential. student to progress to and Modern Irish) introduces First year in EMI (Early opportunities available and the student to the vast such as the origin of the language encompasses topics These, and many others, are then and Old Irish literature. Second year, studied in more detail in the following years. Trinity sit the then, provided me with the opportunity to obtained Foundation Scholarship Examinations. Having financial the appropriate grade, the scholar is awarded post- support for the next five years which includes meal graduate studies, accommodation, your evening and much more. academically Third year was one of the most socially and to exciting years for me as I was given the opportunity While there, for a semester. Aberystwyth, Wales study in and Early and Modern the student of EMI is taught Welsh Then, during the Irish from a totally new perspective. I was given the choice of studying second semester, little A Scottish Gaelic in the Isle of Skye for a week. is that you Trinity known fact about the Irish Department in as well as are introduced to all these wonderful languages Irish itself. studies My choices of where to apply for post-graduate Early Irish were broad and varied having majored in For instance, I considered applying to in my final year. chose Cambridge, Paris, Bonn and Marburg. I finally Phillips-Universität in Marburg for my Master’s programme where I can learn the German language and broaden my academic horizons in a foreign country. Of the many boons included as a result of being part of Scoil na Gaeilge, the student is presented with multi- dimensional facilities, networks and access to the major Trinity, works housed in the Manuscript Department in I also Academy and the National Library. the Royal Irish became acquainted with the scholars and academics of Trinity’s Advanced Studies through the Dublin Institute of Scoil na Gaeilge and was thus able to avail of their facilities. I have made a deep connection with the subjects Department College and the Irish Trinity I have studied, that I will carry with me for the rest of my life.” Graduate Profile Graduate 56 Arts, Humanities and Social Sciences before 1400. they alsocoveralongerhistoricalrange,includingliteraturefrom developing genres(Poetry, theNovel, Theatre, theEssay)and students, Englishstudiesstudentsstudyliteratureintermsof critical andculturaltheory. ComparedtoEnglishliterature(TSM) a sophisticatedcriticalconsciousnessandanawarenessof history oftheseliteratureswhilealsoenablingyoutodevelop cultures. Itaimstodevelopathoroughknowledgeofthe English, Anglo-Irish, American andemergingpost-colonial of writinginEnglishandencompassesliteraryworksspanning The studyofEnglishisconcernedwiththehistoryandpractices genres, andaconcentrationon themodernperiod(post1400). honor programme,withlessemphasis onthedevelopmentof in English,thecourseislessextensive thanthatofthesingle While TSM studentscoveralltheprincipalareasofliteratures critical andculturaltheory. a sophisticatedcriticalconsciousnessandanawarenessof history ofdiffering literatures whilealsoenablingyoutodevelop of thecourseistohelpyouacquireathoroughknowledge the Englishlanguage,fromChaucertopresentday. The aim English literaturecoversabroadrangeofliteratureswrittenin English studies TR023 honors) –TR001 English studies (Single honor) – – honor) (Single studies English English literatureand English literature (TSM joint joint (TSM literature English For subjectsthatcombinewithEnglishliteratureseepage92. is awardedinbothsubjects. subject onlyisstudiedinthefourthyear. An honorsdegree subjects arenormallystudiedforthreeyearsandone programme. TSM isajointhonorprogramme.Both other subjectwithinthetwo-subjectmoderatorship(TSM) a singlehonorcourse.Itmustbecombinedwithone TR001 –Englishliterature(TSM)cannotbestudiedas English isreadalmostexclusivelyforfouryears. TR023 –Englishstudiesisasinglehonorcoursewhere Advanced GCE(A-Level) DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODES: Leaving Certificate Special EntryRequirements: TSM points:

Grade C HC3 B.A. 505* 40 TR023 See noteonpage28 English literature English language (A or B) (A orB)English 525*-570 85 TR001 (TSM) time studyingEnglishat Trinity Collegeisexcitingandintense. writing byundergraduates.Inthiswayweensurethatyour The Schoolactivelysupportsseveraljournalsofcreative School. satirist andfantasywriter, areboth Adjunct Professorsinthe prizewinning author, and Sir Terry Pratchett,thebestselling Chair ofPoetry)andvisitingwriters.RichardFord,thePulitzer Man Booker Prize, and Professor Michael Longley, The Ireland guest lecturers(suchas Anne Enright,winnerofthe2007 activities, suchaslectureseries,conferencesandsymposia, The SchoolofEnglishalsocoordinatesmanynon-syllabus the resourcesofaworld-famouslibrary. undertaken independently, andyouwillhaveatyourdisposal discussion, bothoralandwritten.Muchofyourworkwillbe independence of critical thought and the articulation of informed Our Englishcourseshavebeendesignedtodevelop is amaximumofaround20studentsineachseminar. options, mostaretaughtthroughseminardiscussion. There modules arechosenbyyoufromawiderangeofavailable In theSophister(thirdandfourth)years,mostofyourEnglish only, andthenumbersfortutorialsarearound8-10students supported bysmall-groupteachingdedicatedtothatmodule 40. All Freshman(firstandsecondyear)lecturemodulesare honors onlylectureswilltypicallyhaveamaximumofaround typically haveamaximumofaround120students,whilesingle lectures andrelatedtutorials.For TSM students,lectureswill teaching. Inthefirsttwoyearsisbyacombinationof The SchoolofEnglishisstronglycommittedto English literatureorstudies. contemporary studiesinthelanguageyouwouldenjoyeither and relatedliteratures,fromtheirearliestbeginningsthroughto If youwanttostudythewholerangeofdevelopmentsinEnglish the libraryandwriting essays. high proportion of yourtimewillbetakenuppreparing workin independent studyandresearch areencouraged,andquitea independent researchprojects of upto12,000words.Individual words, youwillbyyourfinalyear bepreparedtotacklemajor means thatfromshortfirst-year essaysofaround1,500 and discussionskillswilldevelop. The modelofassessment benefit from close personal staff supervision, so that your writing Our commitmenttosmall-groupteachingmeansthatyouwill own courseintheadvancedworkthatwillleadtotheirdegree. year. After thefirsttwoyears,studentsarefreetoconstructtheir and Theories ofliterature is oneofthemajormodulesinfirst variety of modules, based on period, genre, theme and nationality, through acombinationoflecturesandtutorials.Studentstake a consist ofalmostentirelycompulsorymodules,taughtmainly The Englishcoursesaredesignedsothatthefirsttwoyears English atTrinity College Is thistherightcourseforyou? Course content small-group

. Arts, Humanities and Social Sciences 57

Further information Study abroad Study Career opportunities www.tcd.ie/English +353 1 896 1111 Tel: Head of School: Darryl Jones +353 1 896 1878 Tel: E-mail: [email protected] The School of English has strong international links with many international links of English has strong The School in active participation abroad, including English departments Austria, in with universities exchange programme the Erasmus also have an Spain, Switzerland and the UK. We France, Italy, College in the US, and there are agreement with Dartmouth which allow students to spend a year scholarship opportunities College, Boston notably Berkeley, at prominent US universities, and Georgetown. to study abroad, our exchange In addition to the opportunity international students, ensure that the links, which attract many is vibrant and cosmopolitan. student body in English in demand from The skills of English graduates are much marketing, employers, especially in journalism, broadcasting, and teaching, and retail and business management, publishing qualifications in graduates from English often gain professional public relations and accountancy, disciplines as diverse as law, clinical speech. platform for The four-year degree provides an outstanding about 30% of our postgraduate study in English, and usually in English (Master’sgraduates go on to read for a higher degree creative writers are degree, Ph.D. degree). Many well-known College English graduates, including Eavan Boland, Trinity Derek Mahon, Brendan Deirdre Madden, Michael Longley, Kennelly and Eiléan Ní Chuilleanáin.

Children’s literature Children’s Popular literature Contemporary Irish literature Creative writing Dissertation Post-war British fiction 20th century women novelists Shakespeare and sexuality Modernism American letters Literature of the American South Literature of the Ulysses in contexts African and Caribbean literature Irish writer and society Myths and fairies Shakespeare: Text, stage, screen Text, Shakespeare: Introduction to postcolonial literature Victorianism Introduction to Modernism Irish writing Enlightenment Romanticism novel The Genre: Medieval and romance Renaissance Theories of literature Assessment

Assessment is by a combination of submitted essays and end-of-year examinations. In the Freshman (first and second) years the weighting is 50% submitted work, 50% exams; in the Sophister (third and fourth) years it is closer to 25% submitted work, 75% exams. n n n n n n n n n n n n n n n Examples of Sophister modules may include: In the Junior and Senior Sophister (third and fourth) years, you In the Junior and Senior Sophister (third and range of specialist will choose most of your modules from a wide modules are taught at an advanced level options. By fourth year, by seminar only. n The Sophister years n n n n n n n n n The Freshman years The Freshman a (first two) years and Senior Freshman Over the Junior Examples of Freshman modules include: Examples of Freshman range of modules provides you with an introduction to a variety an introduction to provides you with range of modules approaches to literature. practices and of critical theories, texts. on selected prescribed primarily concentrate will You 58 Arts, Humanities and Social Sciences continent-wide basis. and examinescontemporaryEuropeinallitscomplexityona studies theEuropeanpastinordertounderstandpresent, history, culture,languages andpoliticsofEuropeannations.It integrated multidisciplinaryprogrammewhichencompassesthe At Trinity CollegeEuropeanstudiesisabroad-ranging,fully European studies What isEuropeanstudies? TR001: TSM, page92 See also: language asabeginner. Seenote8onpage32. beginner level.Nostudentmaystudymorethanone Italian, Polish,RussianandSpanishareavailablefrom Italian, Polish,RussianandSpanish. Students studytwolanguagesfromFrench,German, Advanced GCE(A-Level) Leaving Certificate must attainatleastthefollowinggrades: If candidatesarepresentingtwoormorelanguages,they English orIrish),theymustattainagradeofHB3higher If candidatesarepresentingonelanguage(otherthan Certificate (orequivalent). language (otherthanEnglishandIrish)intheLeaving Applicants mustpresentwithatleastoneEuropean Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

Grade B HC Grade C Or HC3 HC2 HC1 B.A. 520 45 TR024 in onelanguage In twoofFrench, above) or Irish(aslisted other thanEnglish or Irish other thanEnglish other language a non-beginner taking Spanishas Spanish and French orGerman Spanish Polish, Russian, Italian, Latin, German, Greek, In twolanguages If presentingany If presenting If presenting range ofdisciplinaryapproaches. with abroadintellectualappetiteandwhoareinterestedin this course.Europeanstudiesisexplicitlydesignedforstudents politics andtheworkingsofcontemporarysocietyyouwillenjoy If youenjoystudyinglanguagesandhaveaninterestinhistory, to yourspecificstrengthsandinterests. the disciplinesthatinterestyou most,andsotailorthedegree compulsory andyouwillbeable tochooseothermodulesfrom year onwardsthehistoryofideas, orculturalhistory, is In firstyearallcomponentsare compulsory. Fromthesecond component inthefirst,secondandfourthyears. from theRenaissancetopresentandiscompulsorycore of ideasteachestheevolutionEuropeanthoughtandculture social sciences(politics,economicsandsociology). The history present throughthreedisciplines–history, historyofideasand As wellaslanguagesyouwillstudytheEuropeanpastand studied inthefinalyear. specialising inthesocialandpoliticalsciences.Literatureis and languagestudyisdesignedtomeettheneedsofstudents and cultureofthecountriesinwhichlanguageisspoken Language learningisembeddedinthestudyofsociety one becomesyourmajor, andtheotheryourminorlanguage. languages arestudiedequallyinthefirsttwoyears,afterwhich Spanish andRussiancanbestudiedfrombeginnerlevel).Both German, Italian,Polish,RussianorSpanish(Italian, You willstudytwooutofsixEuropeanlanguages: French, Is thistherightcourseforyou? Course content Course overview

Arts, Humanities and Social Sciences 59

Social, economic and political history are given equal emphasis in this this given equal emphasis in Social, economic and political history are as well as Russia, and France Germany, on concentrates which course, looking at Italy and Spain. This module is an introduction to the study of comparative politics. We will We politics. comparative of study the to introduction an is module This be studying both developing and developed countries, democratic and authoritarian regimes as well as countries that are in the midst of political Among other things, we will learn about (i) why and economic transitions. countries like Israel have a multitude of parties, while the United States has only two, (ii) what determines why some countries are capable of making the transition to democracy (e.g. Chile), while in other countries authoritarian regimes prevail and autocrats manage to hold onto power for a long time (e.g. Zimbabwe), and (iii) why some countries have seen tremendous economic growth (e.g. Ireland), while others have struggled will begin African countries). We to spur economic development (e.g. most decision-making. political of foundations micro the course by discussing the will study the role of preferences and beliefs, which are we Specifically, essential for understanding political cleavages, conflict and culture. Next, we will move to the study of collective decision-making and group politics, interest groups and parties political from ranging topics of variety a covering rights movement in the 1960s American civil to social movements (e.g. the will then shift to the study and the East European revolution in 1989). We in individual as well of political institutions as a key source for differences will be of political institutions effects The as collective decision-making. voting (e.g. decision-making political at looking by level micro the at studied behaviour in plurality systems like the United States versus proportional systems like Italy) and at the macro level by looking at political and economic development. History of Continental Europe since 1870 History of Continental Europe Comparative politics

n n Culture and politics in Europe 1700-1815 Culture and politics since culture and society modern of development and emergence the Studies itself with political culture The core of the course concerns the Enlightenment. to, the ideologies created from, and in opposition by analysing the political who be introduced to the central texts and figures will You French Revolution. changes that of modernity and to the social and cultural defined the meaning of a modern society. carried forward the project 1750-1820 The making of Modernity themselves constituted they as modernity of concepts key to students Introduces the main philosophical and during the saddle epoch around 1800. It covers elucidates and Romanticism and Enlightenment European the identifies in It trends cultural society. and politics with interact discourses aesthetic and cultural how of Enlightenment and the interaction of Enlightenment Dialectics the of elements trends with counter movements and cross-currents. and ‘Culture module History Term Michaelmas the on builds and follows It Politics in Europe 1700-1815’. Select one of: Senior Freshman (second) year Senior Freshman of classes per week. approximately 22 hours There are Languages 1 & 2: expression of the languages, written and spoken Grammar and structures and comprehension

the First World War the First World Socialist ideologies The upsurge of right-wing thought after The role of new media Culture and politics in the inter war years The idea of Europe after 1945 The Fin-de-Siècle mood around 1900 The urban culture of the European metropolis The pre-war crisis of values (Nietzsche) Social Darwinism

Europe, c. 1500-1700: Power and belief history Examines the political, social and cultural of sixteenth and seventeenth-century Europe. By the end of this module, students will have been introduced to a variety of primary methods and sources and some of the different approaches that can be used in their analysis. This module addresses key themes of the period including intellectual changes during the Renaissance and Reformation, the emergence of rival churches across most of the Continent, the impact of the printing revolution, the increasing power of territorial states, the expansion of states into new colonial spaces, and military and political rivalry between states. n n n n n n n n n Junior Freshman (first) year Junior Freshman of classes approximately 22 hours There are per week. Languages 1 & 2: of the languages, written Grammar and structures and comprehension and spoken expression Introduction to the history of ideas Introduction to the of European thought Introduction to the evolution and to the century, and culture in the 20th texts in their historical techniques of analysing context. the intellectual and This module examines before and after the cultural climate in Europe you will examine In particular Wars. two World or how intellectual and cultural trends reacted contributed to the threat of war and how they dealt with catastrophes in their aftermath. covered include: Topics The Freshman years The Freshman 60 Arts, Humanities and Social Sciences where theErasmusschemedoesnotapply). offsets thisadditionalexpense (withtheexceptionofRussia, funding undertheEuropeanUnion’s Erasmusscheme partially abroad mayentailadditionalexpensesforstudentsbutsupport (Moscow) andSpain(Seville,Salamanca, Alcalá). The year Italy (Pavia,Siena,Florence),Poland(Krakow),Russia Grenoble, Bordeaux),Germany(Hamburg, Tübingen, Freiburg), departments inuniversitiesFrance(Paris,Strasbourg, have beenestablishedwithhistoryandpoliticalscience language andthisisanintegralpartofthecourse.Exchanges studying throughthelanguageyouchooseasyourmajor The JuniorSophisteryearisspentatauniversityabroad Junior Sophister(third)year supervision ofa memberofstaff. one oftheoptions) onasubjectoftheirownchoice underthe encouraged towriteatenthousand worddissertation(replacing from thelanguagedepartments. Studentswhosowishare sociology, andanumberofcultureliteratureoptions from awiderangeofmodules history, politicalscience, since 1890. Additionally, youwillchooseoneortwooptions ideas course:ModernismandMass Society–ideasandculture textual analysis. The core courseinyourfinalyearisahistoryof minor languageconcentratesmainlyoncomprehensionand predominantly onyourmajorlanguage.Courseworkfor In theSeniorSophisteryear, languageworkfocuses Senior Sophister(fourth)year economics oftheEU. by payingattentiontoissuessurroundingthe The thirdsectionbuildsonthefirsttwosections to studentsofEuropeanpolitics. main issuesinpoliticalscienceofsignificance The secondsectionprovidesanintroductionto structure. debates insociologyaboutEuropeansocial The firstsectionofthecourseintroduceskey social science:politics,economicsandsociology. the significantissuesinthreemainfieldsof This moduleoffers studentsanintroductionto Introduction tosocialscience per week. There areapproximately22hoursofclasses Junior Freshman(first)year

There areapproximately22hoursofclassesperweek. Senior Freshman(second)year n n n subject choice. Freshman (first)year, beforedeclaringtheirSeniorFreshman(secondyear) of theDepartmentEconomicsduring Trinity (third) Term oftheirJunior * StudentswhowishtotakethiscoursemustseekpermissionfromtheHead

Intermediate economics* European societies International relations France, Germany, Italy, Swedenand theUK. the divisionsofamarketsociety. The courseusescasestudiesfrom social model of social cohesion – a particularly European way of countering It considerstheextenttowhichEuropeanUnioninvolvesa Europe, thedivisionsofclass,region,gender, ethnicityandlifecycle. This moduleexaminesdifferent formsofsocialinequalityinWestern and humanrightsregimes. Organisation, theEuropeanUnion,andinternationalenvironmental contemporary politics,includingtheUnitedNations,World Trade to internationalrelationsandaselectionoftopicsinhistorical considers these questions by looking at differing theoretical approaches of internationalorganisationsonrelationsbetweenstates? This module for thegrowthofcross-bordertradeandfinance?Whatisimpact international relations. Why do states make war? What are the conditions This moduleisanintroductiontothepositive,descriptivestudyof imperfectly competitivesettings)andgeneralequilibrium. and oligopoly);gametheory;factormarkets(inperfectlycompetitive market structure(perfectcompetition;monopoly;monopolisticcompetition budget constraints);producertheory(isoquantcurvesandisocostlines); level. The modulecoversconsumertheory(indifference curvesand studies thetheoryandapplicationsofmicroeconomicsatanintermediate and different levelsofprosperity. The microeconomicmoduleofthecourse to understandwhydifferent countrieshavedifferent long-rungrowth rates policy responses that help mitigate such fluctuations. Thethirdstepaims two stepsstudythesourcesoffluctuationsineconomic activity and the The macroeconomicmoduleofthecourseshasthreesteps. The first E-mail: [email protected] Tel: +35318961808 www.tcd.ie/European_Studies relatingtoEurope. focus orspecifically more applied,specialised Many studentsgoontodopostgraduatecourses,oftenwitha and tourism. and abroad),translatinginterpreting,journalism popular careerpathsareinlaw, consultancy, teaching(inIreland the diplomaticcorps,inbusiness,financeandmarketing.Other both inIrelandandabroad,theEU,civilservice Recent graduatesareemployedininternationalorganisations assessment, essaysandend-of-yearexaminations. Written, oralandauralexamsarecombinedwithcontinuous Further information Career opportunities Assessment

Arts, Humanities and Social Sciences 61

and Ireland, c.400-1000 Crusades History of political thought The economy of Ireland Anglo-Saxons, Vikings and their impact on Britain Anglo-Saxons, Vikings Europe, c.1215-1517: Religion, death and culture War Years The Hundred Ireland and the wider world, 1534-1641 Ireland and the wider world, 1641-1815 Culture and politics in Europe, 1700-1815 Ireland and the union, 1801-1922 Europe, 1870-1930: Grandeur and decline Europe since 1914: Cataclysm and rebirth Ireland Twentieth-century The rise and fall of the British Empire American history Themes in modern Doing history in the age of the and society Europe, 1000-1250: War Ireland, 1000-1250: Boru Brian to the English invasion Britain, c.1066-1296: Conquest and domination Europe, 1000-1250: of Conflict church and state Ireland, 1250-1500: revival Gaelic and the English Pale Britain, c.1296-1603: Nations and kingship Europe, c.1500-1700: Power and belief The making of a great power Britain, 1603-1815: survey A American history: An introduction Asian history: South Modern language electives – Students this choosing option must enroll on the Broad Curriculum website: option must enroll on the Broad Curriculum www.tcd.ie/Broad_Curriculum

n n For further information about these courses see our website and www.tcd.ie/Broad_Curriculum www.tcd.ie/history The Senior Freshman (second) year: The Senior Freshman (second) from a wide variety of modules, listed below. may choose You Single honor year. Each module runs for half of the academic Subject Two while students select six modules (or equivalent), modules (or Moderatorship (TSM) students select three equivalent). n n n n n n n n n n n n Students may substitute one of the following year-long modules for one of their history modules: The Junior Freshman (first) year Freshman The Junior from the take half-year options (TR003) students Single honor whole study requirement amounting to the below, areas outlined year: for their academic half-year TSM (joint honor) programme take Students in the amounting to half their outlined below, options from the areas the academic year: study requirement for n n n n n n n n n n n n

TR001 (TSM) 40 535*-555 See note on page 28 TR003 38 480 B.A. See also: TSM, page 92 TR001: TR009: Music education, page 78 63 TR012: History and political science, page TR027: Irish studies, page 65 Ancient and medieval history and culture, page 36 TR028: TR003 (single honor History) – This is a course where This is a course where History) – TR003 (single honor and written almost exclusively History is studied, analysed for four years. and in increasing depth – In this course History is TR001 – History (TSM) subject within the two-subject combined with one other TSM is a joint honor programme. moderatorship (TSM) An honors degree is awarded in both programme. subjects. page 92. For subjects that combine with History see However, All History students follow the same courses. science students TSM and History and political while the workload is less cover all the principal areas of history, TR003. – intense than that of the single honor programme TSM points: COURSE CODES: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE Course content Is this the right course for you? Is this the right course for History and economic lines. In the second part of the programme (the Sophister years) a very wide degree of choice is made available to students from a broad range of specialist courses by those actively engaged in research on these topics. offered An independently conceived, researched and presented dissertation is a key element of the final year. to particular aspects of history along socio-political, cultural The History programme at Trinity College has been constructed College has Trinity The History programme at on clear pedagogical and intellectual principles. In the first two years the modules are designed with a systematic to provide you American with options in knowledge of European and Irish history, and other non-European modules, as well as to introduce you If you are interested in discovering our past, in developing a If you are interested in discovering our past, interpretations of critical perspective on previous and current new perspectives history and working toward the development of College Trinity on our past, this course is right for you. History at aims to encourage the greatest possible critical independence among those learning the techniques and the methods of historical research and writing. 62 Arts, Humanities and Social Sciences n n n n n n n n n n n n include: teaching staff andvaryfromyeartoyear. Currentoptions List I,IIandIIImodulesarisefromthespecialisationsof honor studentsintheSeniorSophisteryear. year. TSM studentsnormallyfollowthesamepatternassingle II, module,intheirJuniorSophister(third) plus thehistoriography Those studying TSM HistorychooseonemodulefromListsIand is undertakenintheSeniorSophisteryear. III in the Senior Sophister (fourth) year. The research dissertation historiography module.FurtherchoicesfollowfromListIand from eachlistintheirJuniorSophister(third)year, plusa Those studyingsinglehonorHistorychooseonemodule secondary commentaries. modules baseduponacombinationofprimarymaterialsand List IIImodules debates ofmodern-dayhistorians. special subjectswhichrelatetotheconcepts,methodsand List IImodules modules whichinvolveintensiveresearchandwriting. List Imodules We offer arangeofsubjectswithinthreedifferent categories: The Sophister(thirdandfourth)years n n n n n n n n n n n n

Race andethnicityin thoughtsince 1880 American culture 1880: Societyand France since Sub-Saharan Africa since1875 Slavery in American history 1820-1920 inBritainandIreland, History writing Empire: Historiansandthe Anglo-American community Dublin Eighteenth-century The FrenchRevolution 1775-1847 age ofO’Connell, Ireland inthe Britain,1678-1715 Revolutionary earlymodernIreland The nobilityin torestoration:ConfederateandCromwellian From rebellion ofFrance,1550-1700 The fallandrise 1550-1610 andtheirworld, The Elizabethans 1540-1610 Europe reformed, Florence, c.1347-1527 Renaissance c.1215-1517 Medieval religion, Edward I,IIandtheconquestofBritain,1286-1328 Medieval Dublin medievalIreland The Englishin century intheeleventh Empire andpapacy 1000-1300 ofmedievalwarfare, The archaeology Viking tocrusaderwarriors,800-1200 raiders The reignofCharlemagne Ireland in theeighteenthcentury – theseareprimarysource-basedspecialist – theseareprimarilyhistoriographically-based – thesearebroaderthematicandanalytical

and Australian universities. Kingdom aswellexchangeprogrammeswith American with universitiesinFrance,Germany, ItalyandtheUnited The Department of History has Erasmus exchange agreements per centofthefinal-yearmark. of thefinal-yeardissertationaccountsforapproximatelythirty Assessment isprimarilyessay-andexam-based. Assessment n n n n n n n n n n n Tel: +35318961791/1020 www.tcd.ie/history publishing, mediawork,humanresources,etc. management, cultural,artsandheritageadministration, public administration,relations,marketing,advertising, a widerangeofareas,forexample:journalism,teaching, and TSM) havebegunandpursuedsuccessfulcareersover Over manydecades,graduatesinHistory(singlehonors

Study abroad Assessment Further information Did youknow? Career opportunities n and beyond,1948-1998 The Troubles, 1968-1998 and Ireland, Britain theColdWarAmerica during South Asia since1947 andculture,1939-1989 American politics Ireland intwentieth-century Popular culture 1920s and1930s Ireland inthe Ireland politicsinmodern Literature and Writing oftheIrishrevolution thehistory The Weimar Republic FirstWorldFrance andthe War, 1912-1920 The impactofWorld War 1onIrelandandBritain

Trinity military, teachespolitical, College social, from theMiddle Ages tothecontemporaryperiod. too. Areas ofstudyrangeinchronologicalbreadth and itoffers modulesin African andIndiantopics Ireland, Britain,France,Germanyand America; specialises inthehistoriesofseveralcountries– economic, culturalandintellectualhistory;it

Arts, Humanities and Social Sciences 63

TR012 24 515 B.A. COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE of the following can also study history through one You to the degree of B.A: programmes, all leading (joint honor programme) History in TSM TR001: other subject. For subjects that combination with one see page 92. combine with History page 61. course in history, TR003: Single honor through several other can also study political science You 82. programmes, see page See also: Ancient and medieval history and culture, page 36 TR028: Assessment Study abroad History and political science and political History Course overview A combination of essays, assignments and end-of-year A examinations make up the assessment process. Both the Political science and History departments have arrangements allowing students to study abroad in another Participating university for a semester or a full academic year. in these opportunities is dependent upon the exchange fulfilling the course requirements of both departments. History and political science have a close affinity and the History and political science have a close provides combination of the two in a joint honor programme of interdisciplinary a coherent framework for the development you will interests. In the first three years of the programme, you fourth year, take both subjects on an equal basis. In the either subject or to may choose to concentrate exclusively on 10-12 hours of There are approximately continue with both. below See years. two) (first Freshman the in week per classes for course details. 64 Arts, Humanities and Social Sciences n n n n n n n n n n n n n n n n including: More than35modulesareavailableintheSophisteryears(threeandfour) fourth yearchoosethreespecialmodules,andwriteadissertation. particular attentiontooriginalsources.StudentstakingHistoryalonein and choosespecialmodules,whicharestudiedingreatdetailwith In thefinaltwoyearsyouwilltakeashortlecturemoduleonhistoriography n n n n n n n n n n n Senior Freshmen(second-yearstudents)selectfromcoursessuchas: n n n n n n n n n n History courses Junior Freshmen(first-yearstudents)selectfrommodulessuchas: while intheirsecondyearstudentsmaysubstituteelectivesforoneofthehistorymodules(seeBroadCurriculum,p.13). In theirfirst-yearstudentsmaysubstitutemodernlanguageelectives(twocourses)foroneofthesecourses, In eachofthefirsttwoyearsstudentstake3politicalsciencemodulesandequivalentnumberterm-longinHistory of different ways. overall characterofyourstudies,andpermityoutospecialiseinanumber Modules aredesignedtoallowyourindividualpreferencesshapethe

c.400-1000 The Troubles, 1968-1998 Britain, theNearEastandWorld War 2 Society Stalinism and Sub-Saharan Africa since1875 The FrenchRevolution Britain,1678-1715 Revolutionary The impactofWorld War 1onIrelandandBritain FirstWorldFrance andthe War, 1912-1920 1775-1847 age ofO’Connell, Ireland inthe Britain,1678-1715 Revolutionary Ireland Cromwellian Confederate and 1550-1610 andtheirworld, The Elizabethans 1540-1610 Europe reformed, Edward I,IIandtheconquestofBritain,1286-1328 The Crusades ofmedievalwarfare The archaeology VikingsAnglo-Saxons, impactonBritainandIreland, andtheir Themes inmodern American history The riseandfalloftheBritishEmpire Twentieth-century Ireland andrebirth 1914: Cataclysm Europe since 1700-1815 inEurope, Culture andpolitics deathandculture Religion, Europe, c.1215-1517: widerworld,1641-1815 Ireland andthe widerworld,1534-1641 Ireland andthe union,1801-1922 Ireland andthe and decline Grandeur Europe, 1870-1930: South Asian history: An introduction American history: A survey Britain 1603-1815: ofagreatpower The making belief Powerand Europe, c.1500-1700: kingship Nationsand Britain, c.1296-1603: andtheEnglishPale Gaelicrevival Ireland, 1250-1500: churchandstate Conflictof Europe, 1000-1250: anddomination Conquest Britain, c.1066-1296: totheEnglishinvasion BrianBoru Ireland, 1000-1250: WarEurope, 1000-1250: andsocietyintheageofCrusades

Senior Freshmen(second-yearstudents)take: n n n n n n Junior Freshmen(first-yearstudents)take: you withasystematicfoundationinthesubject. The workofthefirsttwoyearsisdesignedtoprovide Political sciencecourses n n n n n n n n n n subject, including: choose toconcentrateonparticularaspectsofthe In theSophister(thirdandfourth)years,youmay

Comparative politics Comparative International relations History ofpoliticalthought economicpolicy Introduction to sociology Introduction to politicalscience Introduction to Government and politics of the UnitedStates politicsofthe Government and African politics internationalrelations Contemporary politics European Union Democracy anddevelopment Issues incontemporarypolitics Political parties politicaltheories Contemporary political institutions Comparative Irish politics

. Arts, Humanities and Social Sciences 65

TR027 20 330 B.A. COURSE CODE: PLACES 2011: POINTS 2010: AWARDED: DEGREE Special Entry Requirements: below. the Course overview, See notes 1 and 2 in See also: page 61 TR003/001: History, 53 TR022/001: Early and modern Irish, page studies, page 56 TR023/001: English literature and English Irish studies: An An studies: Irish Course overview interdisciplinary course course interdisciplinary civilisation in Irish This is an exciting interdisciplinary programme, devised by This is an exciting interdisciplinary programme, in collaboration the Irish, English and History departments Art and Film/ History of with the departments of Geography, a unique opportunity to This programme offers Drama. and to study outside the traditional academic disciplines freedom associated experience the integration, creativity and taking courses in with an interdisciplinary education while still The Irish and English. established subjects such as History, between Ireland and emphasis throughout is on the interaction in British, European the wider world, including specific courses American history and literature. Irish studies provides and guaranteeing a you with a very diverse range of options, thus which will stand rich and rewarding educational experience, market that is you in good stead in a competitive employment demanding increasing flexibility. There are two distinct strands in the Irish studies programme: This strand contains a number of Irish language – A Strand this strand Applicants who wish to choose modules. Note 1: must attain at least a grade HC3 in Leaving Certificate Irish or a grade C in A-level Irish. or a grade C in OR through All of the courses in this strand are taught Strand B – There are no special entry the medium of English. Note 2: requirements for Strand B. Students choose a strand after admission to the Irish Studies programme. Irish Studies is an accredited degree programme Council for the following subjects: Teaching with the A: Irish and History Strand Strand B: English and History Further information Career opportunities www.tcd.ie/history +353 1 896 1020 Tel: www.tcd.ie/Political_Science/undergraduate +353 1 896 1651 Tel: Recent graduates are pursuing careers in government and the media, accountancy and business to name a few. public sector, Some graduates each year progress to further study in areas as diverse as medicine, film production, graphic design and business, as well as areas more closely related to history and political science. 66 Arts, Humanities and Social Sciences English: 7. 6. 5. History: 4. 3. 2. Irish: 1. Interdisciplinary: Junior Freshman(Year 1) This strandcontainsanumberofIrishlanguagemodules. Strand A a dissertationinyourfinalyear. Coursesinclude: both continuousassessmentandexamination. You willalsowrite irishstudies. Assessment throughoutthefouryearsconsistsof details areavailableonourwebsiteat areas whereyouhavedevelopedparticularinterests.Course optional coursesinthefinalyear, allowingyoutospecialisein There willbeamixtureofcompulsorycoursesinyears1-3and study abroadontheErasmusprogrammeintheirthirdyear. competed forthe TCD Foundationscholarshipandchosento For example,studentsonthisprogrammehavesuccessfully the full range of academic opportunities provided by Trinity College.is theprogrammeforyou.Studentsareencouragedtoavailof Ireland inabroad,interdisciplinary, comparativecontextthenthis If youhaveaninterestinthehistory, literature,andcultureof 8. 7. 6. History: 5. 4. 3. Irish: 2. 1. Interdisciplinary: Senior Freshman(Year 2) 8. English: Course content Is thistherightcourseforyou? Ireland and the widerworld,1534-1815 Ireland andthe andtheEnglishPale Gaelicrevival Ireland, c.1250-1500: Doing history Nualitríocht Cleachtadh teanglainne I Ceart nateanga An Ghaeilge: I Imagining Ireland Irish writing in English1590-1800 Irish writingin historyof20th-century Socio-cultural Change &expectation: Union,1801-1922 Ireland andthe Nualitríocht Nuafhilíocht II Ceart nateanga An Ghaeilge: A p.13) course(see BroadCurriculum II Imagining Ireland Theorising Ireland Ireland www.tcd.ie/courses/ 4. 3. Irish: 2. 1. Interdisciplinary: Senior Sophister(Year 4) 7. English: 6. 5. History: 4. 3. 2. Irish: 1. Interdisciplinary: Junior Sophister(Year 3) 5. 4. 3. 2. English: 1. 8. Irish Dept: 7. 6. 5. History: 4. 3. 2. English: 1. Interdisciplinary: Junior Freshman(Year 1) of English. All coursesinthisstrandaretaughtthroughthemedium Strand B OR Interdisciplinary: Senior Freshman(Year 2) Students choose Sophistermodulesfromanapprovedlist Students choose Ceapadóireacht Dissertation IV Imagining Ireland Irishwriting Nineteenth-century 20th centuryEurope History oftheUSA Prós naLinne An FhilíochtChomhaimseartha Ceapadóireacht An Ghaeilge: III Imagining Ireland Victorian literature postcolonialliterature Introduction to Theories ofliterature English1590-1800 Irish writingin II Imagining Ireland andliteratureI(taughtthroughthemedium Irish language widerworld,1534-1815 Ireland andthe andtheEnglishPale Gaelicrevival Ireland, c.1250-1500: Doing history Genre: The novel Romanticism Theorising Ireland I Imagining Ireland British, Europeanand American history. of IrishandHistorycoursesincludingspecificmodulesin of English)

Arts, Humanities and Social Sciences 67

in the centre of Dublin and study Irish history, literature, literature, and study Irish history, in the centre of Dublin location The experience. unique a is culture and language sites of historical and literary allows easy access to you to experience first-hand what significance, enabling The interdisciplinary lecture hall. you are studying in the is one of the most amazing aspects nature of the course can explore several avenues of of Irish Studies, as you disciplines – politics across different study simultaneously culture. history and linguistics, geography and and poetry, to one subject, you can focus Instead of limiting yourself while you pursue your studies, on a wide range of topics subjects thereby heightening your appreciation of multiple studied in tandem. It is an excellent and rewarding aspects of this academic challenge. One of my favourite is that many of Trinity, course, which I believe is unique to Trinity at staff the leading scholars of Irish studies are on to and are often course lecturers. It is truly remarkable option, as an read a book in the library and to have the author of that undergraduate, to run upstairs and ask the Trinity is available at The expertise that book a question. exceptional.” in support of this course makes Irish studies Jordan Followwill the premier university in Ireland “Being able to attend Student Profile Student

of English and History courses, including specific modules of English and History courses, including literature. American history and in British, European and of English) Ireland Imagining Ireland IV Dissertation Students choose Sophister modules from an approved list History of the USA 20th century Europe Nineteenth-century Irish writing Irish writing, 1890-1945 American literature Imagining Ireland III Broad Curriculum (see module p. 13) A History of Irish cartography Change & expectation:Change & Socio-cultural history of 20th-century Irish language II (taught through the medium and literature Ireland and theIreland and union, 1801-1922 Further information Career opportunities Junior Sophister (Year 3) Junior Sophister (Year Interdisciplinary: Irish Dept: E-mail: [email protected] +353 1 896 2626 Tel: www.histories-humanities.tcd.ie/irishstudies/index.php the diplomatic corps, publishing, media work, translation services, public relations etc. In terms of further education, graduates from this course have already been accepted onto postgraduate programmes in Oxford, Durham and elsewhere. Graduates in Irish studies can expect to arrive at a diverse range of career destinations, where the interdisciplinary nature of the programme will provide a distinct advantage; in particular, teaching (Irish Studies is an accredited degree programme with the teaching Council for the following subjects – Strand A: Irish and History/Strand B: English and History), as well as journalism, arts and heritage administration, the civil service, 1. 2. 3. Senior Sophister (Year 4) Senior Sophister (Year Interdisciplinary: History: 7. 8. 5. 6. English: 4. 1. 2. 3. 8. 7. History: 6. 68 Arts, Humanities and Social Sciences Student welfareisattheheartofSchool’s activities. staff andstudents,inspiredbymutualrespectco-operation. in size. This fostersafriendlyandvibrantrelationshipbetween calibre. Bynationalandinternationalcomparisonswearesmall Trinity College’s SchoolofLawattractsstudentsthehighest now enjoysinternationaldisseminationonHeinOnline. members oftheCollege’s LawSociety. Thelatterpublication the ‘Trinity CollegeLawReview’ publishedbythestudent periodicals, the‘DublinUniversityLawJournal’,andto The SchoolofLawishometooneIreland’s leadinglegal body. are encouragedandpromotedamongstourstaff andstudent independent thinkingandidealsofsocialinclusionequality are widelyrecognisedforprovidingaliberalenvironmentwhere leaders ofthelegalprofession,publicserviceandsociety. We field ofstudy, arecommittedtoeducatingpeoplewhowillbe school. is Ireland’s oldestandmostinternationallyrenownedlaw Trinity CollegeDublin’s SchoolofLaw, foundedin1740 In additionaltoourfavourable learned throughstudyinglawareusefulinallwalksoflife. foreign affairs anddiplomacy andpublicservices. The skills fields suchasbusiness,journalism,financialservices,politics, for lifeas‘lawyers’,butalsoenablethemtoentermanycareer Trinity CollegeDublin’s LL.B.degreespreparestudentsnotonly refugee andimmigrationlaw, mediaandsportslaw. first universityinIrelandtooffer manymodulese.g.child law, challenging rangeofmodulesandcourseshavebeenthe We arecommittedtooffering arelevantandintellectually from manyotheruniversities. to specialiseandgainacompetitiveadvantageovergraduates years ofthedegrees,thusaffording studentstheopportunity an unrivallednumberofoptionalmodules Why study Law at Trinity College? Introduction totheSchoolofLaw Law TR020: Lawandpoliticalscience,page74 TR018/019: LawandFrench/German,page71 TR017: Lawandbusiness,page72 See also: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: Our staff, manyofwhomareleadingexpertsintheir smaller classsizes LL.B. 510* 90 TR004 in thefinaltwo , weoffer may alsobesupplementedbyseminarsandworkshops. differently inthefinaltwo years,seebelow)andmodules between sixandeightmodules(modulesareweighted semester. IntheSophisteryearsstudentstakegenerally by threehoursoflecturesperweekandfourseminars or mootingseminarsandworkshops.Eachmoduleistaught take threemodulespersemesterandaseriesoflegalskills into twoterms(semesters).IntheFreshmanyears,students of between12-15students). The academicyearisdivided supplemented withseminars(smallgroupteachinginclasses Most oftheteachingtakesplaceatlecturelevelandis of lawchosenfromarangeapproximately30subjects. (third andfourth)yearsyoucanfocusonparticularareas body withexperienceofprivatepractice.InyourSophister programmes, andassistedinpartbymembersofouracademic through theintroductionoflegalskillsandmooting(mocktrials) between theacademicandpracticalaspectsoflaw, achieved bodies). There isanappropriatebalanceinthefirsttwoyears subjects (manyofwhicharerequiredbythelegalprofessional two (Freshman)yearsaregivenovertothestudyofcorelegal Law at Trinity Collegeisafour-yeardegreeprogramme. The first facility forarticulateexpressionareimportant. and carefuluseoflanguage,thereforegoodwritingskillsa historical andpoliticalcontext.Legaltrainingrequiresprecise subjects cannotbefullyappreciatedwithoutreferencetotheir and politicaldevelopmentswillbeanadvantageasmanylegal of ourLawdegreesmaybeforyou. A generalinterestinhistory If youliketobechallengedandintellectuallystimulatedthenone n n n n n n Junior Freshman(firstyear) Modules (Subjects)

Course overview Is thiscourserightforyou? Visit theLawSchool n Legislation and regulation Legislation and Criminal law Contract law Legalskills) system(including The Irishlegal lawI Constitutional Torts

If you are considering studying foraLawdegree If youareconsideringstudying e-mail (seebelow)toarrangeavisit. would behappytomeetyou.Pleasecontactusby with amemberofstaff, ortovisittheLawSchoolwe of thisopportunity, tocomeinanddiscussyouroptions welcome toattendlectures.Ifyouwouldlikeavail at Trinity Collegebutwanttobesure,youaremost

Arts, Humanities and Social Sciences 69 ). www.kingsinns.ie www.lawsoc-ni.org ), while prospective www.barlibrary.com Law degrees and professional Law degrees and professional Broad Curriculum programme Curriculum Broad Study abroad Career opportunities qualifications In view of rapid changes relating to the rules of entry into all students are advised to maintain regular professional study, contact with the relevant professional bodies so that they are aware of any new requirements coming on-stream. No law degree entitles a person to practise law as a solicitor No law degree entitles a person to practise If you wish to go on to obtain a professional or barrister. that require profession the for bodies governing the qualification, primary law degree. you study certain specific modules in your modules during the These modules are taught as compulsory The Freshman years and/or as optional Sophister modules. five undergraduate law degree programmes School of Law’s enables students the opportunity to study all modules required by the Irish and English professional bodies. Students contemplating a career as a barrister will need to continue their studies with the Honorable Society of the King’s law graduates must complete the qualify as a barrister, To Inns. Inns before ‘devilling’ one-year degree course with the King’s Further information on with a qualified barrister for a year. becoming a barrister is available from Prospective solicitors must undertake the professional training programme for solicitors delivered by the Law Society of Ireland ). (www.lawsociety.ie Separate requirements apply in Northern Ireland. Prospective The Inns Court Treasurer, barristers should consult the Under of Northern Ireland ( the Incorporated Law solicitors should consult the Secretary, Society of Northern Ireland ( The School of Law is committed to making available to students to making available of Law is committed The School under outside its discipline, of taking a module from the option to Students may choose Curriculum programme. the Broad variety of disciplines, not just from the study modules from a and Social Sciences (see page 13 Arts, Humanities Faculty of for further information). a limited there are (third) year of study, In the Junior Sophister on the EU-funded exchange number of places available universities. In addition to exchange programmes in European also has bilateral programmes in Europe, the School of Law Australia. America and links with leading universities in North law degree provides the ideal foundation for the aspiring A wider opportunities law offers However, solicitor or barrister. graduates finding than professional practice alone, with many journalism, employment in public administration, business, banking, insurance, politics, foreign affairs, accountancy, diplomacy and international financial services. Sport and the law Public interest law Public international law Refugee and immigration law Restitution law Tax International trade law Jurisprudence Labour law Legal philosophy Media law Penology Evidence Family law Intellectual property law International family law International human rights law Employment law English land law Environmental law European human rights EU food law Company law Comparative law Corporate governance Criminology Economic and legal aspects of competition policy Advanced European law Union Advanced evidence Child law Collective labour law Commercial law Constitutional law II Equity UnionEuropean law Land law Private law remedies (including Mooting) Administrative law

n students may opt to write a In the Senior Sophister year, research dissertation on a topic of their choice in place of a taught module. n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n The Sophister years (third and fourth year) The Sophister years take modules students must of study, Throughout the four years The each year. Transfers) Credit (European worth 60 ECTs in the Sophister however,1 10 ECTs; majority of modules bear The modules 5 credit modules available. years there are also to study are as follows: which may be available n n n n n Senior Freshman (second year) Senior Freshman n 70 Arts, Humanities and Social Sciences Graduate Profile Student Profile of greatbenefit tomeinmypracticeatthebar.” lecturers encouraged ustotakelegalissues hasbeen that thequestioningapproachwhich Yvonne andother in planningandenvironmentallaw. Ihavenodoubtbut Yvonne Scannell,andsubsequently decidedtospecialise the EnvironmentalLawcourse taught byProfessor cases weretheleadersintheir field. Iparticularlyenjoyed atmosphere. Mylecturerswere excellent,andinmany School isrelativelysmall,andthushasaveryfriendly fairer basisofassessmentthaninmostcolleges. The Law your performanceinthirdandfourthyear, whichisamuch subjects indepth. Your degreeisawardedonthebasisof subjects, butalsoaffords an opportunitytostudythose four-year coursenotonlyallowsforagreaterchoiceof fact thatitoffered afour-yearhonorsdegreecourse. A excellent reputationoftheSchool,and,secondly, the “My reasonsforchoosing Trinity Collegewere,first,the (Thomson RoundHall,Dublin). law, andtheauthorof“PlanningDevelopmentLaw” Senior Counselspecialisinginplanningandenvironmental with afirstclasshonoursdegreein1992.Garrettis Garrett Simons,S.C.graduatedfromtheSchoolofLaw Garrett Simons friends intheprocess,then Trinity Collegeistheplacetobe.” about the law from outstanding teachers, and make a lot of to that.Ifyouarelookinghaveagreatfouryears,learn world classstandardsandtheLawSchoolisatestament Trinity College is an internationally recognised university of are learning. subject andtohaveaninquisitorialapproachwhatyou exam, buttohaveawideandpracticalknowledgeofthe and fourthyears,arenotjustaimedatmakingyoupassan always willingtohelp. The lectures,especiallyinthethird the bookonwhattheyareteaching,friendlyand Aside fromthefactthatmostoflecturershavewritten The teachingintheLawSchoolhereissecondtonone. friendships inanothercountrythatwilllastalifetime. on legalissuesandalsotosetupconnections United States gave me the chance to broadenof the degree my in otherperspectives world class universities. Studying in the invaluable opportunityofstudyingabroadforthethirdyear particularly interestedin.Lawstudentsarealsogiventhe to delveintomorespecificareasofthelawthattheyare students notonlytostudythecorelegalsubjectsbutalso between the staff and students. The four-year degree allows universities and it allows for a friendly close-knit environment The Law School is relatively small compared with other leading to goagainstthegrainandcome Trinity College. Law here and I can honestly say I am so glad that I decided and I very nearly did the same. I am now in my final year of school friendsweregoingtocollegethereorinEngland a bitofwhim.ComingfromNorthernIreland,mostmy “If Iamhonest,chosetostudyLawat Trinity Collegeon Grainne McAnaney

E-mail: [email protected] Tel: +35318961125 /1278 www.tcd.ie/law/undergraduate Further information

Arts, Humanities and Social Sciences 71

area studies French or German civil law French constitutional law or German legal system Law of tort Land law Private law remedies Equity Mooting programme French or German language French civilisation or German cultural history The Irish legal system Contract law Constitutional law 1 Criminal law Legal skills French or German language French civilisation and legal methods or German Course content Course

n Senior Freshman Law and French students study French civil tort) through French. In contract and law (including property, their integrated French language and civilisation modules, they focus on French politics and the integration of the themes studied in the first two years. n study French Junior Freshman Law and French students through French constitutional law and French legal methods These two as well as French language and civilisation. tutorials, and listening integrated modules comprise of lectures, language, French society and They cover comprehension work. the French legal system. alongside study, Junior Freshman Law and German students political institutions German language and textual analysis, the and aspects of society and economy in the German speaking The course involves an introduction to German countries. constitutional law and the German legal system, German legal history and legal philosophy. Senior Freshman modules n n n n n n n In the Freshman (first two) years you will study a variety of you will study a variety (first two) years In the Freshman you will have In each semester, see below. legal subjects, each per hours of lectures in modules, with three two Irish law law lectures are complemented by compulsory These week. and modules in legal skills in the Junior seminars (4 per module) and mooting (mock trials) in the Senior Freshman (first) year Law and language students also Freshman (second) year. and civil law of their chosen jurisdiction. study the constitutional students take integrated modules Alongside their law modules, covering aspects of sociology, on language and civilisation, Lectures, tutorials and listening legal systems and politics. are all involved. comprehension work Junior Freshman modules n n n n n n n TR019 (German) 15 510* German (TR019) German (TR019) French (TR018) French (TR018) LL.B. (Ling. Franc) LL.B. (Ling. Germ) Grade C TR018 (French) 15 555* HC1 HC1 Grade C

Trinity College but want to be sure, you are most College Trinity welcome to attend lectures. If you would like to avail of to come in and discuss your options this opportunity, or to visit the Law School we with a member of staff, would be happy to meet you. Please contact us by e-mail (see below) to arrange a visit. If you are considering studying at for a Law degree

Special Entry Requirements: Leaving Certificate DEGREE AWARDED: DEGREE n Advanced GCE (A-Level) See also: page 68 TR004: Law, TR017: Law and business, page 72 TR020: Law and political science, page 74

PLACES 2011: POINTS 2010: COURSE CODES: COURSE Visit the Law School Visit Is this the right course for you? Overview Law and French/German Law and In addition to a desire to study law, you will need a specific and In addition to a desire to study law, strong interest in the general culture, legal, political, economic You and sociological make-up of either France or Germany. should also be willing and have the ability to become fluent in the relevant language. Law and French and Law and German are demanding Law and French and Law and German are to learn about the law, programmes that give you the opportunity continental civil law language and culture of one of the principal grounding in Irish and jurisdictions, in addition to receiving a full Far more is involved than simply attaching a language EU law. French or German component to a law degree. Students study These both constitutional and civil, in their first two years. law, the relevant law subjects are taught and examined through of each programme is The language component language. in the context integrated so that language skills are developed legal, culture of studying the general, as well as the specifically of the country concerned. Each programme is taught over four years with a compulsory year abroad. 72 Arts, Humanities and Social Sciences assessment inlanguageandFrenchorGermanlawsubjects. examinations isused. There isastrongelementofcontinuous A combination ofassignmentsandaural,oralwritten their lawmodules. rhetoric, attendaseminaronGermanLaw, aswelltaking and writtenlanguagemodules,including Translation and law modules.LawandGermanstudentstakeadvancedoral translation, ReportwritingandOralFrenchinadditiontotheir Senior SophisterLawandFrenchstudentsstudy the relevantlanguagedepartment. (see page13),aresearchdissertationormoduleoffered by place ofalawmodule,includingBroadCurriculummodule Students maychoosefromanumberofoptionstotakethe will engage in language and oral work and project/report writing. if requiredbytheparticularprofessionalbody. Inaddition,you also takeFreshmanmodulesinplaceofaSophistermodule wish tocontinuetheirstudieswiththeprofessionalbodiesmay See page69fordetailsofpossiblemodules.Studentswho (credits) worthofmodulesfromapproximatelythirtyoptions. In theSeniorSophister(fourth)year, youselect40ECTS final degreegrades. obtained studyingabroadconstituteasubstantialpartofyour related subjectsinaFrenchorGermanuniversity. The results The JuniorSophister(third)yearisspentstudyinglegalor The Sophisteryears law. history; Germancivillawandjurisprudencecriminal to thespecialistlanguageusedinlegaltexts;Germancultural German language,includinglegaltranslationandanintroduction Senior FreshmanLawandGermanstudentstakemodulesin E-mail: [email protected] Tel: +35318961125 /1278 www.tcd.ie/Law page 69. Also, see“Lawdegreesandprofessionalqualifications”on affairs anddiplomacy publicservices. journalism, accountancy, banking, insurance,politics,foreign and Germangraduatesalsofindemploymentinbusiness, to careersinthelegalprofession,LawandFrench as wellenjoyingcareeropportunitiesinEurope.Inaddition much tocontributethelegalandotherprofessionsinIreland, graduates ofthelawandalanguagedegreeprogrammehave The increasingEuropeanisationoflegalpracticemeansthat Career opportunities Assessment Further information

international perspectivesonlawandbusiness. markets, taxation,theprotectionofintellectualpropertyand of markets,consumerlaw, labourlaw, financeandfinancial forms ofbusinessorganisation,competitionlawandregulation disciplines; forexample,thestructureofcompaniesandother upon themanyareasofoverlappinginterestbetweentwo law operates.Studentswillhavetheopportunitytofocus activity andtheeconomiccommercialcontextinwhich understanding ofboththelegalframeworkbusiness the disciplinesoflawandbusinesstodevelopacritical This jointdegreeaimstogivestudentsafirmgroundingin German, Russian, SpanishorPolish). Mathematics and statisticsoralanguagemodule (French, to economicpolicy. Inaddition,studentscanchoosebetween Introduction toorganisationand management,andIntroduction Law oftort.Studentstaketwomandatory businessmodules: law modules: The Irishlegalsystem,Lawofcontract,and each equalto10ECTScredits. Studentstakethreemandatory In theJuniorFreshman(first)year studentstakesixmodules, range ofcareeropportunitiesorfurtherstudy. management skills,enablingstudentstochoosefromawide provide studentswithafirmgroundinginlawalongstrong principles andmanagementpractices. The programme will individuals seekingacareerdefinedbytheapplicationoflegal have blendedinmanyaspects. This courseisaimedat and taxation, the work of legal graduates and business graduates of the work of the legal profession into areas of mergers,With thegrowthinsizeoflegalpracticesandexpansion acquisitions evolving commercialorganisationsandbusinesspractices. policies. Conversely, thelawhashadtograpplewithconstantly concerning governmentregulationsandinternationaltrade global economy, businessesnowdealwithmorecomplexissues closely associatedinboththepublicandprivatesector. Inour Historically, thedisciplinesofbusinessandlawhavebeen Course overview Law andbusiness Course content Is thistherightcourseforyou? TR020: Lawandpoliticalscience,page74 TR018/019: LawandFrench/German,page71 TR004: Law, page68 See also: GCSE Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

OC3/HD3 Grade B LL.B. (LawandBusiness) 550 25 TR017 Mathematics Mathematics

Arts, Humanities and Social Sciences 73

http://lawlibrary.ie (solicitors). www.lawsociety.ie Further information Career opportunities Why choose the Trinity College Assessment study abroad Languages and School of Business? of law, European Union food law, International trade law, Private Private trade law, International Union food law, European of law, family law. international interest law, Public international law, Refugee law, Research law, Refugee Public international law, interest law, Curriculum Broad Media law, law, Tax Sports law, dissertation, issues in the philosophy Contemporary Child law, (see p. 13), and www.tcd.ie/law www.tcd.ie/business +353 1 896 1840 or +353 1 896 2367 Tel: The programme will provide students with strong management The programme will provide students with well be will Graduates law. in specialisation in-depth an and skills in both the legal prepared for demanding and rewarding careers where the two and business professions, particularly in areas graduates to accept positions expect disciplines coincide. We business, taxation, finance and accounting, general in law, civil service. In management, employment relations and the all the law students will have the option of studying particular, subjects required for a qualifying law degree, which will enable them to apply for entrance to the professional legal institutions The post-degree training to qualify as barristers and solicitors. for barristers and solicitors varies from time to time, and current details can be found on the following websites: (barristers) and Also, see “Law degrees and professional qualifications” on page 69. See page 40 Modules are examined by a combination of continuous Modules are examined examination. assessment and formal students have the option to study French, First and second-year who have the German, Spanish, Russian or Polish. Students the opportunity to prerequisite language proficiency will have the Erasmus exchange study abroad in their third year as part of This will mean spending all or part of the Junior programme. Austria, Belgium, in Sophister (third) year abroad at a university The Business School Russia or Spain. Italy, France, Germany, programmes exchange international English-speaking offers also Australia America, to prestigious universities in Europe, North Taiwan China, Asian countries including Japan, and in several and South Korea.

Law: Commercial Advanced European Union law, Administrative law, (private Conflict of laws Comparative law, Company law, law, international law), Constitutional law II, Corporate governance, Evidence, Family law, Equity, Environmental law, Criminology, Employment Economic and legal aspects of competition policy, Intellectual property law, European human rights law, law, International practice in International human rights law, Land law II, Legislation Jurisprudence, Labour law, law, Private law remedies, Public and regulation, Planning law, Business: Theory and practice; International Strategic management: business; Exploring organisational experiences; Financial Advances in marketing theory and reporting and analysis; practices; Managing non-profit organisations; Employee relations; Managing new product development; International A commercial finance and risk management; Entrepreneurship: and social perspective. In the Senior Sophister (fourth) year students may choose from In the Senior Sophister (fourth) year students to either combine a range of module options and may choose to or alternatively, business and law modules in this year, specialise entirely in either law or business modules. Module options include: optional modules as follows: Comparative law, Company law, Commercial law, Administrative Conflict of laws (private international law), Constitutional law, Environmental law, law II, Corporate governance, Criminology, Economic and legal aspects of Evidence, Family law, Equity, European human rights law, Employment competition policy, International human rights law, Intellectual property law, law, Land law, Jurisprudence, Labour International practice in law, law Private law, law II, Legislation and regulation, Planning Refugee law, Public international remedies, Public interest law, Media law, law, Tax Research dissertation, Sports law, law, Contemporary issues Broad Curriculum (see p. 13), Child law, International law, European Union food in the philosophy of law, Private international family law. trade law, The remaining Law modules may be drawn from a list of The remaining Law modules may be drawn Human resource management; Operations management; Human resource management; accounting; Marketing management; Financial and management and change. Applied finance; Organisation behaviour In the Junior Sophister (third) year students take a combination (third) year students take a combination In the Junior Sophister 1/3 must be from the Business School of modules, of which School. One of the law modules must be and 1/3 from the Law be The remaining business modules may European Union law. modules as follows: drawn from a list of optional In the Senior Freshman (second) year students take six year students take Freshman (second) In the Senior are: Criminal law, mandatory law modules The three modules. business The three mandatory law I and Land law. Constitutional discipline modules: Management the core business modules are management), Marketing behaviour, 1 (Organisational to accounting, Financial analysis), Management 2 (Introduction to finance, Introduction to and Management 3 (Introduction operations management). 74 Arts, Humanities and Social Sciences service wouldbestrengthenedbyaknowledgeofthelaw. or ifyourintellectualcareerinterestsinpoliticsandpublic study oflawtobeinformedbyawiderpoliticalunderstanding, Yes, if you are interested in pursuing a legal career and want your required bythelegalprofessionalbodies. students will have the opportunity to study all of the core subjects subject, orcontinuewithboth.Duringthefouryearsofstudies, you willhavetheoptiontoconcentrateexclusivelyoneither take bothsubjectsforthefirstthreeyears.Inyourfourthyear relation toeachother. As astudentonthisprogramme,youwill the opportunitytolearnaboutbothandbetterunderstandtheir Law andpoliticsaredeeplyconnectedthiscourseprovides modules fromboth subjects. Sophister (fourth)yearorcontinue totakeacombinationof to specialiseineitherLaworPolitical scienceintheirSenior totalling 30creditsfromeachdiscipline. Studentsmaychoose In theJuniorSophister(third)year, studentstake modules six 10creditmodules(threefromeachdiscipline). Transfer System)peryear. Inthefirsttwoyearsstudentstake All studentstakemodulesworth60ECTS(EuropeanCredit Visit theLawSchool Is thistherightcourseforyou? Course overview Law andpoliticalscience Course content n TR081: BESS,page37 sociology, page80 TR015: Philosophy, politicalscience,economicsand TR012: Historyandpoliticalscience,page63 TR017: Lawandbusiness,page72 TR018/019: LawandFrench/German,page71 TR004: Law, page68 See also: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

If you are considering studying foraLawdegree If youareconsideringstudying e-mail (seebelow)toarrangeavisit. would behappytomeetyou.Pleasecontactusby with amemberofstaff, or tovisittheLawSchoolwe of thisopportunity, to comeinanddiscussyouroptions welcome toattendlectures.Ifyouwouldlikeavail at Trinity Collegebutwanttobesure,youaremost LL.B. (Pol.Sc.) 560* 20 TR020

dissertation; Restitution; Tax law;andSportthe law. international law; Refugeeandimmigrationlaw; Research philosophy; Medialaw;Penology; Publicinterestlaw; law; Jurisprudence;Labour Landlaw(English);Legal family law;InternationalHuman Rights;Internationaltrade law; Evidence; Family law; Intellectual property law; International Environmental law;Equity;European HumanRights;EUfood and legalaspectsofcompetition policy;Employmentlaw; Conflict oflaws;ConstitutionalLawII;Criminology;Economic Child law;CommercialCompanyComparative Law: Administrative law; Advanced EU law; Advanced evidence; the followinglist: study acombinationofLawandPoliticalsciencemodulesfrom either 60ECTSfromLaworPoliticalsciencecontinueto Senior Sophister(fourthyear)studentsmaychoosetotake Democracy anddevelopment. and politicsoftheUSA;EuropeanUnionPolitics; the finalyear),andtwomodulesfrom:Irishpolitics;Government (compulsory ifstudentswishtospecialiseinPoliticalscience Political science:Researchmethodsforpoliticalscientists Tax law, andSportthelaw. international law;RefugeeandimmigrationRestitution; philosophy; Medialaw;Penology;Publicinterest Jurisprudence; Labourlaw;Landlaw(English);Legal law; InternationalHumanRights;trade Family law;IntellectualpropertyInternationalfamily law; Equity;EuropeanHumanRights;EUfoodEvidence; aspects ofcompetitionpolicy;Employmentlaw;Environmental laws; ConstitutionallawII;Criminology;Economicandlegal Commercial law;CompanyComparativeConflictof modules: Administrative law; Advanced evidence;Childlaw; Law: EUlaw(compulsory)and20ECTSfromthefollowing Law andPoliticalsciencefromthefollowingmodules: Junior Sophister(thirdyear)studentstake30ECTSfromboth The Sophisteryears politics, andInternationalrelations. Political Science: Law: Criminallaw, Constitutional lawIandLandlaw. Senior Freshman(second)year to economicpolicy, andIntroductiontosociology. Political science:Introductiontopoliticalscience, and Torts law. Law: TheIrishlegalsystemandLegalskills,Contract, Junior Freshman(first) Year take Researchmethodsforpoliticalscientists. science inthefinalyearofhis/herdegreethenhe/shemust is mandatory. IfastudentchoosestospecialiseinPolitical In theJuniorSophister(third)year, onelawmodule,EUlaw, week permodule. at lecturelevelwithtwohoursoflecturesandonetutorialper seminars permodule.Politicalsciencemodulesarealsotaught one semesteronlyandstudentsattendfourcompulsorylaw Law modulesaregenerallytaughtforthreehoursperweek History ofpoliticalthought,Comparative

Arts, Humanities and Social Sciences 75

[email protected]

Career opportunities Further information Law degrees and professional qualifications Whether students’ career goals lie in public leadership, the career goals lie in public leadership, Whether students’ academia, public legal profession, the media, the civil service, knowing how relations, anything in business that requires organisations such government works, positions in international law enforcement, as the EU or a not-for-profit organisation, in Law and political private practice, or elsewhere, the degree for attaining those science will be ideally suited as a platform goals. www.tcd.ie/law/undergraduate / 1278; E-mail: +353 1 896 1125 Tel: www.tcd.ie/Political_Science/undergraduate +353 1 896 1651 Tel: No law degree entitles a person to practise law as a solicitor or throughout the four-year degree programme However, barrister. in Law and political science, students will have the opportunity to study all core modules required by the professional bodies. Please see page 69 for further information on legal professional qualifications.

. www.tcd.ie/Law/Courses Study abroad Assessment A limited number of places are available on EU-funded exchange EU-funded on available are places of number limited A Italy, Austria, France, Germany, programmes at universities in the Netherlands, Poland and Spain to students in the Junior Students are advised to take optional Sophister (third) year. language courses (see page 13) within the first two years if they wish to avail of this opportunity; alternatively they must satisfy that they have proficiency in the language of the host university There are also exchange programmes that they wish to study in. America. Participating in with a number of universities in North these opportunities is dependent upon the exchange fulfilling the course requirements of both departments. Courses are examined by a combination of continuous assessment and formal examination. Full details of all law modules (Freshman and Sophister) Full details of all law modules (Freshman In both subjects small-group teaching is an important aspect In both subjects small-group teaching is an to specialise in of the Sophister years and, should you decide you will have the year, either Law or Political science in the final on a topic of opportunity to research and write up a dissertation your choice. are available on Political science: Research seminar; Contemporary political parties; Issues in theories; Comparative political reform; Political relations; and contemporary politics; Contemporary international African politics. 76 Arts, Humanities and Social Sciences specialisation. is designedsothatstudentsmay alsotakesubjectsoutsidetheir they undertakeamajorproject in thatarea.However, the course historical andanalyticalstudyofmusic);intheirfinalyear areas: composition,musictechnology, and musicology(the wide rangeofoptions.Studentsspecialiseinonethefollowing and especiallyinthethirdfourthyears,bothcoursesoffer a study (seebelowfordetails).Fromthesecondyearonwards, grounding inthebasicskillsofmusicianshipandacademic The singlehonorandtwo-subjectcoursesprovideathorough Music Course overview DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODES: TR009 –Musiceducationpage78 See also: the samerangeofoptionsassinglehonorstudents. that ofthesinglehonorprogramme. TSM studentshave studied bysinglehonorstudents,theworkloadislessthan While TSM studentscoveralltheprincipalareasofmusic Single honorand TSM studentsfollowthesamecourses. For subjectsthatcombinewithMusicseepage92. both subjects. the fourthandfinalyear. Anhonorsdegreeisawardedin studied forthreeyearsandonesubjectonlyisin can becombinedwithoneothersubject.Bothsubjectsare TR001 –Music(TSM)isajointhonorsprogramme. read almostexclusivelyforfouryears. TR002 –Musicisasinglehonorcoursewheremusic You arenotrequiredtoperformatinterview. of April/beginning ofMay, beforefinalselectionsaremade. applicants maybecalledtoattendaninterviewattheend On thebasisofentranceexaminationresults, important musicalqualificationisagoodear. read andnotatemusictoarudimentarylevel. The most but candidatesshouldhaveagoodearandtheabilityto Formal musicaltrainingisnotaprerequisiteforentry, Special EntryRequirements: www.tcd.ie/Music/undergraduate/music/index.php from theMusicDepartmentwebsite: Specimen examinationpapersareavailablefordownload for Saturday24March2012. attend anentranceexamination,provisionallyscheduled proposed yearofentry. Applicants willberequiredto Applications mustbesubmittedby1Februaryofthe These arerestrictedentrycourses. TSM points: B.A. 470* 20 TR002 See noteonpage28 555-570 10 TR001 (TSM) collection ofCDs. holdings ofbooksandmusic,it housesanextensivelistening and best-equippedlibraryformusic. Inadditiontoitsgeneral largest researchlibraryinIreland. Itisalsobyfarthelargest As astudentat Trinity Collegeyouwill haveaccesstothe they chosebecausethey, likeyou, loveit. They areheretohelpyouinyourexplorationofasubjectthat expertise incomposition,musictechnologyandmusicology. The staff oftheMusicDepartment haveawiderangeof lending collectionofCDsandvideos. elsewhere), excellentlisteningequipment,andasubstantial a smallmusicstudio(plusmoreextensive,sharedfacilities of computerworkstationsthatareusedforteachingandstudy, practice roomswithpianos,anexcellentandup-to-datesuite The facilitiesintheMusicDepartmentincludearecitalroom, able toemphasisetheareasthatinterestyoumost. Because thecourseincludesawiderangeofoptions,youwillbe conduct ensembles,andgainexperienceofartsadministration. awareness. You willalsohaveplentyofopportunitytoperform, thought, creativity, criticalandanalyticalskills,intellectual As anacademicdiscipline,musicfostersindependenceof greatly improvedindepthandbreadth. or practical,yourexperienceofthisvastandrichsubjectwillbe course foryou.Whetheryourinterestsareprimarilyacademic music, howtobecomeamoreinformedperformer–thisisthe know howitworks,itshistoryanddevelopment,towrite If youlovemusicandwanttounderstandit–forexample, or fewer. large group,manysubjectsaretaughtingroupsoftenstudents subjects, suchasHistoryofmusic,aredeliveredlecturestoa is thecommitmenttosmall-groupteaching. One ofthestrengthsMusiccoursesinTrinity College traditions. the departmentcome,primarilyfromoneofthosenon-classical music andIrishtraditionalmusic.Manystudentscurrentlyin lectures inothermusicaltraditions,includingjazz,popular the presentday. However, thedepartmentregularlypresents practice ofclassical(orart)music,fromthemedievalperiodto The majorityofsubjectsarebasedonthetraditionsand and performance. compositions andonprojectsinmusictechnology, musicology professional playersofinternationalstanding offers studentsanunmatchedopportunitytoworkwith The recentlyestablishedEnsemble Avalon (APT)Residency many performanceopportunitiesoffered bystudentsocieties). supervision ofexpertsintheirfields(theseareadditiontothe supports severalperformancegroupsthatworkunderthe skills areavailableineachyear;andtheMusicDepartment the campus.Practicalcoursesinauraltrainingand/orkeyboard curriculum, awiderangeofmusicalactivitiestakesplaceon Although instrumentalorvocalstudiesarenotpartoftheformal Is thistherightcourseforyou? While some , ontheir Arts, Humanities and Social Sciences 77

Film music Three Parts Counterpoint in and Fugue the 19th centuryThe German Lied in Music and language of polyphonyByrd and the politics Sonata structures Experimental theatre music and contemporary opera design Web Handel and the English oratorio of Gerontius The Dream Newman and Elgar, Career opportunities Further information Assessment in music technology you will produce a major project in the final a major project you will produce in music technology courses involves a range of in musicology Specialisation year. in a subjects, and culminates historical and analytical relating to in the fourth year. dissertation a recital for up to approximately may opt to present All students Sophister students are also In each year, 10% of their degree. of option in either aural training or in the playing an offered either piano or harpsichord). In recent years, figured bass (using other options have included: Anyone considering studying Music is welcome to visit the of members to speak to lectures, on in sit to order in department, make an appointment, To and to speak to current students. staff, 1120; contact the Music Executive Officer: +353 1 896 [email protected] (office hours: 1000-1630, Mondays to Fridays). and of the Full details of the courses in Music, of the staff curriculum can be accessed via the Music Department’s website: www.tcd.ie/Music +353 1 896 1120 Tel: Most subjects are assessed by a combination of examination Most subjects are assessed by a combination (at the end of the year) and continuous assessment. graduates in Music College’s Trinity The employment record for successful is excellent. Recent graduates have established for television, radio, careers as composers, as music producers and or recording companies, as performers, administrators recognised institutions teachers, as academics in internationally last few years several worldwide, and as conductors. Within the recent graduates have been commissioned by front-rank to write new works. Graduates organisations such as RTÉ are working in this country and in countries as diverse as the Australia, China and England. Music USA, Canada, Germany, graduates have an outstanding record of obtaining scholarships for further study abroad, from international institutions, as well smaller number have used A Arts Council of Ireland. as from the to the analytical and intellectual skills that these courses offer build successful careers outside music: recent examples include financial investment, and public relations. medicine, law, n n n n n n n n n n

– includes computer orientation, but want to be sure, you are most welcome to attend welcome to attend be sure, you are most but want to at any time during teaching lectures at the department to discuss your options will also be invited You terms. Contact us by teaching staff. with a member of the below). e-mail or phone (see If you are considering studying Music at Trinity College Trinity studyingIf you are considering at Music

and introduction to MIDI protocol, audio signals and computer-based notation and sequencing. they come together to form increasingly large units. Music technology – the conventions of music to counterpoint Introduction notation and rudiments, leading to the study of Fuxian species counterpoint, which will enable you to acquire History of music – an introduction to the music of Baroque context (this and early Classical periods in a broad cultural music forms part of a four-year programme of general history), plus an introduction to research methodologies, to music analysis – includes re-assessment Introduction ways in which of the elements of a musical text and the Keyboard skills – (taught in conjunction with aural training) given figured bass, will enable you to create harmony over a to transpose up or down a and to play four-part harmony, tone or semitone. – an introduction to the writing to harmony Introduction and to presentation and style in writing essays. a command of basic polyphonic composition. Aural training – using moveable Doh (Solfège orAural training Solfa). skills in areas The course will improve your basic musical score-reading. such as musical dictation, sight-reading, and of four-part harmony. n Course content Visit the Department of Music the Department Visit

In the Senior Freshman (second) year you will continue with the above subjects from the first year while beginning to explore or music your specialist area – either composition, musicology, Single Honor students will also select a Broad technology. TSM students have a Curriculum course (see page 13), and wider range of options that includes Broad Curriculum. Students who specialise in composition will receive a thorough grounding in compositional techniques; they present a portfolio of their compositions as their final-year project. If you specialise The Sophister years In the Sophister (third and fourth) years study becomes more concentrated on your chosen specialisation. It is always possible to take options from other specialisations. n n n n n n n Subjects include: The Freshman years The Freshman (first) year is designed to ensure that The Junior Freshman in basic musical skills and provides you are fully competent musicology, an introduction to historical and analytical compositional techniques and music technology. 78 Arts, Humanities and Social Sciences analysis andthehistoryofmusic. grounding inharmony, counterpoint,composition,orchestration, chamber musicgroups. The coursealsoprovidesforasolid keyboard skillsandperformanceinchoral,orchestral associated competenceinrelatedmusicskills,i.e.conducting, performance intheinstrumentofyourchoice,aswellwithan This four-yearprogrammewillequipyouwithahighstandardof Drama, andtheRoyalIrish Academy ofMusic. the DublinInstituteof Technology, ConservatoryofMusic and Northern Ireland). The degreeistaughtinconjunctionwith to becomemusicteachersatsecondary-schoollevel(including for theacademicandprofessionalrequirementsofthosewishing The BachelorinMusiceducationdegreeisdesignedtoprovide practice. classroom teaching isprovided,inadditiontoinstrumental/vocal the exceptionallygifted.Supervised practiceinallaspectsof perform areprovided,offering realisticgoalsforall,including at alevelappropriatetoyourown ability. Opportunitiesto pupils. You willbeencouragedtoengage inensemblework evoking theabilitytoarouse interestandenthusiasmof A basicfeatureofthecourseispersonal developmentinmusic, teaching career, thenthiscoursewillbeideallysuitedtoyou. performance, andwishtocombinethesequalitieswitha If youenjoymusic,alreadyhaveareasonablestandardof Course overview Music education Course content Is thistherightcourseforyou? Education, page55 TR002: Music,page76 See also: See page27forfurtherdetails. Students willberequiredtoundergoGardavetting. Garda Vetting: element oftheinterview. final selectionsaremade.Performancewillfeatureasone will becalledtoduring attend aninterview April/May before On thebasisofexaminationresults,someapplicants for 24March2012. attend anentranceexamination,provisionallyscheduled proposed yearofentry. Applicants willberequiredto Applications MUST besubmittedby1Februaryofthe This isarestrictedentrycourse. DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: B. Mus.Ed. 475* 15 TR009 n n n n n n Education courses n n n n n n n n n n Music courses www.riam.ie www.dit.ie www.tcd.ie/Education/courses/bmused.php contact theMusicEducationCo-ordinator at+35318961145. and tospeakcurrentstudents. To makeanappointment, to visittheSchoolofEducation, tospeakmembersofstaff, Anyone consideringstudyingMusic educationiswelcome performance, orinarangeofotherareas. in relatedareassuchasmusiceducation,musicology, technology. Manystudentstake postgraduatecourses–either as artsadministration,librarywork,musictherapyand as ageneralartsqualificationandgoontoworkinareassuch schools, butalsotoinstrumentalteaching,someusethedegree While mostofthestudentsgoontoteaching–usuallyin Sophister (third)yearstudyingabroad. There areopportunitiesforstudentstospendpartoftheirJunior examinations andteachingpracticemakesuptheassessment. A combination ofcontinuousassessment,practicalandwritten n n comprising musicandeducation. There areapproximatelyeighteenhoursoflecturesperweek,

Further information Career opportunities Study abroad Assessment History ofeducation assessment&examinationsinpost-primary Introduction to education: Sociologies of Yesterday &today;Ireland &theory Educational philosophy ineducation Applied psychology practice andteaching Music education &Musiceducation Sociology ofMusic Music technology classforfirstinstrument Special repertoire Conducting Practical musicianship Irish music History ofmusic counterpoint Harmony and skills andkeyboard Aural perception (Irishtraditional First instrument–individualtuition Research methods ineducation Research methods Educational issues the world education instruments maybeoffered)

Arts, Humanities and Social Sciences 79

place in any list of the great philosophers, attended In addition, the political philosopher, College. Trinity Edmund Burke (1729-1797), inaugurated the College College. Trinity debating society while still a student at philosophy can be taken as a degree course on its own. George Berkeley (1685-1753), who has a permanent College is the only university in Ireland where Trinity

n n Further information Assessment Career opportunities Did you know? Course content Course www.tcd.ie/Philosophy/teaching/undergrad.php +353 1 896 1529 Tel: Assessment is by means of both essays and formal Assessment is by means of both essays and to both. In the Seniorexaminations with equal importance given you will research and write a dissertation. Sophister year, have worked in areas In the recent past graduates of Philosophy teaching, journalism, law, academic as diverse as accountancy, reporting and research, film making, banking, computing T.V. and advertising. Each year some graduates also opt to pursue a research career beginning with postgraduate study in Ireland or abroad. The Freshman years The Freshman Senior Freshman and two years, called Junior In the first foundation courses in the history Freshman, you will study as well as engage with certain fundamental of philosophy, such as the debates about free will philosophical problems The Sophister years and Senior In the final two years, called Junior Sophister you are able to set your own syllabus by selecting Sophister, political courses from a reasonably wide choice including religion, and philosophy of ethics, philosophy of philosophy, in the areas mind, among others. In this way you can specialise and most suitable of philosophy you have found most interesting to your skills. and determinism, the nature of morality, the nature of language, language, of nature the morality, of nature the determinism, and logic, and the scope and limits of human the existence of God, knowledge. with programmes where philosophy is studied TSM In the are approximately five hours of classes another subject there that for the single honor programme. per week; with double

TR001 (TSM) 43 425*-570 See note on page 28 TR005 17 430 B.A. Philosophy may be studied as a single honor course Philosophy may be studied Subject Moderatorship Two (TR005), within the political and in the Philosophy, programme (TR001) sociology (TR015) programme. science, economics and Philosophy is studied for four years. TR005 In cannot be studied as a single TR001 (TSM) Philosophy other subject honor course. It must be combined with one programme. within the two-subject moderatorship (TSM) is An honors degree TSM is a joint honor programme. a list of the awarded in both subjects. See page 92 for subjects with which Philosophy may be combined. TR015 it is possible to study philosophy for the entire In period, see four-year degree programme or for a shorter TSM points: page 80. COURSE CODES: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE Is this the right course for you? Course overview What is Philosophy? Philosophy If you are interested in questioning society’s basic assumptions If you are interested in questioning society’s and in analysing the moral, political, aesthetic and religious questions lying at the heart of our culture in an articulate manner you will find this a stimulating and challenging course. In all cases the purpose of the Philosophy course is to give you a solid, scholarly grounding in the classical texts that form the and are one of the formative philosophy, history of Western Western culture. Studying the fundamentals of influences on both formal and informal reasoning will enable you to think independently. Philosophy is the discipline concerned with the questions of how Philosophy is the discipline concerned with exist and what are one should live (ethics); what sorts of things counts as genuine their essential natures (metaphysics); what is and what it means knowledge (epistemology); what existence principles of reasoning to be (ontology); and what are the correct is a method, rather (logic). It is generally agreed that philosophy Its investigations than a set of claims, propositions, or theories. wedded to reason, are, unlike those of religion or superstition, no leaps based purely making no unexamined assumptions and In Greek, “philosophy” revelation, or authority. on analogy, means “love of wisdom.” Philosophy is based on rational The questions addressed by argument and appeal to facts. philosophy remain the most general and most basic, the issues that underlie the sciences and stand at the base of a world-view. 80 Arts, Humanities and Social Sciences taken torecognisethegreatercommitmentindependentwork. In thefinalyearthereisareductioninnumberofmodules three teachinghoursperweekincludingtutorialclassesineach. In thefirstthreeyearsyoutakesixmoduleswithapproximately disciplines whichmakeupthedegree. obtaining anexcellentgroundinginone,oratmosttwo,ofthe of thefour-yeardegreeprogramme,studentsareassured over thecourse specialisation a gradual frameworks. Byallowing several complementarydisciplinarydirectionsandanalytical and humanphenomena,onemustapproachthemfrom idea behindtheprogrammeisthat,tounderstandsocial skills forawholerangeoffuturecareersandactivities. The to understandingthesocialandhumanworld,developing It bringstogethersomeofthemostimportantapproaches introduction tothestudyofsocialsciencesandphilosophy. The aimofthisdegreeistoprovideacoherentandintegrated this maywellbethecourseforyou. ways ourworldisstructuredandhaveadesiretochangeit,then insights ofphilosophicalinquiry. Ifyouare puzzledaboutthe governed andcreatewealthdrawingonthemethods challenges ofunderstandingthewaysocietiesareorganised, This coursewillappealtostudentswhoareexcitedaboutthe economics andsociology Course overview Philosophy, politicalscience, Is ittherightcourseforyou? TR083: Sociologyandsocialpolicy, page89 TR081: BESS,page37 TR029: Politicalscienceandgeography, page83 TR020: Lawandpoliticalscience,page74 TR012: Historyandpoliticalscience,page63 TR005: Philosophy, page79 TR001: TSM, page92 See also: GCSE Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

OC3/HD3 Grade B B.A. 510* 25 TR015 Mathematics Mathematics enquiry. to helpdevelopresearchskillsandtheofindependent all fourthyearmoduleshaveelementsofprojectworkintended year willbeabletopursueanundergraduatedissertation,and pursuing theequivalentofsinglehonorprogrammesintheirfinal either twosubjectsorchoosetospecialiseinonlyone.Students subjects andintheSeniorSophister(fourth)yearyoumaytake In theJuniorSophister(third)yearyoutaketwooffour The Sophisteryears European politics,toanintroductionsocialresearch. from economicprinciples,tothehistoryofphilosophyWest of thesubjectsandcould,forexample,takemodulesranging Senior Freshman(second)yearyouchoosetocontinuethree science) andsociology(introductiontosociology).Inthe history ofphilosophy),politicalscience(introductionto and statistics),philosophy(centralproblemsinphilosophy, subjects: economics(introductiontoeconomics,mathematics In theJuniorFreshman(first)yearyouwilltakeallfour The Freshmanyears Course content Arts, Humanities and Social Sciences 81

Contemporary international relations African politics Economic theory The world economy Development economics Economics of financial markets economics Transport Economics of human resources Quantitative methods Monetary thought and policy Economic and legal aspects of competition Economics dissertation Economic sociology of Europe Conflict studies Popular culture and digital lives Migration The limits of thought Finitude and transcendence The philosophy Husseri of Edmund Psychology/philosophy Deliberation and decision-making unconscious Freud, Hegel and the Social justice and heath Relativism Fiction and truth space and place in Plato and Time, Aristotle Philosophy dissertation General paper Research seminar Contemporary political theories Political parties Issues in contemporary politics n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n n Year 4 (4 modules if you select if you select 4 (4 modules Year or Economics Political Science, consult the Please Sociology. handbook for Philosophy Philosophy requirements) Democracy and development European Union Politics Economic analysis Money and banking The European economy Economics of less developed countries Investment analysis Economics of policy issues Industrial economics Mathematical economics Econometrics Social theory and social inequality Race, ethnicity and identity development and Globalisation Researching society Conflict studies Political philosophy in ancient philosophy Topics in psychological Topics philosophy in analytic philosophy Topics Moral philosophy Philosophy of religion Logic and philosophy in Continental Topics philosophy Research methods Irish politics Government and politics of the USA n n n n n n n n n n n n n n n n n n n n n n n n n n n Year 3 (6 modules) Year

Gender, culture and society Gender, European societies Introduction to social research History of political thought International relations Comparative politics Intermediate economics Mathematics and statistical methods Logic & philosophy of science History of philosophy n n n n n n n n n n Year 2 (6 modules) Year Economics Sociology Political science Philosophy PPES at a glance PPES at The table ‘PPES at a glance’ (see above) gives you a sense of the richness and diversity of modules that are available within PPES The table ‘PPES at a glance’ in the second, third and fourth years. 82 Arts, Humanities and Social Sciences teaching, journalism,media,lawandmanagement. careers inavarietyofareasincludingpublicadministration, this degreegiveyoutheinsightsandcompetenciestopursue The rangeofdisciplinestowhichstudentsareexposedin assessment andformalexamination. Modules areexaminedbyacombinationofcontinuous Tel: +35318961840 www.social-phil.tcd.ie/PPES Career opportunities Assessment Further information Did youknow? n

This degree programme is unique inIrelandoffering isunique This degreeprogramme philosophy. a dedicatedintroductiontothesocialsciencesand

the ancientGreeks. this entail?Suchtopicshavebeendiscussedsincethetimeof do thesetermsmean?Ifasocietyistoberunjustly, whatwould much everyoneisinfavourofjusticeanddemocracy–butwhat than onesthatcanberesolvedbyevidence. These days,pretty to dowithnormativeissues–the‘should’ questions–rather politics, politicaltheoristspondermorefundamentalquestions, And, takingastepbackfromthedebatesofcontemporary study ofpolitics. of manoeuvre?Questionssuchastheseareattheheart pressure ofevents,thatinpracticetheyhaveverylittlefreedom courts, theEuropeanUnion,constitution,andsheer so constrainedbyotheractorssuchasinterestgroups,the Can governmentsdoprettymuchwhattheywant,orare is itfeasibletomakethedecision-makingprocessmoreopen? How muchsaydoordinarypeoplehaveinpolicy-making,and decision oneconomicpolicyorsomeotherissue,whynot? do notalwaysmakewhatseemstobethemost‘rational’ has to be decided, whose views prevail and why? If governments If it’s notpossibletokeepeveryonehappywhensomeissue other things,thinkingabouthowthesedecisionsgetmade. The studyofpoliticsasanacademicsubjectinvolves,among questions willbedecidedthroughthepoliticalprocess. How highapriorityshouldthirdworldaidbe? All ofthese EU spendsontheagriculturalsectorbecutbackdrastically? Should abortionbelegalised?theamountofmoney the environment?Shouldthird-levelstudentshavetopayfees? equality? Shoulditintroduce‘greentaxes’ inordertoprotect Should governmenttaxtherichtotryachievegreater It’s easytothinkofissuesthatweallhaveopinionsabout. and politicalbehaviour. Politicsaffects usallinourdailylives. of politicsandthedescriptionanalysispoliticalsystems Political scienceisthefieldconcerningtheoryandpractice you thenecessarytools. the levelofpublicaffairs, thestudyofpoliticalsciencewillgive aspect oftheirlife.Ifyouwantto raiseyourknowledgebeyond Politics inthemodernworldtouches everybodyinnearlyevery What isPoliticalscience? Political science Is thistherightcourseforyou? TR081 BESS,page37 TR029 Politicalscienceandgeography, page83 TR020 Lawandpoliticalscience,page74 sociology, page80 TR015 Philosophy, politicalscience,economicsand TR012 Historyandpoliticalscience,page63 programmes: Political sciencemaybestudiedthroughsixdegree

Arts, Humanities and Social Sciences 83

TR029 20 430* B.A. See note on page 28 COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE TSM points: See also: page 92 TSM, TR001: science, page 63 TR012: History and political political science, economics and TR015: Philosophy, page 80 sociology, TR020: Law and political science, page 74 TR071: Science, page 139 TR081: BESS, page 37 Is this the right course for you? Course content Political science and Course overview geography of the developing world as a result of climate change. if you are interested in the disciplines of political science Yes, understanding critical a develop to hope you and geography and natural and human of the relationship between the Earth’s phenomena and its political institutions and systems. In the first three years you will take twelve courses that will each lectures and one hours of two require attendance, on average, of tutorial per week. In the Senior Sophister (fourth) year there is a reduction in the number of courses required to allow greater depth of study and more independent work. In a rapidly changing international economic, political, security In a rapidly changing international economic, science and and environmental context the tools of political to analyse geography are becoming increasingly important This course global problems and provide policy solutions. of real-world combines analytical rigour with an understanding two disciplines have been The variations and complexities. which geography, associated through the sub-fields of political in voting patterns, for example, covers geographical differences powers great the how examines which geo-politics, through and a context in influence other parts of the planet. However, of socio- of globalisation, interdisciplinary understandings solving in key increasingly becoming are issues environmental parts in instability political as such future, the of problems the

is one of the most highly rated in Europe. This is one of the most highly rated in Europe. means that students are taught by some of the top researchers in Europe, enthusiasts for their subject who bring to their students not only the accumulated wisdom of the wider political-science community but also the fruits of their own cutting-edge research. The Political science department in Trinity College Trinity The Political science department in

n Further information Did you know? Career opportunities Study abroad Assessment Course content Course Tel: +353 1 896 1840 or +353 1 896 2367 Tel: Tel: +353 1 896 1651 Tel: www.tcd.ie/Political_Science/undergraduate/index.php There are careers for which a demonstrated interest in politics There are careers for which a demonstrated The Department of Political Science is a partner in Erasmus The Department of Political Science is a partner and Spain. exchanges with universities in France, Poland all or part of their Students have the option to go abroad for Junior Sophister (third) year. is a definite plus and gives you a real head start. Journalism, is a definite plus and gives you a real head public relations, other kinds of media work, the civil service, how government anything in business that requires knowing such as the EU works, work in international organisations A this category. or a not-for-profit organisation, all come into works is obviously demonstrated knowledge of how the world number of An increasing an asset for many types of career. graduates go on to do further study by means of postgraduate even get elected And, with a politics degree, you could work. TD! as a Normally, each course has two hours of lectures and one course has two hours of lectures and each Normally, required in the Senior tutorial per week. Fewer lecture hours are work. Sophister year to allow time for more independent Courses are examined by a combination of assessed essays Courses are examined you year (fourth) Sophister Senior the In examination. formal and to research and write up a dissertation will have the opportunity on a topic of your choice. See the individual course descriptions for History and political for History and course descriptions See the individual and sociology; political science, economics science; Philosophy, and science and geography; science; Political Law and political BESS. 84 Arts, Humanities and Social Sciences scientists intheirthirdyear. alone inthefourthyearmusttakeResearchmethodsforpolitical currently offered); students intendingtotakepoliticalscience Science/undergraduate/timetable.php students maytakeanythreeoptions(see in geographyisalsocompulsory. Onthepolitical-scienceside, (fourth) yearastheirsolesubject, Advanced researchmethods students planningtocontinuegeographyintheSeniorSophister (see www.tcd.ie/Geography formoreinformation).Forthose information systems,andHistoryphilosophyofgeography of options. The mandatorygeographycoursesareGeographic mandatory withtheotherfourcoursesbeingdrawnfromalist subject equally. Onthegeographysidetwocoursesare In theJuniorSophister(third)yearstudentstakeeach The JuniorSophisteryear and theHistoryofpoliticalthought. economic policy, Comparativepolitics,Internationalrelations to politicalscience,Introductionsociology, Introductionto geographical data,andGeographyseminars;(ii)Introduction and III(Human);Changingworlds;Collectionanalysisof Introduction togeographyI(Physical),II(Human-environment) Freshman, youwillstudyfoundationcoursescovering(i) In thefirsttwoyears,calledJuniorFreshmanandSenior The Freshmanyears offered in political science. ie/Political_Science/undergraduate/timetable.php Sophisters (fourth-yearstudents) ingeographyand modules/year4 toviewthecurrentcoursesoffered forSenior their fourthyear. Seewww.tcd.ie/Geography/undergraduate/ by studentscontinuingtostudy politicsandgeographyequallyin dissertation willnotberequired,butmaytakenasanoption a researchthesisordissertationiscompulsory. The geography geography orpoliticalscienceastheirsolesubjectinthisyear subjects equallyoronesubjectalone.Forstudentstaking In theSeniorSophister(fourth)year, studentsmaytakeboth The SeniorSophisteryear to viewthecourses www.tcd.ie/Political_ www.tcd. for those

course requirementsofbothdepartments. opportunities isdependentupontheexchangefulfilling Netherlands, Sweden,PolandorSpain.Participatinginthese third yearstudyingabroadintheUnitedKingdom,France, There areopportunitiesforstudentstospendallorpartofthe Tel: +35318961651 www.tcd.ie/Political_Science/undergraduate/index.php Tel: +35318961576 www.tcd.ie/Political_Science/undergraduate/polscigeog.php environmental policymaking,andteachinghighereducation. to governmentsandindustry, thestudyandpracticeof risk assessment,thesupplyofenvironmental-relatedadvice affairs, overseasassistance,resourcemanagementand Careers forgraduateslieinfieldssuchaspublicandEuropean assessment andformalexamination. Courses areexaminedbyacombinationofcontinuous Study abroad Further information Career opportunities Assessment

Arts, Humanities and Social Sciences 85

Introduction to psychology Social psychology Perception History of psychology Psychological disorder Developmental psychology Cognition Fundamentals of neuroscience and behaviour Evolutionary psychology Personality and individual differences Course overview Course

n n n n n n n n n n will also be given the opportunity to take module(s) from You the Broad Curriculum options (see page 13). Research methods, statistics and laboratory practicals Modules in research methods and statistical analysis, and in laboratory practicals are provided in the Freshman years. research These will enable you to understand the different methodologies (qualitative and quantitative) upon which psychology is based and will prepare you for planning, conducting and communicating your own research. Some of the practicals relate specifically to the foundation courses and provide hands-on experience of carrying out research in different Other practicals concentrate on statistical areas of psychology. description and analysis and key research-related skills, such as literature searching. The course is designed to develop a wide knowledge of a wide knowledge is designed to develop The course of and research methods principles, theories the concepts, and skills of analysis psychology; to develop contemporary statistical description and evaluation,synthesis, research design, computer use; to provide practice in the problem-solving and and assessment of research and design, execution, reporting in group work, communication and to develop competence is This preparation self-assessment. presentation skills and a high level of competence in scholarship designed to cultivate the successful graduate to proceed and research, enabling postgraduate work, professional training directly to advanced The Freshman years second) years of The Junior and Senior Freshman (first and provide a broad TSM programmes both the single honor and work is built in foundation on which more advanced course modules in the Sophister (third and fourth) years. In addition, to develop their methodology and statistics enable students in academic Training research skills in a systematic fashion. build the skills skills is also provided which enable you to of scepticism required to write essays, to develop an attitude or a productive career. honor students spend approximately During lecture term, single TSM students) receiving 10-12 hours per week (5-6 hours for practicals. tuition such as lectures, seminars and laboratory and to develop independent, critical thinking. modules As a Freshman student, you will take foundation-level in a range of areas such as:

TR001 (TSM) 17 570 See note on page 28 TR006 31 545* B.A. TR006 – Psychology is a single honor course where TR006 – Psychology exclusively for four years. psychology is read almost may be combined with one TR001 (TSM) – Psychology two-subject moderatorship (TSM) other subject within the TSM is a joint honor programme. Both programme. studied for three years and one subjects are normally honors degree An subject only is studied in the fourth year. is awarded in both subjects. see page 92. For subjects that combine with Psychology follow the same courses. TSM students Single honor and TSM students cover all the principal areas while However, the workload is less extensive than that of of psychology, the single honor programme. TSM points: COURSE CODES: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE Is this the right course for you? What is Psychology? Psychology Psychology is a rigorous, fascinating and demanding field of the life sciences. If you are interested in the factors influencing as individuals and in human thinking, feeling and behaviour, The School of Psychology groups, you will enjoy this course. is committed to excellence in education and training at all a knowledge base and a set of skills levels, and aims to offer that not only equip students for the many careers that exist in but also prepare students intellectually for other psychology, careers. Psychology is a branch of science that demands clear, rigorous thinking, numeracy and the ability to define, rigorous thinking, numeracy and the clear, There are five thematic areas in psychology: Biological, There are five thematic areas in psychology: differences, individual and Personality Developmental, Cognitive, and Social psychology. Psychology is the scientific study of human behaviour and Psychology is the scientific study of human Although classified as an arts course, mental processes. science course Psychology has many of the features of a analysis of data – practical work, statistical description and of the human and courses on the underlying physiology These are in addition to the more familiar brain, for instance. perception, psychological topics such as human development, individual differences learning, motivation, cognitive processes, and social psychology. study and solve problems in complex, changing settings. Psychology educates and trains students to be aware of the factors influencing human thinking, feeling and behaving, as individuals and in groups. Such abilities are highly transferable spheres of life. Psychology is also an applied to many different science that deals with how people act and behave in the real world. It provides support for families in their social life and work, though clinical and counselling interventions. 86 Arts, Humanities and Social Sciences while challenging,isoneofthemostrewardingpartscourse. work, givingyouallthebenefitsandsupportofanactiveaccessibleresearchgroup.Manystudentsreportthatthisproject, supervision ofamemberstaff. Typically, ownresearch thetopicyouchoosetoinvestigatewillcoincidewithyoursupervisor’s In theSeniorSophister(fourth)yearalargepartofyourworkloadinvolvescarryingoutan research givesyouafirst-handaccountoftheprocess. and ofpresentingpsychologicalresearch. A seriesofseminarsintheJuniorSophisteryearwhichstaff talkdirectlyabouttheirown issue. This willgiveyouexperienceofworkingasateammember, ofworkingwitharangeresearchmethodologies inpsychology, As aJuniorSophister(third)yearstudentyouwillcarryoutgroupresearchprojectonanimportantcommunity-basedpsychological The followingtableshowsthekindofmoduleswhichareoffered withineachoftheseareas: On completionoftheSophisteryears,studentsmusthavetakenatleastonemodulefromeachfivespecifiedthematicareas. also takeadditionalmodulesinresearchmethodsandstatistics. make decisionsaboutyourfuturecareer, ifitistobeinpsychology. Singlehonorstudentsand TSM studentsmajoringinPsychology various branchesofpsychologyandthedifferent waysinwhichresearchiscarriedout. The optionsyouselectmayalsohelpto will choosemodulesfromaseriesofadvancedoptions. These optionalmoduleswillallowyoutogainadeeper understandingofthe have theopportunitytodeveloptheseintereststhroughoutSophisteryears.Inadditionanumberofcoreadvancedmodules,you By theJuniorSophister(third)yearyouwillhaveidentifiedareaswithinpsychologythatareofparticularinteresttoand The Sophisteryears made forstudents tostudy. several Europeanuniversitieswhere arrangementshavebeen were examinedhere. This Schoolhasbilateralagreementswith (i.e. foreign)institutionandisaccepted by TCD asifstudents charges tobepaidabroad. Assessment iscarried outinthehost provided bytheEUErasmusfund. There arenobasiccourse with travel,andwhereappropriate,somesubsistencefunding academic year)incertainotherEuropeanpsychologyschools, study foroneormoreterms(studentsusuallygoawhole Second andthird-yearundergraduatesareeligibletoapply submit areportofyourresearchproject. continuous assessmentisused.Inyourfinalyear, youwillalso A combinationofend-of-yearwrittenexaminationsand n n n n DEVELOPMENTAL n n n n SOCIAL n n n n BIOLOGICAL

Study abroad Assessment Applied issues in developmental psychology indevelopmental Applied issues languagedisorders Language and Debates inchildpsychology familycontexts inchanging Child development criminalbehaviour Psychology of psychology Organisational The socialself: Theory andmeasurement Culture andhealth neuropsychology Clinical andexperimental Memory, thebrain synapticplasticityand Behavioural neuroscience disorders andneurological Neuropsychiatric n n n n n PERSONALITY AND INDIVIDUAL DIFFERENCES n n n n COGNITIVE

will beprovidedbytheSchoolduring thecourseofyourdegree. teaching andrecruitment.Seminars aboutcareerdevelopment advertising andaccountancy, tojournalism,broadcastmedia, many professions,rangingfrom management,marketing, developed duringthecoursehaveallowedstudentstoenter human behaviourandexperiencethewiderangeofskills Ph.D. degrees.However, theadvancedunderstandingof Applied behaviouranalysisaswellresearchM.Sc.and analysis andClinicalsupervision,apostgraduatediplomain Masters coursesin Applied psychology, Applied behaviour doctorates inClinicalpsychologyandCounsellingpsychology, a rangeofpostgraduateprogrammesincludingprofessional areas relatedtopsychology. The SchoolofPsychologyoffers psychology throughprofessionaltrainingorhighereducationin Many psychologygraduatesproceedtoacareerinprofessional Health psychology Human sexuality Embodiment differencesAdvanced individual Clinical cases ofperceptionthroughoutthelifespan Development cognition Cross-modal imagination Creativity and reasoning Rationality and Career opportunities independent researchprojectunderthe

Arts, Humanities and Social Sciences 87 TR084 45 465 B.S.S. COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE Garda Vetting: to undergo Garda vetting. Students will be required details. See page 27 for further Is this the right course for you? Is this the right course for Course content Social studies (social work) studies Social Course overview Social studies is the right course for you if you know you want Social studies is the right course for you if social work is the to work in one of the caring professions, think you have the personal one closest to your interests, and believe line of work. Potential qualities and motivation necessary for this workers do before applicants are advised to find out what social they apply. This course introduces you to a wide range of social science and then increases subjects in the Junior Freshman (first) year, the number of social work subjects in the following three years. and draw on your methods are varied and interactive Teaching personal and practice experience. The Freshman years Junior Freshman (first year) subjects include introductions to economic sociology, social policy, social work, psychology, policy and political science. Optional courses in either French there or German are also available (see page 13). In first year, are approximately 12-14 hours in lectures, 3-4 hours in tutorial classes and several hours in the library each week. If you have had no relevant practice experience before starting the degree, we ask you to do 30 hours (2-3 hours per week) volunteer work during first year to build your confidence and help you to apply what you are learning to a real-world situation. This four-year programme is the only degree in Ireland that This four-year programme is the only degree to a social work takes students straight from school through applicants,qualification. It also provides places for mature-student international Access Programme and Trinity students on the student body. students. It aims to recruit a very diverse you the advantage of achieving an honors This degree offers also recognised as a degree in social studies (B.S.S.) which is national social work professional social work qualification by the an intensive programme which CORU. It is registration agency, proactive social worker aims to help you become a reflective and a broad range of who will make a significant contribution across voluntary and community services. statutory,

www.psychology.tcd.ie , particularly in the third and , particularly in the third of Psychology collaborates with a number of other collaborates with of Psychology Research Centre, Children’s disciplines through the Aerospace Psychology and the Neuroscience Institute campus). College’s Trinity on based (all Group Research involved actively become to encouraged are Students in our ongoing research See fourth years of College. As well as offering high-quality teaching, the School offering As well as

n Further information Psychology degree and Did you know? Did you professional qualifications professional Progression into the profession of psychology, however, requires however, Progression into the profession of psychology, example, clinical further training at postgraduate level. For for 3 years, health and counselling psychology typically lasts for 1 year. psychology for 2 years and occupational psychology of the society. www.psychology.tcd.ie + 353 1 896 1886 Tel: for only three years) are not eligible for graduate membership for only three years) are not eligible for graduate The single honor degree and the TSM degree (where the The single honor degree and the graduate for eligibility confer both Psychology) in majors student TSM of Ireland. membership of the Psychological Society subject (studied students for whom Psychology is the minor 88 Arts, Humanities and Social Sciences year on. who meetsyouregularlyandvisitsonplacementfromthird your professionaldevelopmentbyanindividualsocialworktutor (e.g. Britain,North America, South Africa). You aresupportedin are interestedingainingrelevantexperienceanothercountry (but notobligatory)withinthecoursestructureforthosewho time intheSophisteryears.Overseasplacementsarepossible summer vacationsintheFreshmanyearsandmostlyterm time (215days)overthefouryearsandtakeplaceduring projects. They accountforapproximately50%ofyourcourse centres, probationservice,andcommunitydevelopment care teams,hospitalsocialworkdepartments,childandfamily are arrangedinsettingssuchashealthservicecommunity and knowledgethatyouhaveacquiredinCollege.Placements experience andanopportunitytoapplydeveloptheskills practitioner. These placementsprovideyouwithpractice social serviceagencyunderthesupervisionofanexperienced In eachofthefouryearsyouwillhavea examinations andplacementreports. Assessment includesessays,casestudies,projects, n n n n n n n n include: Junior andSeniorSophister(thirdfourth)yearsubjects The Sophisteryears a BroadCurriculummoduleinthisyear(seepage13). Freshman studentscanalsoavailoftheopportunitytotake elective coursefromsociology, politics,oreconomics.Senior you caneithercontinueyourlanguagestudiesorchooseone field tripstorelevantorganisationsandservices.Inaddition, psychology andsocialresearch. The socialworkcoursesinvolve work theoryandpractice,lawforsocialworkers,policy, In theSeniorFreshman(second)year, coresubjectsaresocial

Professional practice Assessment skills andpracticeworkshops Social work theory and practice, includingcounselling andpractice, Social worktheory law Human rights Groupwork Equality issues Mental health Sociology Social policy carestudies Family andchild placement inadifferent

Tel: +35318962001 E-mail: [email protected] www.socialwork-socialpolicy.tcd.ie can moveintomanagement,researchortraining. professional developmentthroughpostgraduatecoursesand NGO projectwork. As asocialworker, youcancontinueyour allows youtomoveintopolicy, media,researchassistantor countries. You alsohaveagoodsocialsciencedegreewhich CORU. Your qualificationwillalsoberecognisedinmanyother worker withtheHealthandSocialCareProfessionalsCouncil, eligible toapplyregisterasaprofessionallyqualifiedsocial As asocialstudiesgraduateof Trinity CollegeDublin,youare Further information Did youknow? Career opportunities n n n The B.S.S.degreeisuniquein

offering support ofboth student theindividual each offering inpractice- student fourplacements each offering routetosocialwork qualification adirect related settings for school-leaversintheRepublicofIreland a Collegetutorandsocialwork

Arts, Humanities and Social Sciences 89

Ageing and dementiaAgeing and Comparative welfare states Crime and social policy Economic sociology of Europe countriesEconomics of less developed European public policy European Union politics Families and family policy Gender and popular culture Government and of the politics United States Irish politics inequality and redistribution Poverty, Public interest law Researching society Social theory Assessment Career opportunities Postgraduate opportunities

(third and fourth) years typically include: years typically (third and fourth) combination of continuous assessment, class presentations A and written examinations is generally used. the area of social andThe range of employment opportunities in The B.A. in Sociology public policy is expanding all the time. and social policy is a particularly relevant degree for those interested in pursuing a career in the formulation of policy in the voluntary/non-profit and development community service, public sectors. Graduates of the programme are also employed as social researchers, policy analysts and journalists. The course provides a solid foundation for specialist postgraduate courses, in the areas of social research, social policy and social work. The Sophister years The Sophister in the Sophister of subjects available The choice n n n n n n n n n n n n n n n with Ireland and with Many of these modules deal specifically year you will research and write In the final European society. a dissertation on a topic of your choice.

TR083 28 445 B.A. COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE See also: page 92 TSM, TR001: Course content Is this course right for you? What is Sociology and social and social What is Sociology Sociology and social policy and Sociology policy? In the Freshman years, students take six modules, with typically two lectures and one tutorial per week for each module. In the first and second years you will take introductory modules political science, social policy and sociology. in economic policy, and psychology along Optional modules include statistics, law, with a range of language modules (French, German, Russian, The Senior Freshman (second) year places greater and Polish). emphasis on social policy and sociology modules, as well as also have the You the introduction to social research methods. choice of taking a complementary subject, such as psychology, or you may continue your language study. The Freshman years The subjects studied include general social science disciplines The subjects studied include general social areas such such as economics and politics, and specialist criminology and the extent of welfare policy, as family policy, The Freshman (first two) years are more poverty and inequality. and Sophister (third while the nature, general and foundational in fourth) years will focus more specifically on sociology and social strength of the course is that it explores these issues A policy. methods include Teaching in a genuinely comparative context. lectures, seminars and group project work. This course demands both academic and vocational qualities. This course demands both academic and It is particularly relevant to students intending to pursue a career It is particularly relevant to students intending management in research, social policy analysis and evaluation, voluntary and and planning within the social services, both statutory. Sociology and social policy combines the study of social theory, study of social theory, Sociology and social policy combines the The programme aims to give social policy and social research. study of society and you a thorough training in the systematic countries. different the social and economic policies utilised in developed both At the end of your four years you should have specific expertise in a general sociological understanding and various contemporary policy issues. 90 Arts, Humanities and Social Sciences E-mail: Tel: +35318962001 www.socialwork-socialpolicy.tcd.ie Student Profile Further information Did youknow? policy.” discover theirfortewithinthefieldsofSociologyandsocial the focusisnarrowedtoallowstudentsspecialiseand year dissertation. Throughout thefouryearsofdegree, working towardsandshapingtheirchoicesforthefinal interests withinandacrossindividualsubjects–ultimately approach tothelearningprocessandfollowtheirown course enableseachstudenttotakeaverypersonal world, neverfailingtoremainrelevant. The scopeofthe apply ittowhatyouseearoundinsocietyandthe The coursechallengesyoutotakeexistingtheoryand as modulesonstatistics(SPSS). qualitative andquantitativeresearchmethods,aswell to conductresearch. This involvesmodulescovering An importantpartofthedegreeisteachingstudentshow comparative perspectiveintheSophister(finaltwo)years. social policiesintheFreshmen(firsttwo)years,toawider The socialpolicycoursesrangefromanoverviewofIrish structures ofhowcountriesarerun. politics, society, andlearningabouttheunderlying course foranyonewhoisinterestedincurrentaffairs/ science, Lawandlanguages.Iwouldrecommendthis wide rangeofsubjectchoiceswithinEconomics,Political of Sociologyandsocialpolicy, studentsareoffered a it ishighlyinter-disciplinary;alongsidethecoresubjects “I chosethedegreeinSociology&socialpolicybecause Aoife Ryan-Christensen n n

In addition, one or more School membershave ormoreSchool In addition,one focussingon Research centres Ageing, Children, Social work. Immigration; Loneparents;Historyofsocialpolicy; security; Housingandhomelessness;Familypolicy; areas: Crimeandsocialpolicy;Poverty research interestsandexpertiseinthefollowing Policy. situated withintheSchoolofSocialWork andSocial Intellectual disability, andDrugalcoholpolicyare [email protected]

and www.tcd.ie/Sociology

the relationship between scienceandreligion, ethics, political North Africa andtheMiddleEast,literature, philosophy, theology, and Romanhistory, themedievalandmodernperiodsinEurope, Hinduism andotherworldreligions, aswellancientGreek following topics:Judaism,Islam, Christianity, Buddhism, and broadartsdegreeifyouare interestedinsomeofthe You willenjoythiscourseandsucceedingaininganexcellent and opportunitiesofgeneticengineering? as, howcantheethicalstancesofreligionsaffect thediscoveries include theethicalchallengesofscientificadvancements,such multi-cultural Ireland.Otherissueswhichdemandourattention and Trinity College’s coursealsotakes up thechallengeofa syllabus inreligionseriouslyattemptstoprepareforthisfuture challenges andopportunitieslie? The newLeavingCertificate What istheMuslimperspectiveonintegration?Wherewill will newgenerationsofIrishMuslimscontributetosociety? about integrationandtoleranceforamulti-culturalsociety?How Middle Eastreported?WhatlessonscantheHolocaustteachus is Islamdiscussedinthemedia?Howoftenareevents ever changingIrelandisself-evident.Howmanytimesaweek and Western civilisation. The relevanceofthecoursetoan how thesereligionshaveshapedEuropean,MiddleEastern development upuntilthemodernperiod,whereweexamine these religionscameintobeingandcontinuetoexaminetheir and Hinduism.We beginwiththeirorigins–askinghowandwhy Christianity andIslam,worldreligionssuchasBuddhism This artscourseoffers youtheopportunitytostudyJudaism, World religionsandtheology Is thistherightcourseforyou? Course overview TR001: JewishandIslamiccivilisations,page109 See also: students, however, islessextensive. subjects. The rangeofcoursesundertakenby TSM Single honorand TSM studentsfollowthesameprincipal theology seepage92. For subjectsthatcombinewithWorld religionsand subjects. programme. An honorsdegreeisawardedinboth moderatorship (TSM)programme. TSM isajointhonor combined withoneothersubjectwithinthetwo-subject TR001 –World religionsandtheology(TSM)mustbe exclusively forfouryears. course whereWorld religionsandtheologyisreadalmost TR008 –World religionsandtheologyisasinglehonor TSM points: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODES: See noteonpage28 B.A. 340 29 TR008 415-570 24 TR001 (TSM) Arts, Humanities and Social Sciences 91

. Further information Assessment Study abroad Career opportunities www.tcd.ie/Religions_Theology +353 1 896 1297 Tel: lecture theatre and libraries, as central to this course are central to this course and libraries, as lecture theatre Poland. Israel, Berlin and students have visited For example, www.tcd.ie/Religions_Theology Students do not just encounter religious cultures in the religious cultures in the not just encounter Students do and cultural destinations. sacred sites visits to museums, six and ten essays over the course Students write between students) TSM they sit four (or two for In addition of the year. of the year. examinations at the end you the opportunity offers student exchange programme A Leuven in Belgium, to spend up to a year at the University of College, the University of Glasgow in Scotland or Heythrop made available to London. Recently scholarships have been participating in enable students to spend a summer in Israel archaeological digs. and degree arts an is theology and religions World in course The College. Trinity in shares many features of other arts degrees knowledge of the cultures, values and histories of different A for many types societies in the global community is an asset religions and theology graduate of careers. Students of World opportunities with an understanding of the challenges and This understanding which multi-cultural societies present. careers in media, is of particular value to those who pursue and health education, public policy making, human resources religions World in Graduates business. and law professions, care valued by potential and theology have skills which are highly same kinds of careers employers and our graduates pursue the these have included as other arts graduates. Over recent years careers in publishing, media, business, education, archaeology, Advisory Careers College’s Trinity tourism, law and psychology. Service recently surveyed employers about what they looked for in arts graduates and top of the list came: enthusiasm for the position, personal qualities and transferable skills such as good oral communication, written communication, team work and problem solving. Students of religions have ample opportunity to develop all of these skills within a department which is relatively small and very student centred. For further information on Theology see religions and careers for graduates in World

Ireland of Buddhism, Hinduism and other world faiths to Christianity world and human life Jesus Ethics: philosophical and theological Religious identities in modern film and literature The Reformation and the Enlightenment and in Europe Jewish identity in the modern world Christologies (ways of understanding Jesus) Christianity and world religions: the challenge of the claims Jews under empire:the Romans from the Babylonians to Early Christianity and its literature (the Gospels) Judaism and Islam in the medieval world Jewish and Christian identity and interaction in the Roman Medical ethics, including issues cloning such as human The challenge of world religions Issues in modern Islam Arguments for and against the existence of God Judaism since the Holocaust The relation between modern science belief and religious The early history of Israel and Judaism The world of the Bible How Christianity came to Europe Introduction to the problems of recovering the historical Introduction to Christian thinking world about God, the Introduction to Jewish civilisation Introduction to (Buddhism, world religions Hinduism, Introduction to Islamic civilisation African Christianities) Course content

From the second year on, you may choose from a wide range From the second year on, you may choose you have of courses depending on the individual interests courses Students may choose discovered in your first year. on subjects such as: n n n n n n n n Students have a wide variety of subject choices in the Junior n n In addition you may choose to study Hebrew, Greek or Arabic. Greek or In addition you may choose to study Hebrew, n a Broad Curriculum Students in the second year may substitute year courses. course (see page 13) for one of these half n n These include: and Senior Sophister (third and fourth) years. n n n n n n n n n n In your first year you will study a range of introductory courses: In your first year you n and equality issues. Trinity College’s Department of World of World Department College’s Trinity issues. and equality non- in Ireland a unique students offers Theology Religions and affiliated religions: it is not context for studying denominational that you and we do not presume or religious body to any church the subject. knowledge of have any previous 92 Arts, Humanities and Social Sciences of pointspercombination). (see www.tcd.ie/Admissions/undergraduate forafulllisting course code(seep.29)anddifferent minimumentrypoints Each combinationoftwosubjectshasadif overall workloadissimilartothatofasinglehonorsdegree. degree level. subjects (fromalistof25,seebelow)andstudybothtohonors TSM isajointhonorsdegreethatallowsstudentstochoosetwo Two-Subject Moderatorship(TSM) Ancient historyandarchaeology Jewish andIslamiccivilisations World religions andtheology History ofart&architecture The twosubjectsaretaughtseparatelyandthe Classical civilisation English literature Drama studies Mathematics Modern Irish Modern Film studies Psychology Geography Economics Philosophy Sociology Early Irish Spanish German Russian History French Greek Music Italian Latin B B B B B B B B B B B B B B B B Ancient history and archaeology B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B B BB B

Classical civilisation ferent CAO B B B BB B B B B B B BB B B B B BBB B B B BB B B BB B Drama studies Early Irish * * * * * * * B B B Economics B B B B B B B B B B B B B B B English literature B B B B B B BB B B B Film studies BB B B B B B B B B B B B BBBB B B B B B BBB French * * * * * B Geography * * * BB B B B B German B B B B B B B B B B B B B B B B B B B B B B B B B B B subjects isnotpermitted. table belowmeansthatthecorrespondingcombinationof The absenceofaletterornumberfromgridpositioninthe (both subjectsarestudiedequallyforfouryears)orpatternB. Greek * B: A: In somecases(denotedby subject onlyisstudiedinthefourthandfinalyear(patternB). TSM. Usuallybothsubjectsarestudiedforthreeyearsandone The gridbelowshowsthepossiblecombinationsofsubjectsfor : B B B B B BB B B B B B B BB Possible combinations Both subjectsarestudiedforthreeyearsandonlyone Both subjectsarestudiedforfouryears May be studied underpattern May bestudied A orB. History subject inthefourthyear. B B B B B B B B History of art & architecture BBBBB B B B B B B B B B B Italian * BBB B B B Jewish and Islamic civilisations BBB B BB B B B BB BB BBB B Latin * * * B B Mathematics BBBBBB BB B B B Modern Irish B B B B B B B Music * * * * BB B B B BBBBB B B B B B B B B B *

Philosophy ) studentsmaychoosepattern A B B B B B B Psychology B B B B B B B B B B B B B Russian * * B B B BBBBBB Soc B B BBBB BBBBBBBB B B B iology Spanish * B B B B B B B B B B B B B B B B World religions and theology

Arts, Humanities and Social Sciences 93

– an introductory survey of the – an introductory survey Greek and Roman history Archaic age to the from the Greek Greek and Roman world as The course covers topics such early Roman Empire. invention of democracy, Athenian the politics and power, of Rome as a major the emergence Alexander, the rise of war and conflict. colonisation, imperial power, and architecture – an introductory Greek and Roman art and major artistic achievements survey of the development art The course places and painting. in architecture, sculpture social and political context; it focuses and architecture in its use of narrative and mythology in art, on themes such as the forms urbanisation, and on the development of architectural such as temples, theatres and Roman baths. and archaeology – Sources and evidence in history theories and methodologies materials, the to introduction an This course employed by historians and archaeologists. analytical is specially designed to develop the practical, The evidence. and critical skills required to assess ancient which focus course mixes lectures with smaller seminars on discussion and hands-on work with artefacts.

The second and third years the opportunity Courses in the second and third years offer the history and to focus on specific themes and periods in a deeper awareness archaeology of the Mediterranean, develop discuss key themes of relevance to both of methods and theory, with artefacts. Over the ancient and modern world, and to work archaeology and the two years you will study topics in: Greek Roman archaeology Age archaeology, Aegean Bronze history, and History and archaeology of Roman Britain. and history, work or an There are also options to do practical archaeological approved study tour to the Mediterranean in place of a taught by lectures and All the courses are taught course in these years. small-group seminars. In the Greek archaeology and history courses you explore major themes such as colonisation, empire, the emergence of literacy, religion, and social issues such as war and ideology, slavery, These courses range in time from gender and death. sexuality, Athens and the development of the Greek city-states, such as Sparta, to the Hellenistic kingdoms founded in the wake of Age course takes you back in time to the The Bronze Alexander. early palatial civilisations of the Minoans and Mycenaeans. Augustus from history imperial study will you history Roman In to the emperor Constantine, examining the period from a number of perspectives, from the emperors themselves to the lowliest of slaves, and ranging from imperial politics and military to economics and social concerns such as religion and strategy, rebellion. Roman archaeology takes you the length and breadth of the Roman world, exploring cities and urban life, frontiers and In the Roman Britain trade, transport and technology. the army, course you will assess the impact of Roman culture on Britain as a remote Roman province and consider issues such as imperialism, acculturation and identity. The Junior Freshman year Freshman The Junior courses – you will take three Freshman (first) year In the Junior of classes in the six hours There are approximately see below. year. Junior Freshman n n n TR001 (TSM) 23 400*-535* B.A. See note on page 28 See also: page 61 TR003: History, 63 TR012: History and political science, page Ancient and medieval history and culture, page 36 TR028: COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE TSM points: cannot be studied as a Ancient history and archaeology single honor course. with one other subject within the two- It must be combined TSM is a joint (TSM) programme. subject moderatorship studied for honor programme. Both subjects are normally year. fourth the in studied is only subject one and years three An honors degree is awarded in both subjects. Ancient history and For subjects that combine with archaeology see page 92. Course content Is this the right course for you? Course overview Ancient history and and history Ancient archaeology Over your four years you will develop a broad understanding of moving the ancient world through its history and archaeology, to more focused from introductory courses in the first year, thematic topics in the second and third years, and choosing from The course is a range of specialised options in your final year. taught through a mixture of lectures, practical classes and small- group seminars, which encourage lively discussion and the development of independent thinking. You will enjoy this course if you are interested in studying You the history and culture of the Greeks and Romans – their achievements and their profound influence on the modern world – through the complementary study of history and archaeology. Ancient history and archaeology are both concerned with Ancient history and archaeology are both experience in understanding social, political and cultural you the opportunity to range This course offers the past. Greek will study the You across these two broad disciplines. and literary and Roman worlds by working with historical of ancient sites anddocuments alongside the material remains relationships also explore Greek and Roman You artefacts. with neighbouring cultures, such as Egypt and the Near East, There are opportunities within the Mediterranean and beyond. to participate in archaeological fieldwork and in study tours and no All material is studied in translation to classical sites. knowledge of Greek or Latin is required. 94 Arts, Humanities and Social Sciences in greatdepthanareathatparticularlyinterestsyou. independent ideasandacquirecriticalskillswhileinvestigating an opportunitytodoresearchwhichwillallowyoudevelop You willalsowriteathesisonsubjectofyourchoice. This is Mediterranean; Anthropology andtheGreeks. in theGreekandRomanworlds;Goddessesofancient Jews of Palestine; Ancient Cyprus; Entertainment and spectacle the ancientworld; The cityofRome; Athens and Attica; The a rangeonoffer. Coursesoffered recentlyincludeEthnicityin final yearyouwillbeabletochoosetwospecialsubjectsfrom If youdecidetostudyancienthistoryandarchaeologyinthe The SeniorSophisteryear is usedandathesiswrittenin thefinalyear. projects, artefactstudiesandshort commentariesontexts) assessment (e.g.essays,seminar presentationsandteam A combinationofend-of-yearexamination andcontinuous Assessment

Ireland orabroad. in historyorarchaeologybeginningwithpostgraduatestudy year someofourgraduatesalsoopttopursuearesearchcareer museum work,business,accountancyandsocialwork.Each teaching andhighereducationpolicy, publishing,heritageand archaeology, heritageandmuseumwork,artrestoration, Recent graduateshaveenteredmanyfieldsincluding Freshman (second)yearabroad. This allowsstudentstheoptionofspendingtheirSenior programme with universities in France, Switzerland and Cyprus. abroad, includingactiveparticipationintheErasmusexchange Trinity Collegehasstronglinkswithmany Classics departments Tel: +35318961208 E-mail: [email protected] www.tcd.ie/Classics Did youknow? Career opportunities Study abroad Further information Graduate Profile n their subjectsandpassedontous.” professionalism andenthusiasmdisplayedbythestaff for this yearwithinourundergraduatedegreebutalsotothe give creditforthisnotonlytotheopportunityofhaving ever thoughtwhenleavingsecondaryschool.Iwould personal researchforthethesismorefunthanIprobably based aroundseminarsinsteadoflecturesandmyown of learningresearchtechniquesIhavefoundthisyear been withoutdoubtmyfavouriteyear;afterthreeyears year forbothmycoursesandthesis.Fourthhas me forthemorethoroughresearchnecessaryinfourth my ownresearch,inhindsighttheycertainlyprepared were someweeksImaynothaveenjoyedhavingtodo to sitanddiscussideasmoreinformally, andwhilethere second andthirdyearparticularlyenjoyableforbeingable daily lifeoftheancientworld.Ifoundseminarsin understanding ofnotonlythelargerhistorybutalso archaeology, allowingus,asstudents,tohaveafuller a goodbalancebetweentheliterarysourcesand found thecoursecontentof AHA programmetohave department seemedtobeexactlywhatIwanted.have Trinity College’s campusandthecoursesoffered bythe particularly attractivetomebecauseIhavealwaysadored “The DepartmentofClassicsin Trinity Collegewas Aoife Condit

a coursein Ancient historyandarchaeology. Trinity inIrelandtooffer istheonlyuniversity College , postgraduateinClassics, TCD

Arts, Humanities and Social Sciences 95

– an introduction to the major Mythology and religion Mythology and using both literary myths and religions of the classical world also explores theories of The course and material evidence. and includes myth and the functions of myth within society, critical skills seminars designed to develop analytical and relevant to the study of literature. survey of Roman history – an introductory Greek and Archaic age the Greek and Roman world from the Greek topics such The course covers Roman Empire. to the early the conquests democracy, Athenian as politics and power, of Rome as a major imperial the emergence Alexander, of and conflict. colonisation, war power, and architecture – an introduction Greek and Roman art major artistic achievements in to the development and art The course places and painting. architecture, sculpture social and political context; it focuses and architecture in its use of narrative and mythology in on themes such as the the development of architectural forms art, urbanisation, and and Roman baths. such as temples, theatres Assessment on classical culture. There are approximately six hours of are approximately There culture. on classical year. the Junior Freshman classes in A combination of end-of-year examination and continuous combination of end-of-year examination and A assessment (e.g. essays, seminar presentations and short commentaries on texts), and a thesis in the final year. The Senior Sophister year If you decide to study Classical civilisation in the final year you will be able to choose two special subjects from a range on offer. recently include Ethnicity in the ancient world; Courses offered The Jews of Palestine; Attica; Athens and The city of Rome; Ancient Cyprus; Entertainment and spectacle in the Greek and Roman worlds; Goddesses of the ancient Mediterranean; Anthropology and the Greeks. This is will also write a thesis on a subject of your choice. You an opportunity to do research which will allow you to develop independent ideas and acquire critical skills while investigating in great depth an area that particularly interests you. n n n The second and third years or five course which In each of these two years you will take four Virgil, Herodotus), genres focus on specific authors (e.g. Homer, philosophy) or themes (e.g. gender and comedy, (e.g. tragedy, identity and self-image). In these courses you will sexuality, as gateways into analyse ancient texts both as literature and relevance to both culture and thought, discuss key themes of your analysis of texts the ancient and modern world, and refine more specialised in their literary and cultural context through by lectures All the courses are taught skills and methodologies. and small-group seminars. example, how the Greeks and Romans saw will learn, for You to make sense themselves and other cultures; how they tried of the world around them through philosophy and religion; how ethnicity and identity, they thought about politics and ideology, life and death.

TR001 (TSM) 29 410-535* B.A. See note on page 28 COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE See also: page 93 Ancient history and archaeology, (TSM subjects): Greek, page 104 Latin, page 110 TR021: Classics, page 44 TSM points: cannot be studied as a single honor Classical civilisation course. with one other subject within the two- It must be combined TSM is a joint (TSM) programme. subject moderatorship subjects are normally studied for honor programme. Both subject only is studied in the fourth three years and one year. An honors degree is awarded in both subjects. see For subjects that combine with Classical civilisation page 92. Course content Is this the right course for you? Course overview Classical civilisation Classical The Junior Freshman year In the Junior Freshman (first) year you will be introduced to the art, myth and religion, with a view critical study of ancient history, to acquiring a comprehensive and interdisciplinary perspective Over four years you will develop a broad understanding of the from move will You literature. its through primarily world, classical authors, specific of study the to year first the in courses introductory genres and themes in the second and third years. In your final All year you will choose from a range of specialised options. courses are taught by lectures and small-group seminars. If you enjoy literature; if you want to acquire an understanding of the past and its influence; if you would like to engage with the poetic imagination, depth of thought and historical mythology, value of two civilisations that shaped the western world, this is the course for you. The study of Classical civilisation is concerned with the literatureThe study of Classical civilisation is concerned examination the Through Rome. and Greece ancient of culture and the analysis of and contextualisation of literary works and you will develop the main aspects of ancient history and art, and a critical a thorough knowledge of the classical world are studied All texts approach to textual and material culture. in translation and no knowledge of Greek or Latin is required. in translation and no knowledge of Greek 96 Arts, Humanities and Social Sciences teacher trainingandinternationalpeacestudies. study haveselectedcoursesrangingfromlawandmarketingto St. LazarePlayers.Studentswhooptedtoundertakefurther as SmurfitCommunications,BlackwellPublishingandtheGare entered. Recentgraduatesareworkingfor companies asdiverse and theatrearesomeofthemanyfieldsrecentgraduateshave Business, librarianship,museumwork,publishing,teaching Freshman (second)yearabroad. Cyprus. This allowsstudentstheoptionofspendingtheirSenior programme withuniversitiesinFrance,Switzerlandand abroad, includingactiveparticipationintheErasmusexchange Trinity Collegehasstronglinkswithmany Classics departments Tel: +35318961208 E-mail: [email protected] www.tcd.ie/Classics Graduate Profile Careers Study abroad Further information many ancienttheoriesandideasaretomoderndebates.” Western culture:youlearn toappreciatejusthowrelevant is thebeautyofstudyingClassicsasfoundation to thewayweapproachworldaroundustoday. That both groundedinancientconcernsandalsostillpertinent and satisfyingtothinkhardaboutcomplexissuesthatare own ideasandopinionstoourpeers.Itwaschallenging cutting-edge researchandtheopportunitytopresentour privilege ofstudyingwithlecturerswhowereimparting in alessformalseminarformat. This afforded usboththe areaofexpertise,andaregiven centre oneachlecturer’s Classes infourthyeartheDepartmentofClassics my projectintoasatisfyinglysubstantialpieceofwork. wiles togainpowerandinfluence),workingshaping case ImperialRomanwomenwhousedtheirfeminine about exploringanareaofmyownchoosing(in I wasfullyequippedwiththenecessaryskill-settoset thought andresearch.Butbythefinalyearofmydegree, year ortwotofullycomprehendtheideaofindependent the LeavingCertificateeducationsystem,itcantakea my Collegeexperience.ForIrishstudentscomingoutof Fourth yearinClassicalcivilisationwasthehighlightof glaring discrepenciesofHollywoodblockbusterscripts. just beingthepedantinaudiencewhoscoffs atthe to begainedfromthestudyofClassicalcivilisationthan the answertoallofthesequestions.Butthereisfarmore the literarycoursesin2ndand3rdyearwouldgiveyou and HistoryinthefirstyearofClassicalcivilisation, Lightening Thief bogus? The foundationcoursesinMyth Why istheentirepremiseofPercyJacksonand sunny dayatHydaspesasdepictedbyOliverStone? Thermopylae? Was Alexander actuallyinjuredona “Were therereallyonly300Spartansatthebattleof Kate Higgs we presentlyenjoy? better off withhighertaxesbutalsobettersocialservices than is theproperroleforgovernment intheeconomy?Would webe and educationservicesincome-support programmes?What governments trytoraisethefinanceneededpayforhealth still protectournaturalandphysicalenvironments?Howshould reduce poverty?Isitpossibletopursueeconomicgrowthand more thanothers,andwhatarethebestwaystotackle countries? Withincountries,whydosomepeopleearnsomuch at creatingemploymentorreducingunemploymentthanother inequalities? Whyaresomecountriessomuchmoresuccessful of internationaltradeandfinanceinexplainingtheseglobal high livingstandardsandgrowthrates?Whatistherole very lowgrowthrateswhileasmallnumberofcountriesenjoy are economicproblems.Whysomecountriespoorwith Many oftheproblemsthatdominateournewspaperheadlines Economics What isEconomics? further detailsseepage80. and eitheroneortwosubjectsinthefourthyear. For subjects inthesecondyear, 2subjectsinthethirdyear sociology, afteracommonfirst-yearstudentschoose3 Within Philosophy, politicalscience,economicsand For furtherdetailsseepage37. one ofbusinessstudies,politicalscienceorsociology. specialise ineconomicsortocombinewith 6 coursesinthesecondyearandthenproceedtoeither Within BESS,afteracommonfirst-yearstudentschoose and sociology(PPES: TR015) programme. programme orthePhilosophy, politicalscience,economics Business, economicandsocialstudies(BESS: TR081) Alternatively, Economicscanbestudiedthroughthe Economics. See page92foralistofsubjectsthatcombinewith is awardedinbothsubjects. subjects inthefinalyear. Ineithercase,anhonorsdegree or Sociologyhavetheadditionaloptionofstudyingboth in combinationwithGeography, German,Mathematics in thefourthyear. However, studentstakingEconomics studied forthreeyearsandonesubjectonlyis is ajointhonorprogramme.Bothsubjectsarenormally the two-subjectmoderatorship(TSM)programme. TSM course. Itmustbecombinedwithoneothersubjectwithin Economics (TSM)cannotbestudiedasasinglehonor GCSE Leaving Certificate Special EntryRequirements: TSM points: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODES:

OC3/HD3 Grade B See noteonpage28 B.A. 450-570 43 TR001 (TSM) Mathematics Mathematics

Arts, Humanities and Social Sciences 97 Department reflect its excellent record of research and publication, particularly in international macroeconomics, applied economics, economic and the history of economic thought. history, The courses and programmes offered by the The courses and programmes offered

n Study abroad Career opportunities Did you know? Assessment integrate analysis and policy; those intent on a business career intent on a business and policy; those integrate analysis for a package emphasising in industry can opt or a position while organisation; industrial and economics industrial in courses might or academic career to pursue a research those wishing courses. and analytical the more quantitative wish to choose (third) year students have Within the Junior Sophister of lectures and 2 hours of tutorials per approximately 6 hours the Senior Sophister (fourth) year, week in economics. Within 4 hours of lectures and 1 hour of students have approximately a economics. Students will, of course, have tutorials per week in of lectures and tutorials in their other somewhat similar amount economics Those students specialising exclusively in subject. hours of lectures and 2 hours of tutorials have approximately 8 Sophister year. per week in the Senior Students have the opportunity to spend some time in their Students have the opportunity to spend some Australia, France, third year studying in partner institutions in either an academic Belgium, Germany and the Netherlands for of outgoing year or for half an academic year; the majority students go abroad for half an academic year. About a third of graduates go on to further study either in Ireland economists have College’s Trinity or abroad. Over the years made distinguished careers all over the world in business, politics, the public service, and in finance, journalism, law, leading universities. All courses in the first three years are assessed by a All courses in the first three years are assessed or essays) and combination of continuous assessment (tests required are courses Fewer examination. end-of-year formal the time for more in the Senior Sophister year so as to facilitate component ofindependent work. Project work is a very important year; this project almost all courses within the Senior Sophister level of expertise work allows students to achieve a very high facilitates students in a number of specific areas and greatly addition, students when setting out on their career paths. In Senior Sophister specialising exclusively in economics in the on a chosen topic. year may choose to complete a dissertation Course content Is this the right course for you? Is this the right course for The Sophister years The great strength of the Sophister (third and fourth year) There is a wide range programme in economics is its flexibility. and, within the framework of either a single of courses on offer or joint honors degree, you can put together a package that best Those interested reflects your interests and future career goals. in banking, finance or accountancy can choose a finance- orientated set of options; those interested in a career in politics, journalism or the public sector will find a range of courses that Economics teaching in the Freshman (first two) years emphasises the understanding of the basic principles of economics and the acquisition of the quantitative skills in mathematics and statistics necessary for more in-depth study. students have approximately 7 In the Junior Freshman year, hours of lectures and 3 hours of tutorials per week in economics. In the Senior Freshman year students also study the main features, performance and associated policy issues of the Irish economy in the late 1990s and early 2000s. Students have approximately 6 hours of lectures and 3 hours of tutorials per week in economics. Students will, of course, have a somewhat similar amount of lectures and tutorials in their other subject. The Freshman years Economics at Trinity College appeals to students with a wide Trinity Economics at current economic range of interests. If you are interested in both national and international, in understanding how affairs, economic and socialgovernment action might be used to pursue poverty or goals such as lowering unemployment, reducing curriculum Economics the find will you World, Third the assisting and are considering stimulating. If you enjoy abstract thinking should also consider engineering or physics, for example, you Economics as a degree option. Economists aim to develop theories of human behaviour and Economists aim to develop summarised These theories are facts. test them against the that best explain the events we observe. in economic models work of an economist is collecting An important part of the economic phenomena – prices, and analysing data about to blend The art of the economist is employment, costs, etc. data and statistical techniques to arrive at a together theory, or to make policy new understanding of economic problems the welfare and recommendations that hopefully will improve living standards of our society. Any society has to address the problem of how and what to problem of how and has to address the Any society services and how the goods and its material survival, produce for among its population. should be distributed that are produced and and institutions behave explore how people Economists and and using goods producing, exchanging function when is to find mechanisms that main motivation services. Economists’ in the production and use of material goodsencourage efficiency at the same time producing a pattern of and resources, while society finds acceptable. income distribution that 98 Arts, Humanities and Social Sciences Tel: +35318961043 www.tcd.ie/Economics Further information Student Profile couldn’t beamoreinterestingtimetostudyeconomics.” With allthathasoccurredoverthelastfouryears,there of theCollegenewspapers. Economic Review,debatingintheHist,orwritingforone to offer, beitthroughwritingfor(orediting)theStudent advantage oftheuniquesocietycultureUniversityhas At Trinity, you’lldeveloplifelongfriendshipswhiletaking which canbeappliedtopublic,civic,orcommerciallife. prospect aseconomics. You willgainuniqueinsights There arefewsubjectswhichoffer aspromisingcareer theories andmethodsofeconomics. while gaininganindepthunderstandingofthecore (finance, internationaleconomics,policyissuesetc.), allow youdevelopspecificinterestsinthediscipline it atsecondaryschool. The finaltwoyearsofthedegree heart ofeconomics,sothereisnoneedtohavestudied Both firstandsecondyearintroducetheconceptsat commercial, leavingyouwithawellroundededucation. broad rangeofdisciplinesandideasbeyondthepurely (TR081), whereinfirstyearyouwillbeexposedtoa The mostcommonentryintoeconomicsisthroughBESS evidence. put forwardsoundargumentssupportedbyempirical and analyticalabilitytochallengetheconsensus, the wayyoulookatworld,givingconfidence whilst loweringtaxes.Studyingeconomicswillchange of allcreedspledgedtocontinueincreasingexpenditure a “softlanding”tothehousingbubble,whilepoliticians majority ofcommentatorsinthemediawerepromising “At thetimeIwasfillingoutmyCAOform,vast Barra Roantree (Final yearBESS)

and history. Hollywood cinema,Irishfilmstardom,andtheory fields andpublishwidelyonareassuchasEuropeancinemas, and asculturalpractice.Staff inFilmstudiesareexpertstheir students willgainawideknowledgeoffilmasart,industry, Through lectures,classdiscussionsandpracticalcourses, styles andtogainsomeexperienceofpracticalfilmmaking. students tosampleawiderangeoffilmmovementsand leading toanhonorsdegree. The fouryearsofthecourseallow Ireland’s firstspecialistundergraduateFilmstudiescourse Since 2003 Trinity CollegehaspioneeredtheRepublicof complete modules onscriptwritinganddigitalvideo production. and censorship,editing.In addition, Sophisterstudentswill experimental, andcultcinema, film theoryandcriticism,cinema genre studies,documentarytheory andpractice,avant-garde, cinemas, classicalandcontemporary Hollywoodcinema, Topics mayincludevariousnational cinemas,transnational students choosefromawiderangeofFilmstudiesoptions. European and world cinemas. In the Sophister (final two) years, film theoryandcriticismtoaverybroadrangeof American, day. In the Freshman (first two) years, you will be introduced to production andconsumptionfromthe1890stopresent Film studiescoversthehistoryandcriticalframeworkoffilm and gearedtowardcriticalengagementwithfilm. how toproduceshortvideos,thiscourseisprimarilyacademic involved infilmproduction,includinghowtowriteascriptand up tothepresentday. Whileyouwilllearnaboutpracticalissues styles andmovementsfromcinema’s beginningsin1895right then thisisthecourseforyou. This coursewillexaminefilm relation toquestionsofstyle,technology, society, andindustry, interested inacquiringthecriticaltoolstoanalysethem If youenjoywatchingawiderangeoffilmsandifare Overview Film studies Course content Is thistherightcourseforyou? For subjectsthatcombinewithFilmstudies,seepage92. year. An honorsdegreeisawardedinbothsubjects. three yearsandonesubjectonlyisstudiedinthefourth honor programme.Bothsubjectsarenormallystudiedfor subject moderatorship(TSM)programme. TSM isajoint It mustbecombinedwithoneothersubjectwithinthetwo- Film studiescannotbestudiedasasinglehonorcourse. TSM points: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: See noteonpage28 B.A. 450-555 30 TR001 (TSM)

Arts, Humanities and Social Sciences 99

Further information Career opportunities www.tcd.ie/film +353 1 896 2617 Tel: E-mail: [email protected] Filmmaker-in-residence, Lenny Abrahamson, on the set of Abrahamson, on Lenny Filmmaker-in-residence, will hold a number Garage. The Department of Film Studies opportunities in many career degree in Film studies offers A areas such as the film industry; television; journalism; digital media; film reviewing and criticism; arts administration; TCD advertising; marketing. Recent graduates of Film studies at have gone on to be involved in the film industry in a number of ways, from directing feature length films to editing, scriptwriting, number of our graduates have A production and administration. This gone on to further study in film and associated areas. opportunities in the many general areas open degree also offers to arts graduates, such as administration, teaching, civil and public service, etc. of workshops with Lenny Abrahamson during the year. of workshops with Lenny

and censorship, up to recent Irish filmmaking. Cinema and Ireland Ireland, through issues of production, representation, European and world cinemas European and world They will examine national cinemas from around the world. cinemas that they the relationship between nations and the societies produce, or through which their national identities, year of the and cultures are projected. In their second for a more degree, students will be given the opportunity raised. detailed consideration of some of the issues films that have developed over the course of film history. films that have developed the 1890s to the 1960s American cinema from narrative classical considering by century 20th the of half first and key structures, important industrial developments the introduces module this of part second The texts. generic American that student to influential examples of film criticism genres examined films from this period have generated. Film the melodrama, the musical, the may include the Western, the 1950s. gangster film and science fiction films of Film theory and criticism 1 and 2 criticism 1 and Film theory its own specific codes and conventions. visual language with will build upon the issues raised In the second-year students 1 and further strengthen their by Film theory and criticism subject by examining the various engagement with the understanding and evaluating approaches to reading, This module moves from the earliest films made about These modules serve as an introduction to a variety of This module introduces aspects of American cinema in the This module introducesaspects of These modules studying begin by the evolution of film as a Assessment

There are six hours of classes and six hours of screenings There are six hours of classes and six hours per week. to them. Topics covered may include aspects of Hollywood Topics to them. cinema, avant-garde and experimental cinema, documentary film, European cinemas, world cinemas, genre studies, gender and film, film theory and criticism, film style and performance, digital filmmaking, editing and other aspects of film practice. In addition, all Junior Sophister (third year) students are introduced to the principles of script-writing and digital video production. Film studies is assessed by coursework and examinations. In the Freshman years, students will also be assessed on class presentations. choose from the wide range of optional modules available In the final two years of the degree course students can The Sophister years n

n n (first two) years may include: (first two) n The Freshman years The Freshman and Senior Freshman during the Junior Courses taught 100 Arts, Humanities and Social Sciences to you. throughout theworld,Frenchat Trinity Collegewillappeal about othercultureswhereFrenchisspoken,inEuropeand of exploringthisdynamicsocietyandinfindingoutmore distinguished history. Ifyouareinterestedinthepossibility French literature,cultureandcivilisationhavealong forms anintegralpartofthiscourse. skills, intheformofbothoraltasks andwrittenexercises,also and society. The developmentofreading,analytical,andcritical wide knowledgeofmajoraspectsFrenchliterature,culture fluency inthelanguage,bothwrittenandspoken,witha The resultisthatyouleaveuniversitywithahighstandardof provide youwithathoroughgroundinginallaspectsofFrench. French, readincombinationwithanothersubject,isdesigned to Is thistherightcourseforyou? French Course overview TR085: BusinessstudiesandFrench,page42 Polish/Russian orSpanish,page58 TR024: Europeanstudies–FrenchwithGerman/Italian/ TR018: LawandFrench,page71 TR011: Computerscienceandlanguage,page122 See also: programmes. and alanguage,ortheLawlanguagedegree Computer scienceandlanguage,theBusinessstudies or studiedasthechosenlanguageofeither languages studiedintheEuropeanstudiesprogramme Alternatively, Frenchmaybeselectedasoneofthetwo For subjectsthatcombinewithFrenchseepage92. year. An honorsdegreeisawardedinbothsubjects. three yearsandonesubjectonlyisstudiedinthefourth honor programme.Bothsubjectsarenormallystudiedfor subject moderatorship(TSM)programme. TSM isajoint It mustbecombinedwithoneothersubjectwithinthetwo- French (TSM)cannotbestudiedasasinglehonorcourse. Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: TSM points: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

Grade C HC1 See noteonpage28 B.A. 425-570 84 TR001 (TSM) French French

n n n French languageandliterature.Firstyearsubjectareasinclude: an introductiontomanyaspectsofcontemporaryFrance,the The programmeintheJuniorFreshman(first)yearincludes The Freshmanyears politics. the fouryearsincludeFrenchlinguistics,literature,ideasand Examples ofoptionalsubjectsavailableoverthecourse critically onthewaylanguageisusedandstructured. registers andstylesofwrittenspokenFrenchtoreflect writing. This includesnurturinganabilitytocopewithdifferent four basiclinguisticskillsoflistening,speaking,readingand are expectedtoprogressahighlevelofcompetenceinthe forms thebackboneofteachingprogrammeandstudents Language instruction–includingcomputer-basedelements in OrléansandParis. exchange agreementsbetween Trinity Collegeanduniversities the frameworkofanErasmusexchange programme. There are spend theirsecondorthirdyear atauniversityinFrancewithin required overthedurationofyour course.Manystudentsoptto A minimumstayoftwomonthsinaFrench-speaking countryis research andwriteafinal-yeardissertation. assessment. SeniorSophisters(fourth-yearstudents)willalso continuous assessmentofyourcoursework,allcontributeto Written, oralandauralexaminations, inadditiontoessaysand choice inconsultationwithasupervisor. write adissertationinEnglishorFrenchonsubjectofyour elect tostudyFrenchinyourfinalyearyouwillresearchand other Francophonecountries,toFrenchtravelwriting.Ifyou French literaturetopolitics,societyandidentityinFrance are available. These rangefromclassicalandcontemporary previously undertaken in the Freshman (first and second) years a widevarietyofoptionalsubjectsleadingonfromcourses In theJuniorandSeniorSophister(thirdfourth)years, The Sophisteryears practice oftheFrenchlanguageitself. and ideologies,Frenchliterature,linguisticsinthe foundation byfollowingcoursesinthehistoryofFrenchideas In theSeniorFreshman(second)year, youwillbuildonthis week studyingliterature. on languageandgrammarapproximatelytwohourseach You willspendapproximatelyfivehourseach week working

Course content Study abroad Assessment Contemporary shortstories,novels,theatre,filmsand Contemporary ofthewrittenandspokenlanguage Comprehension analysis andgrammatical French grammar a speciallypreparedanthologyofFrenchpoetry

Arts, Humanities and Social Sciences 101 TR001 (TSM) 45 445-570 B.A. See note on page 28 COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE TSM points: be studied as a single honor Geography (TSM) cannot with one other subject within course. It must be combined is TSM (TSM) programme. the two-subject moderatorship An honors degree is awarded in a joint honor programme. both subjects. with Geography see page 92. For subjects that combine studied through the Geography can be Alternatively, After two TR071. general-entry Science programme – students may opt to years of general science study, fourth years. specialise in Geography for their third and TR071 – Science see For special entry requirements to page 139. science, Geography may also be studied with Political course Earth see page 83, or as part of the single honor sciences (TR077), see page 161. Why study Geography? Course content Geography Geography is truly interdisciplinary as it spans a broad spectrum Geography is truly interdisciplinary as it spans As physical sciences. of the social, biological, informational and are well placed the world becomes interconnected geographers on social and to bring their understanding and skills to bear geographers, An important attribute of environmental issues. is their ability and one that is highly regarded in the workplace, a wide range of to combine multidisciplinary knowledge with report-writing, transferable skills, including critical thinking, These can be applied to careers numeracy and IT-literacy. which directly incorporate a geographic dimension, such as wider areas planning, and to environmental urban consultancy or such as business and public service. TSM Geography modules aim The Junior Freshman (first year) to provide a flavour of the breadth of the subject, focusing on materials that are dealt with in greater depth in later years, while approaches and challenging students to integrate the different forms of knowledge that characterise the modern discipline of geography. Further information Career opportunities Career www.tcd.ie/French +353 1 896 1553 Tel: Recent graduates in French have gone on to work in areas gone on to work in in French have Recent graduates teaching, arts as secondary and university as diverse tourism, diplomacy, translation and interpreting, administration, banking. Increasing numbers of publishing, and investment further postgraduate courses in areas graduates go on to take of an The combination and business. marketing such as law, vocational or professional programme arts degree and a more to be highly attractive to prospective of studies has proved employers. 102 Arts, Humanities and Social Sciences n modules ingeography: In theJuniorFreshmanyear, studentstakethreeintroductory n n

considering thenatureofdevelopment. the emergent‘blackholesofglobalisation’, aswell including therealitiesoflivingin a‘shrinkingworld’ and human well-being.Italsoexaminesaspectsofglobalisation processes generatingvariationsandchangesinlevelsof the socio-spatialstructureofworldeconomyand Human: introducesthesubjectsofglobalurbanisation, and environmentalhazards. from thefieldsofconservation,environmentaldegradation between humansandtheirenvironment,usingcasestudies to nature,cultureandtheenvironment,interactions Human –Environment:introduceskeyconceptsrelating and subsequentlyinfluencedhumanexistence. habitats andecologicalsystemsincludingthosethatledto conditions fortheevolutionofavarietylifeforms,species, physical landscapeoftheearth,andthathaveprovided large-scale controlsandprocessesthathaveinfluencedthe a basicintroductiontothe Physical geography:provides includes afieldworkcomponent. the collectionandanalysisofgeographicaldatamodulewhich and systems.Researchskillsaredevelopedfurtherthrough and tonaturalhuman-modifiedenvironmentalprocesses issues relatingtocultural,economicandhistoricalgeography, The SeniorFreshman(secondyear)geographymodulescover allocated classtime. subjects. Certainpracticalexercisesarecompletedoutsidethe Participation inlecturesandseminarsislinewithother TSM or Stockholmuniversities. third yearstudyingabroadatExeter, Bordeaux,Paris,Utrecht There areopportunitiesforstudentstospendallorpartofthe examination isused. A combinationofcontinuousassessmentandend-of-year a numberofmodulesoutsideGeographyintheirSophisteryears. and fourth)years,seepage149.Studentsmayalsoopttotake For detailsofmodulesintheJuniorandSeniorSophister(third The Sophisteryears Tel: +35318961576 www.tcd.ie/Geography development. insurance), foreignaffairs, leisureandtourismoverseas as wellpositionsinsuchareasfinancialservices(including planning, environmentalconsultancyandresearchteaching Geography studentsinrecentyearsincludeurbanandregional are widelyregardedasassets.Careerstakenupbygraduating valued intoday’s jobmarket,whereadaptabilityandflexibility discipline andtraininginhighlyrelevanttransferableskillsis Geography graduates. The combinationofabroad-based A wide rangeofcareeroptionsispotentiallyavailableto Study abroad Assessment Further information Did youknow? Career opportunities n

In recentyears,SophisteryearGeography documentaries aspartoftheirassessedwork. Mallorca andZambia,inmakingdigitalvideo students havebeeninvolvedinfieldworkIceland, Arts, Humanities and Social Sciences 103

www.tcd.ie/Germanic_ advanced options that link undergraduate this builds on the written, oral this builds on the written, Language programme: at school and develops both and aural skills you acquired Your language learning in expression. fluency and accuracy developed e-learning programme is supported by a specially at it try website: departmental the on Studies/jfgermanlanguagewebsite/INDEX.HTM political Area studies provides an introduction to society, in modern Germany, current affairs and cultural issues and Austria and Switzerland. studies introduces you to key Literature and textual to reading and aspects of modern German literature and German. analysing literary and non-literary texts in Study abroad Assessment Course content Course

In addition to your on-going language classes, the Senior In addition to your on-going language classes, German cultural Freshman (second) year introduces you to of the history (exploring topics such as the development militarism nation, the role of religion and religious difference, key thinkers of and pacifism, and Nietzsche and Freud as You literature. modernity), Germanic linguistics and medieval fields of interest can also begin to develop your own special of seminars within the programme, choosing from a range linguistics, cultural or historical focus. with a literary, As a TSM German student, you must spend at least two months As a but in practice you are likely in a German speaking country, Options include typically an academic year. to spend longer, studying at a German university within an Erasmus or similar exchange programme in your second year or between third and fourth year (our links include Cologne, Göttingen and Konstanz, but you can also make individual or taking a year arrangements), out to work in a company or as a language assistant in a school. The Sophister years language alongside your In the Junior Sophister (third) year, history of German classes, you will follow a module in the social in specialist literature and choose from a number of seminars historical studies. areas of literature, linguistics, cultural and Sophister (fourth) If you elect to study German in your Senior interests is year the scope for developing these specialist extended through study to the research expertise of staff. In the Senior you will also research and write a dissertation Sophister year, This can be drawn from literature, on a topic of your own choice. intercultural communication or some other aspect of the course that you have particularly enjoyed and is an exciting opportunity to develop your interests in depth. and project of combination a by assessed be will you levels, all At oral and aural examinations. essay work and end-of-year written, Senior Sophister students also write a dissertation. The Freshman years The Freshman in the of classes per week approximately 10 hours There are key areas: The course covers three year. Junior Freshman (first) n n n

German German TR001 (TSM) 32 445-535* B.A. See note on page 28 HC1 Grade C

See also: TR019: Law and German, page 71 French/Italian/ TR024: European studies – German with Polish/Russian or Spanish, page 58 page 122 TR039: Computer science and language, 42 TR086: Business studies and German, page Advanced GCE (A-Level) be studied as a single honor German (TSM) cannot with one other subject within course. It must be combined is TSM (TSM) programme. the two-subject moderatorship awarded in An honors degree is a joint honor programme. both subjects. p. 92. For subjects that combine with German see COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE TSM points: REQUIREMENTS: ENTRY SPECIAL Leaving Certificate Is this the right course for you? Why study German? German a theatre group, debating, and film evenings. When studying German within the two-subject moderatorship competence advanced acquire to opportunity the have you course and fluency in German language and to develop reading skills and methods of research, description and analysis in such areas culture and society of the German-speaking as literature, history, will be encouraged You countries and the linguistics of German. to develop specialist interests by choosing from a wide range award-winning All this in a small, friendly, of optional subjects. department with a wide extra-curricular programme including Modern Germany is a society in transition, more and more ethnically diverse, and engaged in lively debate about its own past and about its political, social and economic responsibilities history has been rich, in Europe and the world. Germany’s dynamic and troubled, and this history shapes the contemporary society and culture in countless ways. Reflection on and critical engagement with these experiences have been central to German writing and thought since the earliest times, and remain All these factors make studying German very much so today. exciting and challenging. German is spoken by some 100 million Europeans. and cultural Contemporary Germany is the geographical economy in an link between east and west and the largest German at an in-depth increasingly integrated Europe. Studying for the world of work level is, therefore, an excellent preparation and is likely to make you highly employable. 104 Arts, Humanities and Social Sciences a competitiveadvantageinthejobmarket. for Ireland. Therefore, competenceinGermancangiveyou the second most important source of Foreign Direct Investment is amajorexportdestinationforIrishgoodsaswellbeing universities inIreland,EuropeandNorth America. Germany as intelecoms,IT, education,publicservice,themedia,and as Google,DeutscheBankandEnterpriseIrelandwell abroad. Recentgraduatesareworkingforemployerssuch engaging with another culture and from the experience gained flexibility andbroadenedunderstandingthatcomesfrom sensitivity which marks the advanced linguist, and the maturity, skills’: themixofaccuracyandcreativity, confidenceand language skills of German graduates, but also their ‘transferable in allkindsofrewardingcareers.Employersvaluenotonlythe People withlanguagesdegreesarefounduptoseniorlevel Tel: +3531896 1373 www.tcd.ie/Germanic_Studies Graduate Profile Career opportunities Further information Did youknow? n n n global headquartersinCalifornia.” role. I’vealsospentsometimeworkingatthecompany’s I currentlyworkinastrategy, policyandcommunications analysis andbusinessplanningfortheDublinoperations. solutions. Fromthis,myrolemovedtofocusonindustry Google andworkedinthecompany’s onlineadvertising with KPMGpriortograduating. After graduating,Ijoined technology andadvertising,Icompletedaninternship year abroadandbecauseofmystronginterestinmedia, career. IattendedtheUniversityofPotsdamduringmy helped metodevelophavesinceproveninvaluableinmy research andcommunicationskillswhichthe TSM degree an importantfactorinmydecision. The criticalthinking, stretch mythinking;theexcellenceofstaff wasalso and wantedtotakeabroadrangeofcourseswhichwould been fascinatedbyGermanculturalstudiesandhistory “I choseGermanat Trinity CollegesinceIhadalways Manager, Global Advertiser OperationswithGoogleIreland Susan O’Malley, TSM GermanandEconomics; Associate

If you are considering studying German,butwantto If youareconsideringstudying We offer Peer Tutoring website andanetworking Trinity College’s DepartmentofGermanicStudieshas staff. Contactusbye-mailorphone(seebelow). discuss youroptionswithamemberoftheteaching the departmentduringteachingterms. You mayalso be sure,youarewelcometosamplesomelecturesin from allovertheworldandlearntheirexperiences. ‘GradLink’ whereyoucanlinkupwithourgraduates (2007) andtheIrelandFundofGermanyPrize(2008). of German-IrishChamberIndustryandCommerce Award forLanguages(2005, 2010),theKuratoriumaward won four prestigious awards in recent years: The European

analytic skills,and thedevelopmentofindependent thinking. courses thegroupswillbesmall, stimulatinglivelydiscussion, perspective onclassicalculture. Forallofyourlanguage-based religion, youwillacquireacomprehensive andinterdisciplinary thought. Through thecriticalstudyofancienthistory, mythand ancient textsbothasliteratureand asagatewayintocultureand studies ortakingGreekasabeginner, youwillengagewith and historiography. Whetheryou arecontinuingyourlanguage genres, includingepic,tragedy, comedy, philosophy, oratory Over thefouryearsyouwillreadtextsinawidevarietyof course. civilisation thatshapedtheWestern world,youwillenjoythis imagination, thedepthofthoughtandhistoricalvaluea If youareinterestedinstudyingthelanguage,poetic culture. classical worldandacriticalapproachtotextualmaterial ancient history, youwilldevelopathoroughknowledgeofthe in theoriginalGreekandexaminationofkeyaspects and thoughtofancientGreece. Through thereadingofliterature The studyofGreekisconcernedwiththelanguage,literature Greek Course content Is thistherightcourseforyou? Course overview honor Classicsdegree– TR021 (seepage44). Greek andLatinmaybestudiedtogetherinthesingle For subjectsthatcombinewithGreekseepage92. advanced level. Greek maybestudiedfromeitherbeginners’ oramore year. An honorsdegreeisawardedinbothsubjects. three yearsandonesubjectonlyisstudiedinthefourth honor programme.Bothsubjectsarenormallystudiedfor subject moderatorship(TSM)programme. TSM isajoint It mustbecombinedwithoneothersubjectwithinthetwo- Greek (TSM)cannotbestudiedasasinglehonorcourse. Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: TSM points: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

HC3 Grade C See noteonpage28 B.A. 470-535* 8 TR001 (TSM) In Greekorina In Greekorina than English language other than English language other

Arts, Humanities and Social Sciences 105 Further information Assessment Study abroad Career opportunities www.tcd.ie/Classics E-mail: [email protected] +353 1 896 1208 Tel: A combination of end-of-year examination and continuous A and other assessment (e.g. essays, unseen translations presentations), language tests, textual commentaries, seminar and a thesis in the final year. has strong links with many Classics departments College Trinity abroad, including active participation in the Erasmus exchange programme with universities in France, Switzerland and This allows students the option of spending their Senior Cyprus. Freshman (second) year abroad. Recent graduates are working in many fields including art business, civil service, restoration, banking and accountancy, librarianship, computers, journalism and broadcasting, law, publishing, teaching and theatre.

– an introduction to the major – an intensive introduction to the ancient Greek language – this course allows you to practice your translation skills and to study the language of authors not covered in the text-based courses. Greek authors – text-based courses introduce you to a close the critical reading of Greek literature through and most examination and contextualisation of the oldest influential works in western literature: Homer’s Iliad and the Histories of Herodotus, the tragedies of Odyssey, Euripides and Sophocles and the philosophical prose Elementary Greek will be ready to Greek language. By the end of the year you language will read original texts and your command of the Greek be at the same level as those who have studied before entering university. of Plato. Mythology and religion Mythology and and archaeology – Sources and evidence in history theories and methodologies materials, the to introduction an employed by historians and archaeologists. – an introductory survey of the – an introductory survey Greek and Roman history Archaic age to world, from the Greek Greek and/or Roman The course covers topics such the early Roman Empire. the conquests democracy, Athenian as politics and power, of Rome as a major imperial the emergence Alexander, of colonisation, war and conflict. power, using both literary myths and religions of the classical world also explores theories The course and material evidence. of myth and the functions of myth within society.

The Sophister years In the Sophister (third and fourth) years you will progress to an in-depth study of topics in Greek literature, history and culture. will refine your analysis of texts in their literary and cultural You context through more specialised skills and methodologies, such as textual criticism, linguistics and literary theories. Empire, may include Polybius and the Hellenistic Topics In your and Hellenistic poetry. Greek comedy, Archaic poetry, you will continue to study ancient Junior Sophister (third) year, while separate language classes provide additional history, assistance in improving your fluency and accuracy in reading and interpretation. In the Senior Sophister (fourth) year you will also study a special topic in Classical culture and write a thesis The thesis is an opportunity to do on a subject of your choice. research which will allow you to develop independent ideas and acquire critical skills, while investigating in great depth an area that particularly interests you. n Greek for non-beginners n Greek for beginners n n n n There are six to eight contact hours per week. There are six to eight The Freshman years The Freshman to you will be introduced Freshman (first) year In the Junior The and literature. culture study of ancient history, the critical you have depend on whether courses you take language-based your it up as a beginner; before or are taking studied Greek history and culture depends on your choice of a topic in ancient your Senior Freshman (second) year you TSM combination. In Greek language, literature and history. continue the study of lectures and small-group seminars. Courses are taught by 106 Arts, Humanities and Social Sciences practical skillinarttotakethiscourse. You donotneedanypreviousknowledgeofart historyorany communication skillstraditionallyassociatedwithanartsdegree. of developingintellectualrigourandacquiringthecritical archaeology and history. It will provide you with an effective way of students,aswellthosewithspecialinterestsinart, History ofartandarchitectureappealstoawiderange Library arealso used. As astudent, youwillbeexpectedto such astheIrishMuseumofModern Art andtheChesterBeatty the venuesforgroupandteaching activities.Otherinstitutions of IrelandandNationalMuseum arelocatednearbyandprovide collections areintegraltotheprogramme. The NationalGallery of artandarchitectureitsown distinguishedbuildingsand Trinity College offers excellentfacilitiesforthe studyofhistory art, suchastheartsofJapanandIndia. the twentiethcentury. There arealsomodulesonnon-Western splendours oftheGeorgianeraandartisticachievements Italian Renaissance,artintheageofchivalry, thearchitectural modern times. Topics available includeIrishart,theartof of painting,sculptureandarchitecturefromancientGreeceto You willtakeabroadrangeofmodulescoveringthehistory nations. you withadeepersensitivitytothecultureandidealsofother develop anawarenessoftheenvironmentwhilealsoproviding to understandtheirhistoricalsignificance.Itwillenableyou This courseteachesyouhowtoanalyseworksofartand architecture Course content Is thistherightcourseforyou? and art of History TR028: Ancient andmedievalhistoryculture,page36 TR012: Historyandpoliticalscience,page63 TR003: History, page61 See also: architecture seepage92. For subjectsthatcombinewithHistoryofartand is awardedinbothsubjects. subject onlyisstudiedinthefourthyear. An honorsdegree subjects arenormallystudiedforthreeyearsandone programme. TSM isajointhonorprogramme.Both other subjectwithinthetwo-subjectmoderatorship(TSM) as asinglehonorcourse.Itmustbecombinedwithone History ofartandarchitecture(TSM)cannotbestudied TSM points: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: See noteonpage28 B.A. 455*-555 40 TR001 (TSM) in thefollowingareas: Sophister years,youwillhavetheopportunitytotakecourses Over thecourseofSeniorFreshman,Juniorand Years two,threeandfour as themedievalmonasteryorcountryhouse. day. Specialattentionisgiventoimportantbuildingtypessuch architecture, whichrangesfromGreektemplestothepresent These topicsarepartofahistoricalsurveyWestern drawings aswelltraininginthevisualanalysisofbuildings. an examinationofdifferent buildingmaterialsandarchitectural needed tounderstandandappreciatearchitecture.Itincludes The coursealsoprovidesyouwiththeknowledgeandskills Book ofKellstothepresentday. and thedifferent technicalmethodsusedbyartistsfromthe manuscripts andotherartefacts,theimportanceoficonography, history. These includethecriticalanalysisofpaintings,sculpture, course willintroduceyoutothemethodsandtechniquesofart such astheItalianRenaissanceandFrenchImpressionism, As wellasprovidingahistoricalsurvey, coveringmajorperiods and architecture,tothepracticeof Art history. providing anintroductiontovariousaspectsofWestern art In theJuniorFreshman(first)yearyouwilltakemodules The JuniorFreshmanyear ornament 1700-1830, Art and religionintheHispanicworld, Saints andSanctity inMedievalEurope,Irisharchitecture and or architecture.Examplesofspecial subjecttopicsinclude interpretation of original works of art, whether painting, sculpture and particularemphasisisplaced onpersonalobservationand you willbegiventheopportunity ofstudyingprimarysources art-historical issues at a more specialised level. Where possible, Sophister (fourth)year, youwillselectasubjectdealingwith If youelecttostudyHistoryofartandarchitectureintheSenior The specialsubject in alternateweeks. These coursescompriseaweeklylectureandseminar n n n n n n n n n n n n n n become familiarwithvariouscollectionsandbuildingsinDublin.

Art inIreland:makingandmeaning History andcultureofSouth Asia arthistoryandcriticism Approaches to The artsofJapan post-modernism Modernism and painting Themes inNorthern Art inFrance1850-1900 andIreland 18th centurypaintinginBritain the19thand20thcenturies Architecture in City court&Campagna:thefoundationsofearly intheItalianRenaissance Painting andsculpture Europe in17th-century Painting andsculpture Art inthe Age ofChivalryc.1150-1350 artandarchitecture Romanesque modern architecture

Arts, Humanities and Social Sciences 107

language other than English language other than English In Italian or in a In Italian or in a TR001 (TSM) 30 400-570 B.A. See note on page 28 Grade C HC3

COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE TSM points: Special Entry Requirements: Leaving Certificate Advanced GCE (A-Level) honor course. Italian (TSM) cannot be studied as a single within the two- It must be combined with one other subject TSM is a joint subject moderatorship (TSM) programme. studied for honor programme. Both subjects are normally in the fourth three years and one subject only is studied An honors degree is awarded in both subjects. year. page 92. For subjects that combine with Italian, see as one of the two Italian may be selected Alternatively, programme. languages studied in the European studies level) within Italian can be studied ab initio (from beginner TSM and European studies. both See also: TR024: European studies – Italian with French/German/ Polish/Russian or Spanish, page 58 Course overview Is this the right course for you? Italian Having played a leading role in European civilisation since Having played a leading role in European economies Ages, Italy today is one of the major the Middle of the world, famous for its style, design and innovation. Many Trinity its people and culture, and people are fascinated by Italy, courses give you the opportunity to develop your College’s Our courses also help you meet interest in a systematic way. the challenge of mastering a new language; you can take Italian There is close contact College as a complete beginner. Trinity at you will receive individual between students of Italian and staff; attention and will be encouraged to discuss your progress at all times. Italian is an excellent subject choice if you have a natural flair for languages, if you enjoy exploring foreign countries and their cultures, or if you want to follow a career in the multilingual Europe of today.

The Douglas Hyde Gallery, one of Ireland’s leading of Ireland’s one The Douglas Hyde Gallery, Trinity contemporary art galleries, is situated in major collection of The College itself has a College. paintings and sculpture, and a student committee assists the curator in managing this collection.

n Further information Did you know? Career opportunities Assessment Study abroad Study www.tcd.ie/History_of_Art www.douglashydegallery.com +353 1 896 1995 Tel: In recent years graduates have been employed in universities, In recent years graduates have been employed salesrooms, galleries, museums, publishing houses, art and abroad, architectural heritage and journalism in Ireland commercial as well as in a broad range of administrative, field of art and and media-based employment outside the architectural history. Assessment is by coursework, end-of-year examinations, and a Assessment is by coursework, end-of-year final-year dissertation. Students have the chance to participate in a study week abroad. to participate in a study week abroad. Students have the chance Rome include Paris, Madrid, Vienna, Cities visited in the past you may apply to study at a university and Florence. In addition, Freshman Italy or Spain during the Senior in France, Germany, As you will of the Erasmus programme. (second) year as part lectures in the language of your host be required to attend possess the necessary linguistic fluency. institution, you must painting in Ireland and Britain c1800-1900: artists, institutions artists, institutions Ireland and Britain c1800-1900: painting in art. and contemporary and Irish modern and audiences, 108 Arts, Humanities and Social Sciences cinema andculturalstudies. and otherkeytextsfromtheRenaissance,togetherwithItalian language courses,ItalianliteratureincludingDante’s Inferno In theSeniorFreshman(second)yearyoucontinuewith poetry, dramaandfiction. independently. You willbeintroducedtomodernItalianhistory, and otheractivities,togetherwithassignmentstobecarriedout devoted tolanguagelearningincludinggrammar, conversation There areabouteightclassroomhoursperweek,mostly video andcomputer-basedlanguagelearning. beginners’ courseingrammar, translation,conversation,audio/ In theJuniorFreshman(first)year, youwillfollowanintensive The Freshmanyears a substantialdissertationonan agreedtheme. Optional topicscanbestudied in depth,andyouwillresearch and others,withathematicapproach tothemodernperiod. language varieties,keyworksby Dante,Boccaccio,Machiavelli In yourfinalyeartheprogrammeincludescoursesonItalian translation, texteditingandwriting. your languageproficiencyanddevelopinghigher-levelskillsin and society. There isacontinuingemphasisonstrengthening culture. Optionsareavailableinliterature,language,history periods, includingcontemporaryperspectivesonItalyandits on majorauthorsofthemedieval,Renaissanceandlater The JuniorandSeniorSophister(thirdfourth)yearsfocus The Sophisteryears Course content

E-mail: [email protected] Tel: +35318962062 www.tcd.ie/Italian teaching,acting,translationandbusiness. marketing, journalism, European studies,whileothershaveoptedfortraininginlaw, selected postgraduatecoursesinarts,socialsciences,and work inItaly. Ofthose whooptedforfurtherstudy, somehave football managementandteaching.Somehavegonetolive export, writing,PR,diplomacy, corporaterecruitment,finance, translation, theatre,business,law, publicadministration,import- Our graduateshavemovedintoalltypesofjobs:journalism, Trieste andPavia. programme. There arelinkswiththeUniversitiesofBologna, the secondyearataEuropeanuniversitythroughErasmus time overthedurationofyourcourse. You mayapplytospend A minimum two-monthstayinItalywillberequiredatsome and assignments. in additiontoessaysandcontinuousassessmentofcoursework There isacombinationofwritten,oralandauralexaminations, Further information Career opportunities Study abroad Assessment

Arts, Humanities and Social Sciences 109

offers a course in Jewish and Islamic civilisations. offers Trinity Collegethe only university is in Ireland that Trinity

to the modern period Introduction to Jewish civilisation from antiquity Introduction to Islamic civilisation The world of the Bible n Assessment structure Did you know? Study abroad Course content Course

Students write between three and six essays over the course Students write between three and six essays In addition they sit two examination papers at the of the year. end of the year. you the opportunity student exchange programme offers A to spend up to a year at the University of Leuven in Belgium, the University of Glasgow in Scotland or Heythrop College, London. Recently scholarships have been made available to enable students to spend a summer in Israel participating in archaeological digs. This course offers you the opportunity to study the world that study the world that the opportunity to you offers This course and history and Islamic culture Bible, and Jewish produced the came and why these religions – asking how from their origins contexts, where we examine how into being – to their modern African Middle Eastern, North religion has shaped European, civilisation. and Western will study a range of introductory courses, In your first year you including: n n n from a range From the second year on, you may choose you have of courses depending on the individual interests combine a You can choose to discovered in your first year. as well as cover range of philosophical and historical courses, you may decide to study In addition all periods of history. can avail of the In second year you Arabic, Greek or Hebrew. Religions of Department the outside course a take to opportunity Broad Curriculum programme (see page 13). College’s Trinity in TR001 (TSM) 10 425-570 B.A. See note on page 28 See also: page 90 religions and theology, TR001/008: World COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE TSM points: cannot be studied as a Jewish and Islamic civilisations It must be combined with one other single honor course. moderatorship (TSM) subject within the two-subject An honors TSM is a joint honors programme. programme. both subjects. degree is awarded in Islamic For subjects that combine with Jewish and civilisations see page 92. Is this the right course for you? What is Jewish and Islamic Jewish and Islamic civilisations? civilisations Trinity College’s Department of World Religions and Theology Religions and Department of World College’s Trinity students in Ireland a unique non-denominational context offers for studying religions: it is not affiliated to any church or religious body and we do not presume that you have any previous knowledge of the subject. Students do not just encounter religious cultures in the lecture theatre and libraries, as central to this course are visits to museums, sacred sites and cultural destinations. For example, students have visited Israel, Berlin and Poland. You will enjoy this course and succeed in gaining an excellent You and broad arts degree if you are interested in the origins of the Bible, early Christian communities and the cultural and religious expressions of Judaism and Islam from the ancient world to range of student activities will be available to A present times. you and often these activities help you to develop precisely the kind of skills employers look for. Starting with how the world of the Bible and the Ancient Near the Starting with how the world of the Bible and and Islam, this East was the birthplace of Judaism, Christianity development of course charts the historical and philosophical periods All Jewish and Muslim religious and cultural traditions. as archaeological, of history are examined through texts as well literature is artistic and architectural evidence. Religious treatises, poetry, studied alongside philosophical and scientific decrees and charters, art, novels, historical writings, biography, and film. 110 Arts, Humanities and Social Sciences civilisations alsotakesupthechallenge. this futureand Trinity College’s course inJewishandIslamic Certificate syllabusinReligionseriouslyattemptstopreparefor promote abetterunderstandingfortoday? The newLeaving a knowledgeoftheoriginsJudaism,ChristianityandIslam generations ofIrishMuslimscontributetosociety?Howcan and toleranceforamulti-culturalsociety?Howwillnew What lessonscananti-Semitismteachusaboutintegration the media?HowoftenareeventsinMiddleEastreported? self-evident. HowmanytimesaweekisIslamdiscussedin The relevanceofthiscoursetoaneverchangingIrelandis types ofcareers. different societiesintheglobalcommunityisanassetformany In addition,aknowledgeofthecultures,valuesandhistories department whichisrelativelysmallandverystudentcentred. have ampleopportunitytodevelopalloftheseskillswithina and problemsolving.StudentsofJewishIslamiccivilisations good oralcommunication,writtenteamwork the position,personalqualitiesandtransferableskillssuchas for inartsgraduatesandtopofthelistcame:enthusiasm Service recentlysurveyedemployersaboutwhattheylooked ie/Religions_Theology as otherartsgraduates(forfurtherinformationsee potential employersandtheypursuethesamekindsofcareers College. Graduateshaveskillswhicharehighlyvaluedby and sharesmanyfeaturesofotherartsdegreesin Trinity The courseinJewishandIslamiccivilisationsisanartsdegree Tel: +35318961297 www.tcd.ie/Religions_Theology/herzogcentre Career opportunities Further information ). Trinity College’s Careers Advisory

www.tcd. development of independentthinking. be small,stimulating livelydiscussion,analytic skills, andthe culture. Forallofyourlanguage-based coursesthegroupswill a comprehensiveandinterdisciplinary perspectiveonclassical critical studyofancienthistory, mythandreligionyouwillacquire literature andasagatewayinto cultureandthought. Through the Latin asabeginner, youwillengagewithancient textsbothas Whether youarecontinuingyourlanguagestudiesortaking genres, includingepic,comedy, lovepoetry andhistoriography. Over thefouryearsyouwillreadtextsinawidevarietyof course. civilisation thatshapedtheWestern world,youwillenjoythis language, thepoeticimagination,andhistoricalvalueofa and researchinClassics.Ifyouareinterestedstudyingthe Latin, andithasalongdistinguishedtraditioninteaching Trinity CollegeistheonlyuniversityinIrelandwithaChair world andacriticalapproachtotextualmaterialculture. history youwilldevelopathoroughknowledgeoftheclassical the originalLatinandexaminationofkeyaspectsancient thought ofancientRome. Through thereadingofliteraturein The studyofLatinisconcernedwiththelanguage,literatureand Latin Course content Is thistherightcourseforyou? Course overview honor degreeClassics– TR021 (seepage44). Latin andGreekmaybestudiedtogetherinthesingle advanced level. Latin maybestudiedfromeitherbeginners’ oramore For subjectsthatcombinewithLatinseepage92. year. An honorsdegreeisawardedinbothsubjects. three yearsandonesubjectonlyisstudiedinthefourth honor programme.Bothsubjectsarenormallystudiedfor subject moderatorship(TSM)programme. TSM isajoint It mustbecombinedwithoneothersubjectwithinthetwo- Latin (TSM)cannotbestudiedasasinglehonorcourse. Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: TSM points: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

HC3 Grade C See noteonpage28 B.A. 425-535* 10 TR001 (TSM) In Latinorina In Latinorina than English language other than English language other Arts, Humanities and Social Sciences 111

Assessment Study abroad Career opportunities Further information www.tcd.ie/Classics E-mail: [email protected] +353 1 896 1208 Tel: A combination of end-of-year examination and continuous and continuous of end-of-year examination combination A translations and other (e.g. essays, unseen assessment seminar presentations) textual commentaries, language tests, many Classics departments College has strong links with Trinity participation in the Erasmus exchange abroad, including active in France, Switzerland and programme with universities their Senior This allows students the option of spending Cyprus. abroad. Freshman (second) year including art Recent graduates are working in many fields business, civil service, restoration, banking and accountancy, librarianship, law, computers, journalism and broadcasting, publishing, teaching and theatre. is used, and a thesis is written in the final year. is used, and a thesis

–

– an introductory survey of the – an introductory survey – an introduction to the major – an intensive introduction to the Latin – this course allows you to practice your – text-based courses introduce you to the critical reading of Latin literature through a close examination critical reading of Latin literature through a prose from the and contextualisation of Roman poetry and include the Texts early republican to the imperial period. famous speech Cicero’s Terence, comedies of Plautus and Aeneid, the love poems of On Behalf of Caelius, Virgil’s Younger. Catullus and Ovid, and the letters of Pliny the Mythology and religion Mythology and myths and religions of the classical world using both literary myths and religions of the classical world also explores theories The course and material evidence. of myth and the functions of myth within society. translation skills and to study the language of authors not covered in the text-based courses. language. By the end of the year you will be ready to read language. By the end of the year you will will be original texts and your command of the language Latin before at the same level as those who have studied entering university. Latin language Latin language Latin authors Sources and evidence in history and archaeology Sources and evidence in history Elementary Latin Greek and Roman history Greek and Roman history an introduction to the materials, methodologies and an introduction to the materials, methodologies theories employed by historians and archaeologists. Greek and/or Roman world, from the Greek Archaic age to world, from the Greek Greek and/or Roman The course covers topics such the early Roman Empire. the conquests democracy, Athenian as politics and power, of Rome as a major imperial the emergence Alexander, of colonisation, war and conflict. power,

In the Sophister (third and fourth) years you will progress to an in-depth study of topics in Roman literature, history and culture. will refine your analysis of texts in their literary and cultural You context through more specialised skills and methodologies, such may Topics as textual criticism, linguistics and literary theories. Satire, Desire and the Latin historians, Augustan poetry, include In your Junior Sophister (third) year you will continue to body. while separate language classes provide study ancient history, additional assistance in improving your fluency and accuracy in reading and interpretation. In the Senior Sophister (fourth) year you will also study a special topic in Classical culture and write a The thesis is an opportunity to thesis on a subject of your choice. do research which will allow you to develop independent ideas and acquire critical skills while investigating in great depth an area that particularly interests you. The Sophister years n n Latin for non-beginners Latin for beginners n n The language-based courses you take depend on whether take depend on whether courses you The language-based beginner; are taking it up as a Latin before or you have studied in ancient history and culture depends on your choice of a topic year, combination. In your Senior Freshman (second) TSM your of Latin language, literature and history. you continue the study lectures and small-group seminars. Courses are taught by n n to the critical study of ancient history, culture and literature. and literature. culture study of ancient history, to the critical contact hours per week. There are six to eight The Freshman years The Freshman you will be introduced Freshman (first) year In the Junior 112 Arts, Humanities and Social Sciences speakers orthosewhohavean entrance qualificationinRussian). with prior knowledge of Russian (heritage speakers, near-native year languagecourse.Special provisions aremadeforstudents Most studentsstartRussianfrom scratchwithanintensivefirst have asenseofadventureandarenotafraidchallenge. you enjoylanguagestudy, areinterested inunfamiliarcultures, You willfindtheRussianprogrammeexcitingandrewardingif the interactionbetweenEurope’s easternandwesterntraditions. it today:exploringRussia’s pastandpresenthelpsunderstand culture; RussianhistoryhashelpedshapeEuropeasweknow and artistshavemadeaconsiderablecontributiontoEuropean College studentsandgraduates.Russianwriters,musicians unprecedented opportunities for work, study and travel for Trinity a marketeconomyandprinciplesofopennesshavecreated Russia isarapidlychangingsociety, inwhichtheadoptionof and isoneofEurope’s mostimportantlanguages. Today Russian isthenativelanguageofnearly150 millionpeople Why studyRussian? Russian Course content Is thistherightcourseforyou? TR089: BusinessstudiesandPolish,page42 TR087: BusinessstudiesandRussian,page42 Italian/Polish orSpanish,page58 TR024: Europeanstudies–RussianwithFrench/German/ See also: For subjectsthatcombinewithRussianseepage92. subjects. in thefourthyear. An honorsdegreeisawardedinboth studied forthreeyearsandonesubjectonlyis is ajointhonorprogramme.Bothsubjectsarenormally the two-subjectmoderatorship(TSM)programme. TSM course. Itmustbecombinedwithoneothersubjectwithin Russian (TSM)cannotbestudiedasasinglehonor Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: TSM points: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

Grade C HC3 See noteonpage28 B.A. 425-535* 36 TR001 (TSM) In alanguage In alanguage other thanEnglish other thanEnglish

choice. research andwriteadissertationonsubjectofyourown If youelecttostudyRussianinyourfinalyearwillalso the Polishlanguage. Russia andtheSovietUnion,Russiansocietypolitics, particular interests. These includeRussianliterature,historyof choices, allowingyoutochooseoptionsthatreflectyourown and fourth)yearsofyourcourseoffer awiderrangeofsubject In additiontoadvancedlanguagestudy, theSophister(third The Sophisteryears cultural orareastudies. class time,dividedequallybetweenlanguageworkandliterary, In thefirsttwoyearsthereareapproximatelytenhoursof n n n main areas: In theFreshman(firstandsecond)years,classescoverthree The Freshmanyears postgraduate studyinIrelandorabroad. graduates alsoopttopursuearesearchcareerbeginningwith the diplomaticcorps;journalismandtourism.Eachyearsome public service;internationalorganisations(UN,EU,NGOs)and media; education;business,financeandmarketing;civil Career pathsfollowedbyrecentgraduatesinclude:artsand a numberofprovincialtowns. with universitiesandinstitutesinMoscow, St.Petersburgandin after secondorthirdyear. Trinity Collegehascloseconnections You willbeencouragedtospendupayearstudying inRussia written andoralexaminationsattheendofeachyear. your languagework,testsandessays,inadditionto Assessment isbyacombinationofcontinuousassessment the PolishlanguageandotherSlavoniclanguages. and politics.Inlateryears,youwillalsohavetheoptiontostudy Russian literature,historyandculture,society In addition to language study, you will take courses on aspects of

Career opportunities Study abroad Assessment Central, East European and Russian areastudies Central, EastEuropeanandRussian andculturalstudies Russian literary inreading,writing, developsfluency Russian language: speaking andlistening

Arts, Humanities and Social Sciences 113

TR001 (TSM) 59 450*-570 B.A. See note on page 28 COURSE CODES: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE TSM points: may be studied through four College Trinity Sociology at TR081 (BESS), TR001 (TSM), programmes: degree different TR083 (Sociology and social policy). TR015 (PPES) and studied as a single honor course. It Sociology cannot be one other subject within the two- must be combined with TSM is a joint (TSM) programme. subject moderatorship in both An honors degree is awarded honor programme. that can be subjects. See page 92 for a list of the subjects combined with Sociology. students year, Within BESS (TR081), after a common first then proceed to choose 6 courses in the second year and it with one of either specialise in Sociology or to combine See page 37. Economics, Political science or Business. and sociology political science, economics Philosophy, but with (PPES/TR015) has a similar structure to BESS See page 80. Philosophy replacing Business as a subject. See also: page 89 TR083: Sociology and social policy, What is Sociology? Course overview Sociology into by those who craft policies and create programmes. Sociology is the study of social life, social change, and the socialSociology is the study of social life, social change, Sociologists causes and consequences of human behaviour. and societies, investigate the structure of groups, organisations, The discipline and how people interact within these contexts. technology and culture gender, age, race, class, that recognises life in ways that become determine the path of an individual’s is Sociology sociology. of study the through visible clearly more challenges cultural and social the of exploration the to committed facing fast-changing contemporary societies and equipping students with research methods skills. Because sociology rapidly a is it time, our of issues challenging most the addresses expanding field, the potential of which is increasingly tapped Each of the four degree courses through which sociology may be studied cover a range of subjects including migration, work and employment, innovation, technology and society, race development and globalisation, conflict resolution, family, education, organisations and management, gender and ethnicity, and popular culture. you have the opportunity to study Russian to degree you have the opportunity to study Russian level. Trinity Collegethe only university is in Ireland where Trinity

“To be honest when filling out my CAO forms I chose be honest when filling out my CAO forms “To of reasons. Some pretty idealistic such for a mix Trinity as the fact that my brother really enjoyed studying engineering there, while I was still doing my Leaving Cert. I always had an interest in Russia, stemming Additionally, was the Trinity from studying history in school. I knew Russian and I knew studying there only university to offer would give me the opportunity to learn about Russia and to possibly to spend an academic year there. But I didn’t really know what to expect. means small, often quite Trinity Studying Russian at personalised classes. In addition to language classes, aspects of there were excellent introductions to different together with informal Russian speaking Russian society, get-togethers. I spent my third year studying in Moscow. I learnt so much when I was there, and it was one of the most interesting and exciting years of my life. an additional I returned to Moscow to work for Trinity Finishing 18 months with a chamber of commerce attached to the After this, my interest in Russia European Commission. industry. gas and oil the on choice career my focus to served oil French the Total, of office London the in work currently I market.” with an increasing focus on the Russian major, Nicholas Browne n Graduate Profile Further information Did you know? www.tcd.ie/Russian +353 1 896 1896 Tel: 114 Arts, Humanities and Social Sciences and applyingforjobs. years. They alsofinditagreatassetwhentalkingtoemployers students findthisthemostsatisfyingpartofwholefour lives, andCounter-urbanisationintheIrishcountryside).Many prison system,Unmarriedfathers’ participationintheir children’s of yourchoice(recentprojectsincluded:Immigrationandthe independent researchprojectfromstarttofinishonatopic conflict studies. You havetheopportunitytocarryoutyourown digital lives,theeconomicsociologyofEurope,migration,and variety ofsubstantivetopicareas,includingpopularcultureand and focusgroups. The SeniorSophisteryearoffers coursesina and verbaldatathataretheoutcomesofrecordedinterviews projects involvinganalysisofbothnumericaldatafromsurveys, development, race,ethnicityandidentity, andcarryoutresearch (third) year, youlearnaboutsocialtheory, globalisationand Sophister (thirdandfourth)years.InyourJunior analysis, researchandpresentationskillsareprovidedinthe Specialisation insociologicaltopicareas,andmoreadvanced The Sophisteryears introduced tosociologicalresearchmethods. and societyindifferent cultures,Europeansocieties,andare Senior Freshman (second) year you study issues around gender in Sociology, PoliticalscienceandEconomicpolicy. Inthe The Junior Freshman (first) year comprises foundation courses The Freshmanyears the socialsciencesinitsunderstandingofchange. we participate in its development? Sociology is foremost among is changing,butwhatwillthenewworldbelike,andhowcan experiencing rapidprocessesofsocialchange. The oldworld investigating social change. Ireland and the world are currently numerous waysofdescribingandanalysingsociety sociology is for you. As an area of university study, it discusses world today, and you’re curious about people and society, then If youwanttounderstandthechangestakingplacein Some oftheseuniversitiesoffer theircoursesthroughEnglish. Singapore, China,Canadaand theUSA intheirthirdyear. the CzechRepublic,Maltaand Denmark aswell Australia, universities inFrance,Italy, Germany, Sweden,Finland, Turkey, Students mayparticipateinfull-yearorhalf-yearexchangeswith take up6to10hoursaweek,dependingontheyear. assessment andformalexamination.Lecturestutorials Courses areexaminedbyacombinationofcontinuous Course content Is ittherightcourseforyou? Study abroad Assessment

fashion andmarketingfromteachingtotourism. Enterprise Ireland.Careersrangefromindustrialrelationsto the DepartmentofForeign Affairs, FriendsoftheEarthand as GoodbodyStockbrokers,theESRI, Abbey Theatre, lecturers. Graduatesareworkingfororganisationsasdiverse in theprintandbroadcastmedia,businessorasuniversity research instatutoryorvoluntarysocial-serviceorganisations, careers inthepublicservice,communitydevelopment,social of howsocietyandpeopleworkmeanstheycanthrivein graduates findthattheirbroadtrainingandappreciation Sociologists workinawidevarietyofsettings.Sociology Tel: +35318962701 www.tcd.ie/Sociology Did youknow? Career opportunities Further information n

The Department of Sociology is aleadingparticipant ofSociologyis The Department involved. the needtounderstandprocessesandimplications the integrationofIrelandintoaglobalisingworldand technology andsociety, andonglobalisation,reflecting Post ConflictJustice.Italsospecialisesinresearchon in the Trinity ImmigrationInitiativeandintheCentrefor

Arts, Humanities and Social Sciences 115

non-beginners attend six per week). These comprise classes These comprise classes six per week). non-beginners attend practice in speaking and listening text analysis, in grammar, to Spanish based on five Spanish and Spanish-American literature, texts Introduction to study language Language classes attend (beginners seven per week and Introduction to modern Spain range of modern of a different Literature: close study Spanish language Syntax and vocabulary of Spanish Spoken Spanish Assessment

Essays submitted throughout the year are combined with written and oral examinations at the end of each year. each week: into extending and year (second) Freshman Senior the in Starting courses in Hispanic the Junior Sophister (third) year you follow Renaissance, linguistics and the literature of the Spanish course on A America. modern Spain and modern Spanish these of Each given. also is Spain early-modern of history the semester-long courses in the second and third years are The format is one lecture followed by one tutorial courses. oral presentations per week. Students are encouraged to give on the texts followed. The Senior Sophister year If you elect to study Spanish in the Senior Sophister (fourth) with significant you will work more independently and year, language, theoryAs well as studying Spanish freedom of choice. of translation and medieval Spanish literature, you will choose These two other subjects from a range of special subjects. American include contemporary prose fiction, Spanish and Latin will You cultural politics, and a course in the literature of exile. also research and write a dissertation under the supervision of a member of the department on either a given topic or one that is of special interest to you. The Junior Freshman year Freshman The Junior is to Freshman (first) year focus of the Junior The primary competence in understanding consolidate your establish and Spanish Students studying the Spanish language. and using per nine hours of classes beginner level) attend ab initio (from attend seven hours of classes. week, while non-beginners main areas: The course covers four n n n n two and three Years with language tuition taking three classes will continue You n n n other than English other than English In a language In a language TR001 (TSM) 41 440*-535* B.A. See note on page 28 HC3 Grade C

the right course for you? COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE TSM points: Special Entry Requirements: Leaving Certificate See also: 42 TR090: Business studies and Spanish, page Advanced GCE (A-Level) honor Spanish (TSM) cannot be studied as a single course. within the two- It must be combined with one other subject TSM is a joint subject moderatorship (TSM) programme. studied for honor programme. Both subjects are normally in the fourth three years and one subject only is studied An honors degree is awarded in both subjects. For year. 92. subjects that combine with Spanish see page as one of the two Spanish may be selected Alternatively, programme, languages studied in the European studies (from see page 58. Spanish can be studied ab initio TSM and European Studies. beginner level) in both Course content Is this Spanish The development of the skill of textual analysis through close and careful reading, together with the organisation and expression of ideas in written and verbal form, are integral aims of the department. Spanish at Trinity College is taught by a variety of methods to College is taught by a variety Trinity Spanish at equip you with a comprehensive range of skills in the accurate, fluent and sensitive understanding and use of the written and spoken language. If you are a beginner the teaching a realistic opportunity for you to reach the same provided offers standard within a year as those who have studied the language previously. Spain, currently one of Europe’s leading industrial nations, was Spain, currently one of Europe’s the foremost Western in the sixteenth and seventeenth centuries and Spanish is today the native language of over four power, hundred million people. In terms of the number of countries – more than twenty – in which it is officially spoken, it is second only to English. If you are interested in reading and in the America, then language and culture of Spain and Spanish this is a course you will enjoy. 116 Arts, Humanities and Social Sciences your finalexams. spend twomonthsinaSpanish-speakingcountrypriortotaking or theColegiodeMéxico. At aminimum,youwillberequiredto close associations,suchasGranada,León,Salamanca,Seville, America, especiallyatoneoftheuniversitieswithwhichwehave Students areencouragedtospendayearinSpainorSpanish Tel: +35318961257 www.tcd.ie/Hispanic_Studies/pages/undergraduate.php M.Litt. andPh.D.researchdegreesat Trinity College. A steadystreamofundergraduateshavealsochosentopursue Literary translationandcomparativeliteratureprovingpopular. in theU.K.andIreland,with Trinity College’s new M.Phil.in translation. Ample opportunitiesexistinseveraluniversities,both particularly diplomaandmasters’ coursesininterpretingand A substantialproportionofstudentsengageinfurtherstudy, gained EUplacementsinBrussels. the visualmediagenerally, whilesome recent graduateshave The maincareeropportunitiesare:teaching,journalismand Study abroad Further information Career opportunities

of simulatingtheworkingenvironment ofaprofessionaltheatre. Training for the theatre at The Lir is founded on the basic principle for 35hoursperweek,andsometimes morewheninproduction. expect tobeinclasses,workshopsandrehearsalsonaverage approximately 14hoursperweek,studentsat The Lircan courses inEnglishordramamightbetaughtclassesfor a studentonotherdramacourses.Whilestudentsofdegree Being an acting student at The Lir is completely different to being class for36weeksperannum(three12-weeksemesters). the trainingforactorsmeansthatastudentcanexpecttobein an instrumentaswellthecreativeimagination,intensityof bodyas course, andtheprincipalobjectiveoftrainingactor’s annum) andoverthreeyears.Giventhepracticalnatureof (RADA) thecourseistaughtoverninesemesters(threeper associatedramaschool to emulatebestpracticeof The Lir’s for performanceawidevarietyofapproachestotheatre.Inorder to equipstudentswiththeskillsnecessarytranslateorcreate complementary classesindramaturgyandtextanalysis,itseeks technique, voice,movement,dance,andsinging,aswell industries. Through aseriesofskills-basedmodulesinacting for acareerasanactorintheprofessionaltheatreandrelated to trainstudentsofexceptionaltalentwiththeskillsnecessary This isathree-year, full-time,intensivehonorsdegreedesigned Acting Is thistherightcourseforyou? Acting TR025 Dramaandtheatrestudies,page51 TR001 Dramastudies,page51 See also: be heldbetweenFebruaryand April 2012. for receiptis1February2012. of applications Auditions will movement and group skills will be assessed. The final date attend atleastonemoreroundofauditionswhichvoice, Successful applicantsatfirstauditionwillberequiredto monologue shouldbenomorethanthreeminuteslong. and acontemporarymonologueforfirstaudition.Each Entry isby Audition. Studentswillprepareaclassical Ireland. Academy ofDramatic Art, Trinity College,Dublin2, should bemailedto The Administrator, The Lir–National downloaded nowfrom The Lirwebsite the CAOapplicationsystem. Application formscanbe Dramatic Art @ Trinity CollegeDublin.Itisnotpartof This courseistaughtby The Lir–National Academy of This isarestrictedentrycourse. Special EntryRequirements: DEGREE AWARDED: PLACES 2011: Bachelor in Acting (Hons.) 14 www.thelir.ie and

Arts, Humanities and Social Sciences 117

Career opportunities Further information Assessment The Lir – NationalAcademy of Dramatic Art of Dramatic The course is specifically designed to train actors for the All the training is provided by theatre and related professions. All of dedicated theatre professionals with strong industry links. the final year productions and showcases are designed to attract There is a strong employment opportunities for the students. emphasis in the training on career preparation, and students will be taught not only how to work as an actor but also how to sustain a career as an actor. www.thelir.ie +353 1 896 1550 Tel: Assessment in the Freshman years is based entirely on a is based entirely in the Freshman years Assessment In the in all modules. class presentations series of practical by a series of public assessment is year, final Sophister performances. by the partnership of the Cathal Ryan The Lir was developed opens its doors to the first College Dublin and Trinity and Trust with the It is formally associated 2011. students in September Art. of Dramatic Academy world-renowned Royal The Lir will be closely linked to the ever- by The training offered The Lir industry. changing needs and directions of the theatre professions of film, has also fostered close links with the allied The training will be provided television, radio and new media. in a of the industry, by professionals with extensive experience to teach students from the outset the highest conscious effort The depth and level of international professional practice. by guest lectures breadth of the training will be supplemented figures of stage and and workshops from leading international screen. The Lir will be in an exciting new by The training offered for a range building at Grand Canal Dock, designed specifically design, stage of courses in acting, design, directing, lighting It will feature management, technical theatre and playwriting. capacity of more than a flexible black box studio with a seating a dance studio, 200, as well as 2 further performance studios, teaching spaces to technical workshop, and a range of flexible The Lir’ssuit the training of young theatre practitioners.

Course overview The Sophister (third and final) year Students will be cast in a series of 5 theatre productions, directed by professional theatre directors. Each production will have multiple performances over a 10-day period and will play to invited agents, directors, producers, as well as the general film, directed students will be cast in a short public. Further, by a professional film director and filmed both on set and on The films will receive a public screening. Students will location. also perform an audition showcase before an invited audience of agents and directors. The Freshman (first two) years take compulsory Students in the first two years of the course studies. Voice Acting & text, Movement studies and modules in by professional is by practical workshop and delivered Teaching practitioners. In addition there is considerable individual tuition to supplement the workshops in all aspects of the course. Students will also be introduced to the techniques of acting for recorded At the end of the Senior Freshman media (film, radio, television). (second) year students will combine all the skills developed over the two years of training in their first ensemble production to an invited audience. 1 short film and an audition showcase over the course of the 1 short film and an audition showcase over directors, producersyear which are performed in front of agents, and the general public. This course trains students for careers in the professional This course trains students for careers in strong emphasis is placed on A theatre and related industries. training the actor’s body as an instrument, as well as nurturing the actor’s and creative imagination. It is physically demanding take compulsory requires a high level of stamina. Students Acting & text, Movement studies and developmental modules in studies in the first two years of the course. In the third and Voice in 5 productions, final year of the course students will be cast Only students who are fully committed to pursuing a career as a fully committed to pursuing a career as Only students who are consider this course. Students who are professional actor should applying stage should consider this path at their career unsure of TR001 or Drama and theatre studies – for Drama Studies – TR025 (see page 51). is a crucial part of the student experience. is a crucial part of the While the course offers the possibility to meet theatre the possibility to offers While the course and ongoing basis as well as the practitioners on a regular and recording studios, students are possibility to tour theatres to widen and deepen their knowledge encouraged and expected theatre scene by attending professional of the contemporary events. Being connected to the performances and related right from the beginning of training professional theatre scene The teaching is intense and offers a high degree of individual a high degree is intense and offers The teaching to maintain a healthy students are expected Acting tuition. stamina and demands physical the with cope to order in lifestyle the training. required by 118 Engineering, Mathematics and Science specialisations in: Science –commonentryprogrammewith Mathematics andScience Engineering withmanagement(singlehonordegree) specialisations in: Engineering –commonentryprogrammewith Engineering studies (MSISS) Management scienceandinformationsystems Computer scienceandlanguage Computer scienceandbusiness Computer science Computer science Engineering, MathematicsandScience Genetics Functional biology Environmental sciences Chemistry Biochemistry Mechanical andmanufacturingengineering programme) Electronic andcomputerengineering(joint Electronic engineering Computer engineering Civil, structuralandenvironmentalengineering 148 147 146 144 143 135 133 132 131 129 139 136 126 124 122 120 119 Information systems Direct Entry(non-CAO): Theoretical physics materials Nanoscience, physicsandchemistryofadvanced Medicinal chemistry Mathematics Human genetics Earth sciences Chemistry withmolecularmodelling Single honorsciencedegrees: Zoology Plant sciences Physiology Physics andastrophysics Physics Neuroscience Molecular medicine Microbiology Immunology Geology Geography 149 159 158 157 155 155 154 153 152 151 150 171 169 167 166 164 163 161 160 Engineering, Mathematics and Science 119

Course content Why study Computer science at Trinity College? at Trinity To get the best from the course you need to be interested in you need to be interested best from the course get the To of real world problems clear logical descriptions developing in solution. Proficiency (algorithms) for their and schemes ability to communicate is required and an mathematics most desirable asset. clearly is a to the about computers already, If you are knowledgeable or writing programs for them, so much extent of building them in mind, no prior knowledge of computer the better – but bear and this course will take you far beyond science is assumed, understanding of computer science. the layperson’s This course provides you with a broad and rigorous grounding in computation and computer systems, starting with fundamental topics in mathematics; logic; electrical theory; programming; and computer systems; and the role of computers in society, culminating in advanced topics such as robot vision; virtual design; system hardware intelligence; artificial graphics; reality and other topics from the research areas our lecturers are options subject various from select to able be will You pursuing. in your Sophister (third and fourth) years. The Freshman years The first two years (Junior Freshman and Senior Freshman) will study digital You provide the foundation for the course. hardware; networking concepts; programming languages; low- level programming; information management; and mathematics together with modules on computers in society and a Broad Curriculum module on a subject outside the general area of computer science (see page 13). Individual and group projects are integrated into the course. For example, a typical individual project is the building of a complete microcomputer from basic components. The School of Computer Science and Statistics in Trinity College College Trinity in Statistics and Science Computer of School The of computer in incorporates the oldest and largest department and over 200 Ireland, with in excess of 60 academics lecturers The areas. researchers working in a wide variety of research and 1962 in established was Trinity in science computer of study a close association since then the department has developed in both the private with the computer sector throughout Ireland has earned a strong The Department and public sectors. in education and international reputation and has partnerships universities As one of the leading in research around the world. science degrees are recognised computer Trinity’s in the world, internationally. have the opportunity Students entering this four-year course will integrated to extend their studies and complete a five-year in Computer programme leading to the award of an M.Sc. professional science which meets Engineers Ireland’s to apply for accreditation standards allowing graduates Chartered Engineer status.

Mathematics Mathematics TR033 80 355 B.A. (Moderatorship) M.Sc. HC3 Grade C

Advanced GCE (A-Level) See also: p. 131; Electronic and TR032: Computer engineering, computer engineering, page 133 TR034: MSISS, page 124 TR039: Computer science and language, for 2012) page 122 (Note: this course was renamed page 120 TR082: Computer science and business, COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREES (Note: this course was renamed for 2012) Special Entry Requirements: Leaving Certificate Is this the right course for you? What is Computer science? Computer science Computer Computer science at Trinity College is a challenging and Trinity Computer science at exciting course with a focus on innovation and cutting-edge As It demands the very best from our students. technology. a graduate you will have a thorough knowledge of computer science along with a range of professional skills in teamwork and management. If, for example, you see yourself in a leading team of software developers in computer games, internet software or medical technologies or as a researcher developing innovative technology that will change the way we use computers, then for you. College may be Trinity computer science at Computers have revolutionised almost every aspect of Computers have revolutionised almost every and years, fifty past the in commerce and business science, are rapidly doing the same in healthcare, communications and the internet are computers Today and entertainment. instrumental in the protection of the environment and are central financial systems. In accordance with Moore’s to the world’s power has computer processing and communication Law, been doubling every 18 months or so, and as their capabilities Computer application. of areas new find to continue we increase science gives us the tools to develop these new applications. and cochlear implants. Computer science is the study of everything to do with Computer science is the study of everything The field began computers and our relationship with them. with the pioneering of theoretical discoveries in logic and with the pioneering of theoretical discoveries through calculation in the nineteenth century and continued middle of the last the development of early computers in the when computers have century right up to the present day, much so that we can become powerful and commonplace – so form of pacemakers have them embedded into our bodies in the 120 Engineering, Mathematics and Science including postgraduatediplomas/degreesandresearch. Creed. Manyofourgraduatesundertakefurtherstudies, engine softwareforgamessuchasHalo3and Assassin’s this coursestartedHavok,awell-knowndeveloperofphysics are successfulentrepreneurs.Forexample,graduatesfrom such asmarketingandadvertising.Someofourgraduates and inmanagementdevelopmentrolesmanyfields experts infieldssuchastheengineeringandlegalprofessions; administrators; CIOsandCTOs; securityspecialists;computer as systemdesigners;IT andbusinessconsultants;system and/or forpostgraduatestudies.Ourgraduatesareemployed The computersciencecoursepreparesyouforworkinindustry exchange programme. Belgium, France,GermanyortheU.K.aspartofErasmus You mayapplytospendthirdyearstudyingat a universityin and youwillalsocompletearesearchdissertation. animation; datacommunicationsandwirelessnetworking; advanced topicsincludingembeddedsystems;real-time research methods,youwillcontinueyourstudyofmore In yearfive,inadditiontotakingamandatorymoduleon The M.Sc.year an industry/researchinternship. following thefive-yearintegratedprogrammewillalsoundertake graphics; advancedcomputerarchitecture;andmore.Students topics suchasartificialintelligence;computervision; researchers. The selectionvariesfromyeartoyear, covering to studyarangeofmoreadvancedtopicstaughtbyactive In thefourthyear(SeniorSophister)youwillgetanopportunity of theyear. amount ofsubjectspecialisationisavailableinthesecondhalf software engineering;parsingtechnologies;andmore. A small topics atamoreadvancedlevel,suchassymbolicprogramming; In thethirdyear(JuniorSophister)youwillbegintoencounter The Sophisteryears Tel: +35318961765 E-mail: [email protected] www.scss.tcd.ie/courses/ba Career opportunities Study abroad Further information

theories inbusiness. Overallattheendofcourse graduates and publicsector fromamulti-disciplinaryknowledge basisof be abletoanalyseandsolvea variety ofproblemsintheprivate a businessperspective,attheend ofthecoursegraduateswill applications tomeetdesiredobjectives andspecifications.From evaluate computer-basedsystems, processesandprograms/ graduates willbeabletodesign, implement/engineerand From acomputerscienceperspective,attheendofcourse achieve fullaccreditation. expected thatfurthertrainingorexaminationswillberequired to exist inaccountancyandcomputerengineering.However, itis for professionalaccreditation–example,suchasthosethat in awaythatallowsstudentstofulfilsomeoftherequirements organisers willstructuretheprogramme,insofaraspracticable, still beaminimumrequirementforstudyineachdiscipline. The options incomputerscienceandbusiness,althoughtherewill and fourth)yearswillallowstudentstochooseamongvarious taught intheFreshman(firsttwo)years. TheSophister(third be requiredtocompletecertainmandatorysubjects,largely obtain anadequategroundingineachdiscipline,studentswill science subjectsandarangeofbusinesssubjects.Inorderto Over thefouryearsstudentsengagewitharangeofcomputer for postgraduatestudyandresearchineitherofthesefields. in computer science and/or business, as well as positioning them of fouryearsduration,preparesstudentsforchallengingcareers organisations andbusinessmanagement. The course,whichis skills requiredtounderstandthefundamentalsofmarkets, field ofcomputersciencealongwiththebusinessmanagement the knowledgeandexpertiseneededtoworkintechnical This jointdegreeprogrammeaimstoprovidegraduateswith and business Computer science science Computer Course overview and alanguage,page42 TR085, TR086, TR087, TR089, TR090: Businessstudies TR081: BESS,page37 TR034: MSISS,page124 TR033: Computerscience,page119 TR017: Lawandbusiness,page72 See also: GCSE Advanced GCE(A-level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

Grade C HC3/OA2 Grade A OR and business Computer science B.A. Moderatorshipin 375 30 TR082

Mathematics Mathematics Mathematics Engineering, Mathematics and Science 121

Assessment Career opportunities In the Junior Sophister (third) year, students take a combination students take a combination Sophister (third) year, In the Junior one third be from business, of which one third must of subjects, The subject third from either. science and one from computer follows: optional modules as drawn from a list of choices are Strategic management: theory and practice; International Strategic management: theory and practice; analysis; and reporting Financial change; Organisation business; Managing non- Advances in marketing theory and practice; A Entrepreneurship: profit organisations; Employee relations; finance commercial and social perspective; and International and risk management. Computer science module choices: graphics; Human factors; Distributed systems; Computer Advanced logic; Computer vision; Compiler design II; Fuzzy Advanced computer architecture. telecommunications; and Please note that not all modules are run each year and that the selection of modules is subject to change. Courses are examined by a combination of continuous assessment and formal examination. The B.A. in Computer science and business opens up a wide range of career opportunities as well as further study options. Likely careers for graduates include, but are not limited to, the following: Software developer/Project manager; Chief architecture; Business executive or information officer/IT manager; Consulting (business and/or computer science); Banking/Accounting; Consumer and business to business products and service organisations; Entrepreneur in marketing and Human resources; Operations management; Many roles in the public sector. Business module choices: Business module Operations management; Human resource management; accounting; Marketing management; Financial and management theory and change; and Business Applied finance; Organisation and society. module choices: Computer science programming; Software Applied probability; Symbolic management Information III; architecture Computer engineering; I; Concurrent systems II; Computers II; Concurrent systems Artificial project; and society II; Software engineering group II; Compiler design I; and Telecommunications intelligence I; e-Business I & II. take one students In the Senior Sophister (fourth) year, final-year project. business subject and the computer science a list of optional The remaining subjects can be drawn from modules as follows: Business module choices:

Course content Is this the right course for you? Is this the right (e.g. development of C/C++ applications) or Systems analysis and design. Students take the following computer science subjects: Programming techniques (algorithms, design patterns etc.); Software engineering programming project and Information management, and a choice of either Systems programming Students take six mandatory business subjects (half year courses): Organisational behaviour; Introduction to marketing principles; Introduction to accounting; Financial analysis; Introduction to finance; and Introduction to operations management. In the Senior Freshman (second) year, students take a number In the Senior Freshman (second) year, some choice of subjects in of mandatory subjects but are offered computer science. Students take seven mandatory computer science subjects: Students take seven mandatory computer Mathematics I & II; Introduction to programming I & II (e.g. development of Java applications); Programming project I; Introduction to computing I; and Business computing systems I. Students take three mandatory business subjects: Introduction Students take three mandatory business subjects: to economic to organisations and management; Introduction policy; and Statistical analysis I. In the Junior Freshman (first) year, students take a number of In the Junior Freshman (first) year, science areas. mandatory subjects in business and computer This course is unique in that it allows for the study of computer in that it allows for the study of computer This course is unique interesting and in a contemporary, science and business The computer science subjects will build relevant manner. logical and mathematical skills and upon your problem solving, a deep understanding of the science challenge you to develop your The business subjects will build upon of computers. and your understanding of the role knowledge of businesses science and the networked Computer of business in society. of development environment are core issues at the forefront of computer in many fields of business, and the combination to produce science and business management is designed computer science graduates who not only understand the latest management skills applications but also have general business human resources including marketing, organisational behaviour, identified a need for and finance. Government and industry have business skills, and more graduates with computer science and demand. this joint honours course helps to meet this will be able to apply their knowledge of computer science, of computer science, to apply their knowledge will be able their along with business and management, mathematics, both familiar environments; skills, in new and problem–solving and in Science and Business of Computer within the disciplines workplace. of the modern the wider context 122 Engineering, Mathematics and Science Course website: See page40 E-mail: [email protected] School websites: School ofBusiness? Why choose the Trinity College College Trinity the choose Why Further information www.scss.tcd.ie/courses/bacsb www.tcd.ie/business orwww.scss.tcd.ie

degree, orwithin computationallinguistics. to shapetheirmajor focuswithinoneofthethree strandsofthe well asthirdandfourthyearprojects andoptionstoallowthem strands ofthiscourse.Students choosetheiryearabroad,as Computational linguisticsisadiscipline thatunitesthethree degree level,withemphasison aural,oralandwrittenfluency. The chosenlanguage(French, German orIrish)isstudiedto factors thatimpingeonlanguageuseandlanguagesincontact. process ofhumanlanguageacquisition,andsociological (constraints onsyntax,semanticsandsoundpatterns),the cognitive scienceexplorestheinternalpropertiesoflanguages Linguistics isthescientificstudyoflanguagesingeneral. This of studyincludesoftwareengineeringandartificialintelligence. software andcomputer-relatedmathematics. Advanced areas science, studentslearntheunderlyingfundamentalsofcomputer cultural awarenessinthelanguagecomponent.Incomputer in understandingnovelconceptslinguistics,tofluencyand problem-solving incomputerscience,tomoreanalyticalskills different strandsfosterawiderangeoftalents,frompractical, offered by the University, bridging both science and arts, and its The CSL degreecourseisoneofthemostinterdisciplinary and language Computer science science Computer What isCSL? Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: TR082: Computerscienceandbusiness,page120 TR034: MSISS,page124 TR033: Computerscience,page119 Electronic andcomputerengineering,page133 TR032: Computerengineering,page131; See also: their chosenlanguage. Irish. Studentsmustpresentoneoftheabovegradesin Students chooseonelanguagefromFrench,Germanand

HC3 Grade C Grade B Grade C HB3 HC1 B.A. (Moderatorship) TR013 (525) TR010 (485), TR011 (430), 15 (French), and TR013 (Irish) TR010 (German), TR011 and alanguage(CSLL): Computer science,linguistics This coursereplaces TR039 Mathematics Mathematics French orGerman French orGerman If presentingIrish If presenting If presentingIrish If presenting

Engineering, Mathematics and Science 123

Senior Freshman Senior Freshman (2nd year) Discrete and continuous mathematics Data structures and programming techniques Natural language processing Syntactic theory Introduction to speech science Formal semantics Instrumental phonetics Computational morphology Statistics for linguistics oral and Written, aural language fluency Junior Freshman Junior Freshman (1st year) Mathematics Introduction to programming Introduction to the study of language (general linguistics) Introduction to phonetics and phonology Introduction to syntax oral and Written, aural language fluency Area studies Assessment Computer science Linguistics Language Written examinations, course work and projects are all used Written will also complete a final-year dissertation You in assessment. amounting to a substantial proportion of your overall degree result. (first and second year) modules: second year) (first and The Sophister years computer science Junior Sophister (third year) students study in Belgium, and linguistics at a university abroad (typically on the language France, Germany or Scotland, depending The subjects you study during this year will depend studied). you choose, on the specialist area of the particular university allowing you builda degree specifically focused on your interests and strengths. In the Senior Sophister (fourth) year you will take advanced modules in interdisciplinary areas such as artificial intelligence, information systems, computer processing of human language, and the analysis and synthesis of the human will also proceed to advanced study in your chosen You voice. language, perfecting both your oral skills and your written skills in résumé, translation and essay writing. An optional module and a major interdisciplinary project allow you to specialise in areas you particularly enjoy and to shape the degree around your individual strengths. Examples of final-year module options include computer graphics, databases, fuzzy logic, natural language evolution, and human second-language acquisition. Junior and Senior Freshman

Course content Is this the right course for you? the right course Is this In the first two years, half of the programme is devoted to In the first two years, half of the programme linguistics and your computer science and half to the study of is a theme that chosen language. Computational linguistics A year abroad is an integral unifies the three components. All CSL students also participate in the Dublin Computational students All CSL This weekly seminar is Linguistics Research Seminar Series. rotating annually TCD, UCD, DCU and DIT, hosted jointly by amongst these partners. Seminars vary from industry talks to (the will notice many CSLL You breaking academic research. former course title for CSL) graduates among the world leaders giving these lectures. part of the programme, further developing language skills part of the programme, further developing another in life university of experience first-hand providing and abroad provides additional options that The year country. their own specialist enhance the potential for students to define students the final year offers The areas within the programme. where computers opportunity to explore in greater depth areas of the constituent and language meet or in the classical core a language. disciplines: computer science, linguistics and Students complete increasingly complex projects in each year of the programme. This course offers a unique combination of skills – technical, of skills – technical, unique combination a offers This course so, it In doing analytical and communicative. mathematical, after skills today: degree-level of the most sought provides two and a degree in computing, fluency in a second language career possibilities. Many of these opening up hosts of future the third degree-level competency of the careers also involve text in telephones, automatic course – linguistics. Predictive directory enquiries, and internet search speech recognition in examples of technologies that derive from engines are just three countless others are on the horizon. computational linguistics; to students with strengths in analytical The course is appealing for mastering languages, but who do reasoning and an affinity arts and sciences. While the course not want to choose between 25% on involves 50% focus on mathematics and computing, optional elements allow linguistics and 25% on the language, the their major focus. If students considerable flexibility to rebalance solving and are you enjoy mathematics, languages and problem and insightful ways, interested in combining topics in creative then this may be the right course for you. 124 Engineering, Mathematics and Science Tel: +35318961765 www.cs.tcd.ie/courses/csl possibilities arelimitless. e.g. theEuropeanPatentOffice,IrishDiplomaticCorps. The graduates havetakenupemploymentingovernmentservice, Another 10%tendtowardsafocusintechnicaltranslation.Some beginning withfurtherpostgraduatestudyinIrelandorabroad. is theprimarylanguage);about25%pursueresearchcareers country orinawherethelanguageofdegreefocus in softwareengineering(whetheramainlyEnglishspeaking and secondary-leveleducation. About 65%ofgraduateswork in professionaltranslation;othershavemovedintoprimary international consultingfirms.Somehaveembarkedoncareers multi-media sectors. A numberworkassoftwareengineersin specialists inanyoftheIT, banking,translation,publishingor as languagespecialists,informationtechnologistsorsoftware topics withinthedegree.Graduateswillbequalifiedtowork Graduates havemovedontocareersthatreflecttherangeof Further information Career opportunities in anareaofyour choice. (third andfourth) yearsprovidetheopportunity tospecialise (i.e. builtintothe teachingofothersubjects). The Sophister presentations arebothtaughtexplicitly andimplicitly Interpersonal skillssuchasinterviewing andmaking n n n subject areasare: areas supportedbytheinterpersonalskillsframework. The three The fourstrandsinMSISSareorganisedasthreemainsubject writing andresearching. including teamwork,makingpresentations,interviewing,report The fourthstrandseekstodeveloparangeofpersonalskills concepts in management, finance and operations management. The thirdstrandisbusiness-basedandcoversimportant techniques inareassuchasstrategicinformationsystems. development anddatabases,uptostate-of-the-arttopics/ like spreadsheets,throughprogramming,systemdesignand technology andsystemsrangesfrombasicendusertools, management science. The secondstrandfocusesoninformation mathematics, statistics,probability, datamining,forecastingand around developingskillsinquantitativetechniques,suchas MSISS ismadeupoffourstrands. The firstisbased of MSISSistherangecareersthatgraduatestakeup. flexibility and creative thinking. One of the remarkable features The emphasisinMSISSisonbuildingupanalyticalskills, problems and in particular, problems in business and finance. science, statistics,probabilityandmathematicstosolve technology together with quantitative tools such as management MSISS isaboutusingbothinformationandcommunications

(MSISS) information systemsstudies What isMSISS? Management scienceand Course overview TR081: BESS,page37 TR039: Computerscienceandlanguage,page122 TR033: Computerscience,page119 Electronic andcomputerengineering,page133 TR032: Computerengineering,page131; See also: Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: Information systems Quantitative analysis management Business and

HC3 Grade C B.A. (Moderatorship) 380 40 TR034 Mathematics Mathematics

Engineering, Mathematics and Science 125

one of the best graduate employment records of any undergraduate course in Ireland. the project. You will tackle a real-life, practical problem You the project. in an external organisation. In recent years projects Procter have been undertaken for Merrill Lynch, Dublin Agriculture, and Gamble, the Department of Alzheimer Society of Corporation Credit Union, the Ireland and the Royal Dublin Society to name but a few. MSISS is highly regarded by employershas and A key feature of the Senior Sophister (fourth) year is A

Mathematics Organisation and management Statistics accountingFinance and n n Career opportunities Further information Did you know? Assessment

An integral component of the final year is a project which of the final year is a project which An integral component project for a real world client. takes the form of a consultancy wide and spans The choice of optional subjects is exceptionally statistics, business studies, economics, computer science, The courses currently offered mathematics and engineering. economics, include financial and management accounting, marketing human resources management, mathematics, financial management, investment analysis, corporate and operations reporting, statistical modelling and production management. by a combination of assignments and end- will be assessed You report on the final-year project is A of-year examination. an important part of the assessment. for MSISS Over recent years, the most popular careers management graduates have been in financial services, professions, but consultancy and the actuarial and accounting each year there are students who do something quite different including, in a number of cases, starting their own companies. www.scss.tcd.ie/courses/bamsiss Website: E-mail: [email protected] +353 1 896 1765 Tel: n n n n years The Sophister Sophister (third and fourth) years allow The Junior and Senior that are of particular interest to you. you to focus on areas a number of core courses (five in third In each year there are year) and a range of optional subjects year and three in fourth select one in each of the final two years. from which students

End-user computing Computer programming Economics Management science Research methods Team-working Consulting End user computing Making presentations Interviewing Report writing Statistics Information systems and technology Basic and Oracle) Programming (C, C++, Visual Strategic information systems Management science (operations research) Data mining Market research Mathematics Probability Finance and accounting Operations management Economics Forecasting Introduction to management and organisation Course content Is this the right course for you? the right course Is this

n will get a solid introduction to a number of fields. Subjects you will study include: n n n During the Junior and Senior Freshman (first two) years, you The Freshman years n n n n n n n Personal skills: n n n Information systems: n n n n n n Quantitative analysis: n n n n n The modules covered by main subject areas are as follows: The modules covered by main subject areas Business and management: The range of subjects studied is wide and will challenge your The range of subjects but it leads to graduates who have abilities on several fronts, issues in both technical and business the ability to think about unique – there is no other undergraduate terms. MSISS is quite possibly even in the UK either) which offers course in Ireland (or are highly employable in a world As a result, graduates this mix. of business, technology and numerical where a combination demand. skills are in increasing This course is ideally suited to students who like solving who like solving is ideally suited to students This course complex business. both technology and are interested in problems and 126 Engineering, Mathematics and Science arrive atefficientandpracticalsolutions. to synthesiseandanalyseinformationfromdifferent sourcesto you mustbeaproblemsolver. You mustbecreativeandable and willalsobecapableofworkingaspartateam. Above all, industry andsociety. Ideallyyouwillbeagoodcommunicator new ideasandtechnologytotheshiftingrequirementsof you willneedtobeadaptableboththerapiddevelopmentof Engineering isaconstantlyevolvingprofession. As anengineer, infrastructure. technologies, transportsystemsandtelecommunications advanced materials,sustainableenergysystems,construction They alsoexpandthefrontiersofsocietybydeveloping by developingnewsolutionsthroughinnovativetechnologies. with analyticalanddesignskills. They tackleexistingproblems possible byusingmathematicalandscientificprinciplestogether Engineering isaboutbeingcreative.Engineersmakethings and buildproject. graphics andcomputer-aided engineering,and agroupdesign physics, chemistry, mechanics,electricityandmagnetism, courses inengineeringscience, mathematics,computerscience, years. The JuniorFreshman(first)yearcomprisesintroductory All studentsfollowacommonprogramme forthefirsttwo The Freshmanyears newly emergingareasastheircareersdevelopaftergraduation. continuously trainthemselves,toadaptandmoveintorelated or chosen specialistarea. The aimis thatgraduateswillbeableto of thewholedisciplineandadetailedknowledgetheir accredited engineerswithbothabroad-basedunderstanding by twoyearsofspecialisation.Graduatesareprofessionally grounding intheprinciplescommontoalldisciplines,followed years ofgeneralengineering,providingstudentswithafirm The B.A.I.(Engineering)degreeprogrammeisbasedontwo entry programme) Is thistherightcourseforyou? What isEngineering? Engineering (common Course overview TR038: Engineeringwithmanagement,page136 See also: Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

Grade C HC3 B.A.I. 405 155 TR032 Mathematics Mathematics assessment ineachdiscipline. A substantial designprojectwillbepartofyourfinal-year might findyourselfbuildingamicroprocessorsystem. Heathrow railway;ifyouchoosecomputerengineering, testing thepre-castconcreteusedtobuildPaddington structural andenvironmentalengineeringyoucouldendup undertake real-life,practicalprojects.Ifyouchoosecivil, Subjects arestudiedinmuchgreaterdetailandstudents of thespecialismyouhavechosentofollowdegreelevel. broaden anddeepenyourknowledgeunderstanding Courses intheSophister(thirdandfourth)yearsaimto n n n n n one ofthefivespecialistareas: At theendofSeniorFreshman(second)yearyouchoose What happensnext? n n (M.A.I.). offers severaloptionsfora5thyearleadingtoMastersdegree be directlyeligibleforCharteredstatus. Therefore theSchool Students graduatingafter2012willrequireaMastersdegreeto 5th Year Options available. Timetable difficultiesmayalsoreducethe numberofoptions number ofplacesforstudentsanyoneyearmaybelimited. right toallocatetheavailableplaces.Insomedepartments they choose,theB.A.I.ManagementCommitteereserves While everyeffort ismadetoallowstudentsstudythecourse about whatspecialismtoconcentrateon. possibilities opentoyouinadvanceofmakingyourfinaldecision design andbuildprojects. This allowsyoutoexploreallthe engineering sciencemodulesandcompletetwomoregroup In theSeniorFreshman(second)year, studentstakefurther

This entails spending the 4th and 5thyearin the4thand This entailsspending Trinity College, studentsmay,Suitably qualified attheendoftheir Mechanical and manufacturing engineering manufacturing Mechanical and (jointprogramme) computerengineering Electronic and Electronic engineering Computer engineering engineering Civil, structuralandenvironmental M.A.I. (Domestic) Double qualification withINSA de Lyon project in5thyear. as agroupprojectin4thyearand asignificantindividual undertaking additionalmodules inthespecialisationaswell accreditation inFrance. B.A.I., theDiplômedel’INSA,whichconfersfullprofessional programme TCD studentsmayreceive, inadditiontothe the programme. At theendofafive-yeardoublequalification standard oflanguagecompetencebeforeparticipatingon through Frenchandstudentswillberequiredtohaveahigh Engineering SchoolinFrance.InstructionatINSA deLyon is programme, runjointlywiththeINSA deLyon, thelargest second year, applyfortransfertothedoublequalification

Engineering, Mathematics and Science 127 .

six

Select one of the five specialisations below: Civil, structural and environmental engineering page 129 Mechanical and manufacturing engineering page 135 Electronic engineering page 132 Computer engineering page 131 Electronic and computer engineering (joint programme) page 133 Management for engineers Engineering mathematics Sophister (third & fourth) years Gothenburg; ETH Zurich; Loughborough University; Gothenburg; ETH Zurich; Aachen University; RWTH Politecnico di Milano; de Catalunya, Barcelona. Universitat Politècnica Programme, a consortium of 9 universities and 15 a consortium of 9 Programme, Students will spend corporate partners. multinational followed by a in a partner university one semester one of the corporate partners month internship with M.A.I. (International – Option 2) – Option M.A.I. (International This is offered in collaboration in collaboration with the UNITECH This is offered Technology, Partner universities: Chalmers University of n Thermo-fluids Fluid mechanics – principles of fluid motion; laminar and turbulent flows; pipe flows; free surface flows Thermodynamics – mechanical work processes of closed systems; mass and energy conservation; heat engines; the second law of thermodynamics Electronics Analogue electronics – discrete analogue electronics; linear integrated circuits; analogue/digital conversions Digital electronics – combinational logic; sequential logic; digital circuits Computer science II Basic concepts of computer programming; object-oriented programming; classic data structures; representation and algorithms Solids and structures Mechanics of solids – properties of solids, stress and strain, failure criteria; applications of Structures – pin-jointed structures; analysis beams; design of beams Lectures – 16 hours per week – 5 hours per week Tutorials Laboratory work – 4 hours per week Engineering mathematics III and IV Laplace transform; Partial differentiation; Fourier series and transform; probability theory; vector calculus; linear algebra; optimisation and graph theory Senior Freshman (second) year Programme, a consortium of 12 universities. The student universities. a consortium of 12 Programme, their returns to complete 4th year abroad and spends their Technical partner universities The other are: TCD. 5th year at Universität Technische Barcelona; University of Catalonia, Universiteit Eindhoven; Institut Technische Darmstadt; Técnico Instituto Superior polytechnique de Grenoble; Leuven/Université Catholique Lisbon; Katholieke Universiteit Karlsruhe Technology; University of de Louvain; Helsinki de Ecole Polytechnique Fédérale Technology; Institute of KTH Royal Institute of Torino; di Lausanne; Politecnico Stockholm. Technology M.A.I. (International – Option 1) – Option M.A.I. (International This is offered in collaboration in collaboration CLUSTER with the European This is offered Experimental methods This module introduces students to modern experimental techniques for engineering. The students gain experience with a variety of sensors used in engineering systems and examine the role of error and uncertainty in measurements and analysis. Exposure to and experience in using commercial software for data acquisition and analysis. Provides experience in working in a team in all aspects of the laboratory exercises, including set-up, data collection/analysis and report writing Mechanics and moments forces, laws, Newton’s – Statics couples, equilibrium, analysis of structures, friction, virtual work, hydrostatics Dynamics – kinematics and kinetics of particles and of rigid bodies, simple harmonic motion and vibration Physics – heat, light and sound, laboratory work Computer science I Introduction to computer systems and software; problem solving, algorithms and programming Lectures – 16 hours per week – 5 hours per week Tutorials Laboratory work – 6 hours per week Engineering mathematics I and II integration, Series and limits, differentiation, equations ordinary differential linear algebra, complex numbers, Vectors, introduction to probability and inference Junior Freshman (first) year

Engineering at a glance Engineering at the second year you will select one of five alternative At the end of TR032 follow common first and second years. All students in degrees as outlined below. n 128 Engineering, Mathematics and Science and third)years.Bothcoursescontinueoverthetwo There isanoptionallanguagecourseinFrenchorGerman,with certification,intheSeniorFreshmanandJuniorSophister(second Junior Freshman(first)year organic chemistry General chemistry, physicalchemistry, Chemistry learning andcriticalevaluation. based activityandtofosterself-directing work andcommunicationskillsthroughgroup- creativity andinnovation,todevelopteam work toprovideaframeworkencourage sciences throughlearning-by-doingproject methodology. Studentsapplyengineering Design-Implement-Operate (CDIO)compliant mangonel (catapult)accordingtoaConceive- Students design,buildandtestaRoman Engineering designprojectI independently questions anddeveloptheabilitytowork to getstudentsdealwithmoreopenended analysis skillsandmostimportantlytobegin is topromotecriticalthinkingand political implications. An associatedobjective social, economic,ethical,regulatoryand decisions madeandactionstakencanhave has morethanatechnicalsideandthatall of thecourseistoemphasisethatthisrole engineer andallthatitentails. The keypoint students totheroleofprofessional The aimofthecourseistointroduce Introduction toprofessionalengineering engineering softwaretoolsandpackages practical applicationofcomputer-aided office work,introductiontotheuseand engineering drawingandgraphics, An introductiontothebasicprinciplesof Graphics andcomputer-aidedengineering introduction tocommunicationsystems systems –idealoperationalamplifier, Electronic analogueandcommunication electromechanics, rotatingmachines systems, magneticcircuitsandtransformers, Electrical energysystems– AC power circuits, metersandmeasurements lumped-circuit elements,analysisofelectric Electric circuits–electricalquantities, Electricity andmagnetism Senior Freshman(second)year and positionsensors. autonomous vehiclewithmotor-drivenwheels objective istobuildacomputercontrolled battery holdersandsensors. The design a vehiclethatincludesthemotorassemblies, Each grouphasaccesstothebasicshellof requires teamworkandaco-ordinatedeffort. design’ and the scale of the task is such that it an exampleof‘hardwareandsoftwareco- electronic systemsdesign. The projectis This moduleintroducesthechallengeof Engineering designprojectIII construction ofashelter analysis andcalculations,managethe design problemandcarryoutthenecessary work onamulti-disciplinaryproject,define the teamleaderoramemberand design. Studentsworkingroupseitheras strategies andelementsofsustainable adaptable structure,understandrecycling and buildatemporarydemountable for ahostileenvironment.Studentsdesign the needsofawell-definedspecification project forarefugeeshelterthatmeets This isafullsemesterdesignandbuild Engineering designprojectII pre-stressed concrete;timbertechnology Civil –concretetechnology;reinforcedand and alloys microstructure andheattreatmentofsteel Mechanical –manufactureofmaterials; fabrication processes; p-njunction;semiconductor Electrical –semiconductors;conduction Materials generation anduseofenergy environmental andethicalissuesregarding in engineeringpracticeandthemain To developtheconceptofsustainability the environment public concernaboutprocesseswhichaffect engineering activityandtobecomeawareof environmental issuesassociatedwith To introducestudentstothemain Engineering andtheenvironment Sophister (third&fourth)years

Engineering, Mathematics and Science 129 Students who wish to study Civil, structural and wish to study Civil, Students who apply to the Engineering environmental engineering The first two years are common to degree (TR032). and at the end of the second- all Engineering students Civil, structural and environmental year students select area. engineering as their specialist of the Freshman (first two) years. See page 126 for details Civil, structural and What is Civil, structural and environmental engineering? environmental environmental engineering environmental Transportation The planning and monitoring of our various transport systems, from cycling to high-speed railways, all come under the brief Not only does traffic have to be of the transport engineer. controlled; understanding the decisions that travellers make enables the engineer to influence users to make better choices for the environment and for each other. Civil engineering use and take for Civil engineers design the services that we ensure that we have clean Civil engineers granted every day. and that we have that traffic continues to move running water, it is supplying homes to live in and places to work. Whether hospitals, factories or building water to people or industry, a civil churches, or mining for fuel and other substances, engineer has been involved. Environmental engineering Environmental engineers design the systems that provide us with water for all purposes and the systems that deal with waste. Environmental engineers also design ways of producing power from renewable resources and ensure that development happens in a sustainable way. Structural engineering Structural engineering is a branch of engineering that might involve designing a building, a bridge, a stadium, etc. Structural engineers have to ensure that a building is safe for the area that it is built in and for the purpose for which it is intended. It must also be economical and have a minimum impact on the environment. Civil, structural and environmental engineering is a very diverse Civil, structural and environmental engineering the chance to work in graduates and broad discipline. It offers areas, including designing transport systems, many different for homes looking after the environment, designing foundations Therefore, structures. and buildings and designing many kinds of The of our lives. civil engineers are involved in every aspect a mathematical skills needed to be a good civil engineer are abilities. In mind, a logical approach and good problem-solving to be imaginative addition to these skills a civil engineer needs and inquisitive.

Further information Career opportunities Assessment Tel: + 353 1 896 1142 Tel: www.tcd.ie/Engineering/about The B.A.I. is a professional degree accredited by Engineers The B.A.I. is a professional by a large number of engineering Ireland and is recognised It will be your gateway to a wide and institutions outside Ireland. below for further varying career path. See the specialist areas details of career opportunities. Assessment in each of the first two years is by means of written two years is by means in each of the first Assessment with of the last term combined primarily at the end examination, Typically, during the year. assessment of coursework continuous contribute at least 50% towards your end-of-year examinations entirely The design projects are assessed grade in each subject. by continuous assessment. 130 Engineering, Mathematics and Science n n n n n n n n n n n Junior Sophister(thirdyear)subjectsinclude: construction andenvironmentalimpact. of thejobthatspecificallyrelatetocivilengineeringdesign, and computer-aideddesign,willuseyourinputonthoseaspects expert orauthority. Others,forexamplearchitecture,surveying or watersupply, willrequireyou,astheengineer, tobethesole Some professions,suchasfoundationandhighwayengineering – analyticalandpractical,aswellcreativeenvironmental. The civilengineeringspecialismcombinesauniquesetofskills n n n n n 4th-year optionsinclude: The coresubjectsinclude: civil engineeringsubjectsandfouroptionalsubjects. In theSeniorSophister(fourth)yearyouwilltakefourcore

What willyoustudy? new materials,planning. structures anddesignoftallbuildings. concrete, pre-stressed nonlinearanalysisof Advanced theoryanddesign ofstructures–reinforced Design ofthe built environment rigid, semi-rigidandsimpledesign. steel: introductiontoplastictheory, limitstatedesign, design,structural Structures 1–reinforcedconcrete pressures andretainingwalls. determination, slopestability, bearing capacity, earth Geotechnical engineering conduits, pipenetworkanalysis,pumpcharacteristics. Hydraulics –flowofwaterincircularandnon-circular concepts, wastewatertreatment,airpollution. characteristics, naturalprocesses,processdesign Environmental engineering1 –waterquality in arealcivilengineeringproject. Group design allthekeystages project–replicates designs. Computer-aided design Highway engineering–thedesignofroadinfrastructure. engineering. Geology Hydraulics –thestudyofwatermovementandflow. of thematerialsusedincivilengineering. Materials –thestudyofpropertiesandbehaviour of sustainabletransportsystems. Transportation of thesoil. Geotechnics –thestudyofpropertiesandbehaviour on, orbeneaththesurfaceofearth. determine orestablishtherelativepositionofpointsabove, to Surveying –thescienceoftakingmeasurements structures. construction ofalltypes Structures –thedesignand – thestudyofearthandhowthisaffects –the study of the design and maintenance –the studyofthedesignandmaintenance – theuseofcomputerstocreate – soilstrengthandits – fireengineering,

n n n n Tel: +35318961457 www.tcd.ie/civileng industries. and makethemveryattractiveemployeestomanydifferent skills andexpertisethatcivilengineershavearebroadbased firms andinbusinessareas. The numerical andproblem-solving engineers areoftenemployedinthebankingindustry, inlaw such asconstruction,designandtransportmanagement,civil In additiontoworkinginthetraditionalareasofengineering programme. Europe (France,Germany, ItalyorSpain)aspartoftheErasmus In theirpenultimateyear, studentsgetthechancetostudyin Unitech orClusterprogrammesinyourpenultimateyear. in industry or with aresearchgroup There may also be the opportunity to undertake a more advancedleveloftreatmentthetopicslistedabove. degree qualificationwith to studytowardtheM.A.I.Master’s The optionalfifthyearoftheprogrammewillallowstudents energy forruralhouseholds. the Port Tunnel; LandslidesintheDublin/Wicklowregion;Solar Structural dynamicsande-learning;Vibrations duetotrafficin projects haveincluded:IntelligenttransportsystemsinDublin; approximately 20%toyourfinal-yearmarks.Inrecentyears, The SeniorSophister(fourthyear)projectwillcontribute a stadium,cathedralandanoperahouse. (third year)programme.Inthepast,studentshavedesigned A groupdesignprojectformspartoftheJuniorSophister to ParisandBarcelona. to aninternationallocation.Recenttripshaveincludedvisits interest nationallyandthereisalsoaone-weektechnicalvisit site visitstocivilengineeringworksandareasofgeological and the course involves a lot of project work. Students undertake A significantamountofteachingtakesplaceinthelaboratory,

Further information Career opportunities Study abroad slope andtunnelstability. and groundwaterengineering;rockmechanics,including investigation. mortar andblock;claycementitiousbrick;concrete stone, preservationof Materials –origin,decayand transportation modelling,systems. Transportation engineering countries. water resourcesengineering,especiallyindeveloping Environmental engineering2 –contaminanttransport, Engineering geology andhydrogeology – transportationengineering, or toparticipateinthe – hydrogeology placement

Engineering, Mathematics and Science 131

– file and database – distributed systems models, file servers, naming, systems models, file – distributed Computer graphics – introductionComputer graphics graphics: to computer and animation. modelling, rendering – image processing, vision, object 3D Computer vision with reference to applications in recognition and tracking healthcare, multimedia and robotics. Distributed systems and advanced microprocessor microprocessor systems and advanced Distributed systems and topics and case studies, failure, advanced recovery from computer systems. the architecture of high-performance engineering data Knowledge and structuring and retrieval, and management, information design and operation of rule-based knowledge management; applications, heuristic search and systems, expert system case-based reasoning. An investigation into Sugarscape Automatic visualisation of Java programmes CLP-based printing job scheduler Character comparison using image processing Statistical analysis of non-invasive high speed Genetic algorithms for programme optimisation educational environments Virtual Real-time smash simulation with payment for services Bluetooth IP interconnect data Further information Study abroad Career opportunities

of project areas include: Practical work is emphasised throughout the third and fourth Practical work is emphasised throughout Master’s M.A.I. an to leads which year, optional fifth the In years. methods and a degree, students take a course in research These semester. number of elective courses during the first courses of fourth courses are in general more advanced level semester each year topics listed above. During the second is assessed by a student undertakes a final year project that Some examples presentation and an end-of-year dissertation. www.tcd.ie/Engineering/about/eng_at_tcd +353 1 896 1765 Tel: n n n n n n n n n may choose to spend all or part of the penultimate year You at a European university as part of the Erasmus programme. The demand for software and system designers will continue to grow within the next decade. When you graduate you will find opportunities for employment in software companies, large industrial organisations, research institutions and multinationals in Ireland as well as in Europe, the US and Japan. n n n n In the fourth year, in addition to a course in engineering course in engineering in addition to a year, In the fourth project, you will study: and an engineering management

– – all aspects of the principles, Operating systems and concurrent systems programmes that coordinate, manage and control the allocation of computer resources to other programmes; systems of programmes designed to run alongside one connected in the same processor or in multiple another, processors. Microprocessor systems (including building a microprocessor system) design, construction and characterisation of the hardware and system software of microprocessor-based computers. Computer networks – protocols and behaviour of computer networks. Students who wish to study Computer engineering apply engineering apply wish to study Computer Students who two years The first degree (TR032). to the Engineering of students and at the end to all engineering are common select Computer engineering as the second-year students their specialist area. of the Freshman (first two) years. See page 126 for details What will you study? What is Computer engineering? What is Computer Computer engineering Computer

n n Third year courses cover: n The optional fifth year of the programme will allow students to The optional fifth year of the programme study toward the M.A.I. Master’s more degree qualification with advanced level of treatment of the topics listed above. Computer engineering is about understanding how computer Computer engineering how they integrate with other systems systems work, and also car; a car for example a modern-day Take that surround us. for controlling such contains many separate computer systems be To the air bags. things as the engine timing, the brakes and engineer the computer able to design and construct such a car, all these various needs a broad theoretical understanding of This might involve some sub-systems and how they interact. and fluids as well mechanical engineering, thermodynamics hardware, write Computer engineers may design computer sub-systems together computer programs, integrate the various good management or do all three. Computer engineers need get quickly promoted skills and good people skills as they often to project management positions. The impact of computer engineering has been more significant The impact of computer engineering has been The disciplines. and more pervasive than that of many other are all products mobile phone, the Internet and games consoles but have now been that were not even imagined 30 years ago, realised by the ingenuity of computer engineers. as the computer systems themselves. 132 Engineering, Mathematics and Science Unitech orClusterprogrammes. industry orwitharesearchgrouptoparticipateinthe may alsobetheopportunitytoundertakeaplacementin advanced leveloftreatmentthetopicslistedbelow. degreequalificationwithmore study towardtheM.A.I.Master’s The optionalfifthyearoftheprogrammewillallowstudentsto laboratory accessforindividualworkonyourproject. and 3to4hoursoflaboratorywork. Additionally, youwillhave weekly timetableof14hourslectures,4tutorials A fourth yearelectronicengineeringstudenttypicallyhasa per week. of tutorials,3hourslaboratorytimeandproject subjects. There areapproximately16hoursoflectures,4 seven electronicengineeringsubjectsandfourcore In theJuniorSophister(third)yearyouwillstudyatotalof and systems. needed todesignanddeveloptheseremarkablecomponents Electronic engineersprovidethevitalskillsandinnovation transmit theinformationgeneratedbyeachofthesesystems. technology usedtomonitorordetect,store,processand Electronic componentsandcircuitsarethecornerstone systems, satelliteimaging,opticalfibres,andautomation. mobile phones,internetresources,computers,entertainment In today’s Information Age thereisanever-growinguseof bearing electricalentities. transmission oflow-powerelectronicsignalsasinformation- and systemsfortheacquisition,storage,processing The roleoftheelectronicengineeristodevisesuitablecircuits to improvethequalityofourlives. a widerangeoffunctionsandtheapplicationthese Electronic engineeringinvolvestheuseofelectricitytoperform Course overview What isElectronicengineering? Electronic engineering See page126fordetailsoftheFreshman(firsttwo)years. their specialistarea. the second-yearstudentsselectElectronicengineeringas are commontoallEngineeringstudentsandattheendof to theEngineeringdegree(TR032). The firsttwoyears Students whowishtostudyElectronicengineeringapply There

n n n n n Junior Sophister(thirdyear)coursescover: n n n n n n n n n n n Some examplesofprojectareasinclude: assessed byapresentationandanend-of-yeardissertation. each studentundertakesamajorindividualprojectthatis fourth yeartopicslistedabove.Duringthesecondsemester courses areingeneralmoreadvancedlevelofthe number ofelectivecoursesduringthefirstsemester. These degree, studentstakeacourseinresearchmethodsand In theoptionalfifthyear, whichleadstoanM.A.I.Master’s n n n n n Fourth yearcoursescover: either individuallyorwithinagroup. engineering. Eachfinal-yearstudentalsocompletesaproject, of subjectsthatallowsfurtherspecialisationinelectronic in engineeringmanagement,youwillchooseacombination In theSeniorSophister(fourth)year, inadditiontoacourse

What willyoustudy? Cognitive radio systems Cognitive radio andapplications Probability modelling and mediaprocessing Digital signal Bioinstrumentation Neural engineering characterisation Microphone array adhocnetworks Sensor-based optoelectronicmaterials Electronic and technology Integrated circuit design Electronic circuit networking Communications bioengineering Introduction to Microelectroniccircuits technologyand Microelectronic mediaprocessing processing andDigital Digital signal Telecommunications communications andDigital Digitalcontrolsystems Integrated systemsdesignand of informationoverguidedpathsandthroughfree-space. the principlesofmodulationandcodingfortransmission Telecommunications of electromagneticradiation. and ofthemathematicalcharacterisationtransmission Electromagnetism –theprinciplesofphysicalsystems signals suchasaudioandvideo. methods andalgorithmsfordescribingprocessing Signals andsystems and systemsoftwareofmicroprocessor-basedcomputers. design, constructionandcharacterisationofthehardware Microprocessor systems behaviour whenconnectedtoformcircuits. the principlesofoperationelectronicdevicesandtheir Core elementsofanalogueand digital electronics– – electronic circuits and networks and – electroniccircuitsandnetworks – electroniccircuits,mathematical – allaspectsoftheprinciples, Engineering, Mathematics and Science 133

– all aspects of the principles, – electronic circuits, mathematical Microprocessor systems design, construction and characterisation of the hardware and system software of microprocessor-based computers. and systems Signals methods and algorithms for describing and processing signals, such as audio and video. Core elements of analogue and digital electronics – Core elements of analogue and the principles of operation of electronic devices and their behaviour when connected to form circuits. Students who wish to study Electronic and computer and computer wish to study Electronic Students who the Engineering degree (TR032). engineering apply to common to all Engineering The first two years are of the second-year students students and at the end in Electronic and computer select the joint programme area. engineering as their specialist of the Freshman (first two) years. See page 126 for details What will you study? Electronic and computer computer and Electronic What is Electronic and computer Course overview engineering? engineering (joint programme) (joint engineering

n n In the third year you will study four core engineering subjects In the third year you will study four core engineering There subjects. engineering computer and electronic seven and hours of tutorials, 3 are approximately 16 hours of lectures, 4 time per week. hours of laboratory time and 3 hours of project fourth year electronic and computer engineering student A of 14 hours of typically has a weekly timetable consisting of laboratory work.lectures, 4 hours of tutorials and 3 to 4 hours access for individual work you will have laboratory Additionally, There may also be the opportunity to undertake on your project. group or to participate a placement in industry or with a research in the Unitech or Cluster programmes. The optional fifth year of the programme will allow students to study toward the M.A.I. Master’s degree qualification with more advanced level of treatment of the topics listed above. This degree option blends aspects of both the Electronic engineering (see page 132) and Computer engineering (see page 131) options into one course. Third year courses cover: n Organising both hardware (electronic) and software (computer) Organising both hardware (electronic) and system is the principal components into a useful and productive With a unique job of the electronic and computer engineer. is trained combination of both skill-sets, such an engineer most productive to make design decisions that result in the systems. Further information Career opportunities Study abroad www.tcd.ie/eleceng/undergraduate +353 1 896 1580 Tel: Department of Electronic and Electrical Engineering The careers open to graduates in electronic engineering range from circuit design in electronics companies through network design and management in telecommunications companies to opportunities in business and financial management where the analytic and problem-solving skills of electronic engineers have long been appreciated. You may choose to spend the penultimate year at a European may choose You or Unitech exchange university as part of the Erasmus, Cluster programmes. 134 Engineering, Mathematics and Science n n n n n n n Some examplesofprojectareasinclude: assessed byapresentationandanend-of-yeardissertation. each studentundertakesamajorindividualprojectthatis fourth yeartopicslistedabove.Duringthesecondsemester courses areingeneralmoreadvancedlevelofthe number ofelectivecoursesduringthefirstsemester. These degree, studentstakeacourseinresearchmethodsand In theoptionalfifthyear, whichleadstoanM.A.I.Master’s n n n n n n n n n n n n n n n n n Fourth yearcoursescover: subjects: specialisation between the electronic and computer engineering a combinationofsubjectsthatallowsyoutobalanceyour management andanengineeringproject,youwillchoose In thefourthyear, inadditiontoacourseengineering

Secure lottery-like services over WAPSecure lottery-likeservicesover A application distributedmusicrehearsalstudio scalablepeer-to-peerfile Anonymous, secure,robustand forvideoretrieval eventdetection Impulsive audio usingnetworking artinstallation Interactive distributed ofacampus-basedwireless Design anddevelopment Vectorin pyramidalform ofimages quantisation characterisation Microphone array adhocnetworks Sensor-based optoelectronicmaterials Electronic and technology Integrated circuit design Electronic circuit networking Communications Computer vision Computer graphics dataengineering Knowledge and systems Advanced microprocessor Distributed systems Microelectroniccircuits technologyand Microelectronic mediaprocessing processing andDigital Digital signal Telecommunications communications andDigital Digitalcontrolsystems Integrated systemsdesignand sharing systemfortheinternet information accesssystem of informationoverguidedpathsandthroughfree-space. the principlesofmodulationandcodingfortransmission Telecommunications networks. Computer networks–protocolsandbehaviourofcomputer – electronic circuits and networks and – electroniccircuitsandnetworks www.tcd.ie/eleceng/undergraduate Tel: +35318961580 Department ofElectronicandElectricalEngineering www.scss.tcd.ie/undergraduate/ug-course-list.php Tel: +35318961765 Department ofComputerScience engineers havelongbeenappreciated. analytic andproblem-solvingskillsofelectroniccomputer opportunities inbusinessandfinancialmanagementwherethe design andmanagementintelecommunicationscompanies,to processors forawiderangeofapplications,throughnetwork computer engineeringrangefromdesigningembedded The varietyofcareersopentograduatesElectronicand Unitech exchangeprogrammes. at aEuropeanuniversityoraspartoftheErasmus,Cluster You maychoosetospendallorpartofthepenultimateyear Further information Career opportunities Study abroad Graduate Profile such asBoards.ie, TheJournal.ie and Adverts.ie.” operate someofthebestknownonlinebrandsinIreland media business.It’s nowcalledDistilled Mediaandwe have youhadtodate?:“Daft.iehasgrownintoalarge What didyoudoaftergraduationandwhatsuccesses competitors.” which reallyhelpedusbeatourbiggerandbetterfinanced to businesssuchascriticalthinkingandproblemsolving of theskillsyoulearninengineeringaretransferrable “We launchedDaft.iewhen Iwasinsecondyear. A lot How did Trinity helpdetermineyourcareerdirection?: some juicyprojectworkandaninterestingsyllabus.” way tolearnisthroughself-directedlearning.We had it doesn’thandholdyouwhichisgoodbecausethebest life andImadesomegreatfriendsthere. Academically, with adiversestudentpopulation.Ithasgreatsocial academically andsocially)?:“Trinity isniceandcompact What doyourecallaboutyourtimeat Trinity (both disappointed.” at thetimeforcomputerengineeringandIwasn’t Why didyouchoose Trinity?: “Ithadthebestreputation Eamonn Fallon

Engineering, Mathematics and Science 135

and international engineering projects for the developing world generation etc. biomedical and pharmaceutical products financial services and IT Engineering consultancy companies engaged in national Large public utilities – Local authorities, transport, power Companies manufacturing mechanical, electronic, Specialist areas such as design, engineering management, Study of jet engine exhaust noiseStudy of jet engine exhaust Design and build for ‘Robot an entry Wars’ Design and construction of energy storage devices Pedestrian car impact simulation Making new body parts by tissue engineering Further information Career opportunities Study abroad and work experience work and abroad Study

www.tcd.ie/mecheng + 353 1 896 1383 Tel: As well as the potential for a career in mainstream mechanical As well as the potential for a career in mainstream have found work in or manufacturing engineering, graduates There is airlines. industries as diverse as film production and also a demand for specialist research and development work in research organisations and universities. Opportunities industry, manufacturing engineering graduates in mechanical and for exist to find employment in Ireland and elsewhere in the following areas: n n n n n n n n n part of your fourth year studying abroad can spend You There are opportunities to study or working in industry. Unitech exchange abroad through the Erasmus, Cluster and The Department links with many universities programmes. de Belgium; INSA including Katholieke University of Leuven, KTH, France; INPG Grenoble; Karlsruhe, Germany and Lyon, Sweden. In the Junior Sophister (third) year you will study eight technical technical eight study will you year (third) Sophister Junior the In (fourth) year and optional the Senior Sophister courses. In of from a wide range year you will choose Masters (fifth) suit to degree your tailoring subjects, non-technical and technical in areas of the subject can specialise You your own interests. or manufacturing. aeronautics energy, such as: bioengineering, aspect of this degree and Project work is an important students. to available facility research extensive an is there a major carry out several projects, including will You Some examples of your final year. research project in include: final-year projects

– the mechanical properties – Engineering principles of the human of metals, polymers, ceramics and composites. Bioengineering or the flow of air into a car engine. Mechatronics – the study of electro-mechanical systems, for example the electronic control of engines and manufacturing processes. design – principlesEngineering underlying the correct design of components; computer-aided design. body: design of medical devices and instruments. Fluid mechanics – the study of gases and liquids, Fluid systems – how Manufacturing technology and components are made and how factories are organised. Dynamics – the study of moving bodies and machines, including acoustics and vibrations. Solid mechanics – stresses and deformation Solid experienced by components under service loads. materials Engineering for example the flow of air over the wings of an aircraft, Energy – the study of thermodynamics applied to the creation and use of energy. Students who wish to study mechanical and manufacturing study wish to Students who The the Engineering degree (TR032). engineering apply to common to all Engineering two years are students and first students select Mechanical at the end of the second-year as their specialist area. and manufacturing engineering of the Freshman (first two) years. See page 126 for details What will you study? What is Mechanical and Mechanical and manufacturing engineering? manufacturing manufacturing engineering manufacturing

n n n n n n n n Mechanical engineers are involved in design, testing, inspection Mechanical engineers are involved in design, As components. and manufacture of mechanical devices and professional using a mechanical engineer you will work as a safer place. technology to make the world a better, Course topics include: n its smooth running and efficiency. Nearly all machines used in everyday life – from the car or Nearly all machines used in everyday life or electricity washing machine to the most complex aircraft – have required supply plant to the tiniest surgical instrument Every industrial plant or the skills of a mechanical engineer. engineer for manufacturing operation relies on a mechanical and electronics to metal fatigue and fluid mechanics. and electronics to metal fatigue and fluid This is often seen as the broadest of all engineering This is often seen as the broadest of all engineering from mathematics qualifications as the skills required range 136 Engineering, Mathematics and Science communications. sales, marketing,production,projectmanagementand of disciplinessuchasthemanagementpeople,finances, of engineeringanalysisanddesign,togetherwithanumber upon specialisedknowledgeintheprinciplesandmethods systems ofpeople,finances,materialsandequipment.Itdraws design, improvement,installationandmanagementofintegrated Engineering withmanagementisconcernedtheanalysis, world marketplace. can contributegreatlytoproductivityandcompetitivenessinthe Engineers areindemandbecausetheyseenaspeoplewho must alsoreflecttheglobalcommercialoutlookofcompanies. However, intoday’s market,aqualificationinengineering n n n n n make everythingfrom: somewhere. They havecreatedthedesignsandsystemsto almost every human endeavour, an engineer has been involved analytical skillstohighlycomplexandvariedproblems.In Engineers areproblem-solvers. They applytheirpracticaland develop boththetechnicalandbusinessaspectsofengineering. engineering programmethatisbroadinscopeandaimsto Engineering withmanagementisanexcitingandwide-ranging If anyofthesedescribesyou,then youshouldconsiderthis running acompany, managingprojects,orbeingaconsultant? though, youseeyourprofessional lifemoreinvolvedwith engineering? Doyoulikethediversity ofengineering?Perhaps, Do youlikethecreative,analytical, problem-solvingfocusof

management management? What is Engineering with with Engineering is What with Engineering Is thistherightcourseforyou? TR032: Engineering,page126 See also: Advanced GCE(A-Level) Leaving Certificate SPECIAL ENTRY REQUIREMENTS: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: yachts tothe Airbus A380 thehumanbody artificialjointsfor wheelchairs to matchbox carstoF1racing tolaserprinters ball-point pens craft gliders tospace

Grade C HC3 B.Sc. (Ing.) 390 20 TR038 Mathematics Mathematics level degree(M.A.I.). year) toa2-yearMasterscycle,resultingin5year or proceeding(subjecttosatisfactoryperformanceintheirthird the optionofcompletinga4yearbachelorleveldegree(B.Sc.) Students intheEngineeringwithmanagementprogrammehave with businessandmanagementskills. students whowishtobroadenatraditionalengineeringdegree The syllabusisambitiousanddiversewillappealto management, amongstothers. quality systems,operationsstrategy, andhumanresources comprises managementsubjectssuchasmarketing,finance, modelling, bio-engineeringandmaterials. The remaining20% subjects suchasdesign,automation,computersimulation/ Approximately 80%ofthesyllabuscomprisesengineering with aprovenengineeringprogramme. achieve this,thesyllabusintegratesmanagementsubjects competitive environmentofworld-classmanufacturing. To that producesgraduateengineerscapableofworkinginthe The course is a fully accredited professional engineering degree projects, casestudiesandteamwork. Throughout thecourse,astrongemphasisisplacedongroup n n n n n n the fouryears. These themesare: The courseisstructuredaroundthemesthataredevelopedover strategies implementedbyourworldclassstaff. and hands-onexercises,deliveredthroughactivelearning This reflectsacorebeliefinthevalueofsmall-groupteaching programme isthattheclasssizecappedat20students. A keyfeatureoftheEngineeringwithmanagement careers inthebusinessandfinancialsectors. graduates tocompetefavourablywithgeneralfor and engineeringconsultancy, thebreadthofcourseequips for employmentinresearch,manufacturing,production,design and howyoudoit. As wellasprovidingthecorecompetencies endless possibilities in your professional life, both in what you do course. The diversityandflexibilityofthiscoursewillgiveyou

Course overview What willyoustudy? Management science Management engineering Manufacturing Materials science Design Business General engineering

Engineering, Mathematics and Science 137

4th and 5th years: Final integration of the Final integration of the (B.Sc. professional degrees with or M.A.I.) in engineering management. Project Work: project Substantial engineering emphasising the integration of technical and business The 4th year project solutions. in the case of the M.A.I. will be a group design and The final year build exercise. project in both cases will be a substantial project – with the M.A.I. project accounting for approximately 50% of the 5th year and having a strong research focus, and the B.Sc. final year project accounting for 25% of the final year. Required courses: Advanced manufacturing Supply chain management Engineering options: Micro-manufacturing Thermodynamics Automation and control and acoustics Vibrations Fluid mechanics Biomechanics Mechanics of solids Materials Selected technical options Management options: Operations strategy Management science in practice Strategic information systems New product development Placement/Study Work Abroad range of formal options A are available – see section Masters in Year below on ‘Five Engineering’. Junior Sophister (3rd yr): Junior Sophister (3rd Integrates the professional Integrates the professional with degree in engineering management science. Project Work: Individual and group design projects integrating manufacturing, business, and human factors. Engineering themes: Computer methods Mechanics of machines Solid mechanics Control systems Failure of materials Manufacturing technology Engineering design Management themes: Project management Human resource management Communication Forecasting Information systems Operations management Placement Work Students are encouraged and assisted in finding suitable vacation work between the 3rd and 4th year. Senior Freshman (2nd yr): Senior Freshman (2nd Development of themes in Development of themes Engineering and management year. introduced in the first Project Work: Design projects introducing standards in drawing and design using computer-aided engineering software tools. Group and independent research projects in materials. Engineering themes: Mathematics Mechanics of solids Electronics Materials Thermodynamics Manufacturing Fluid mechanics Engineering design Management themes: Accounting and finance Statistical analysis

Course content Course Junior Freshman (1st yr): Junior Freshman (1st A foundation year that will foundation year that A introduce you to many of the basic concepts in Engineering with management. Project Work: Individual and group projects on designing new product concepts and experimental methods. Engineering themes: Mathematics Physics Chemistry Computer science Engineering science Manufacturing Engineering design Management theme: Management science Engineering with management at a glance at a with management Engineering class, the larger engineering are shared with Several of the courses engineering degree. pursue an accredited TR038 Students in TR038. to students but the vast majority are unique MSISS and business and third) years. Both courses continue over the two years. There is an optional language course in French or German, with certification, in the Senior Freshman and Junior Sophister (second There is an optional language course in French or German, with certification, in the 138 Engineering, Mathematics and Science n n n 3 principalroutesareavailable: eligible for professional accreditation with Engineers Ireland. qualifications (e.g.further/alternativepost-graduate study) to be graduate after four years with the B.Sc. degree will require(Masters inEngineering)degree. Those studentswhochooseto additional a 2yearMasterscycle,whichwillleadtotheawardofanM.A.I. satisfactory academicstandardintheir3rdyearmayproceedto business andmanagementcomponent.Studentswhoachievea comprising bothtechnicalengineeringsubjectsandasignificant The B.Sc.degreeprogrammeisbasedona4-year Five Year MastersinEngineering Tel: +3531896 1383 www.tcd.ie/mecheng/bsc Engineers, PWC Accountancy, Accenture, ReckittBenckiser. Stockbrokers, Wyse Pharmaceuticals,DenisWoods Forensic IBM, Intel,ProjectManagementGroup,JP Morgan,Davies of optionsavailable.Pastgraduatesarecurrentlyworkingin broad, butthefollowinglistmaygivesomeideaofrange working environments.Careeropportunitiesareextremely Graduates willbeabletoadaptawiderangeofcareersand as wellinthebroaderbusinessandfinancialsectors. careers inprojectmanagementandconsultancy The qualificationisalsowellsuitedtothosewhowishpursue managers, financialcontrollers,marketingandsalespeople. project managersonteamswithdesignandtestengineers, (e.g. design,fabrication,assembly). They oftenworkas pharmaceutical, electronic) as well as traditional manufacturing to jobsinthehigh-techsector(e.g.computer, aerospace, and engineeringmanagementfields.Graduateswillbesuited that willallowthemtoexcelquicklyinboththeengineering Graduates oftheprogrammewillhaveawiderangeskills assessment. courses, such as design, are assessed completely by continuous (laboratory andtutorialassignments)projectwork.Some Assessment isbywrittenexamination,continuousassessment

Further information Career opportunities Assessment An integrated 2yearcyclebasedin An integrated TCD, comprisingan 6-8months)inthe4th period (approximately An extended yearistakenabroadatanapprovedpartner The entire4th approved combinationofprojectworkandlectures. project. advanced levelmodulesandasubstantial TCD andcompletetheirstudieswithanappropriaterangeof formal industrialplacement,afterwhichstudentsreturnto year isspentateitheranapprovedpartneruniversity, orina modules andasubstantial their studieswithanappropriaterangeofadvancedlevel university, afterwhichstudentsreturnto TCD andcomplete research-based project research-based . Engineering, Mathematics and Science 139 In two of: physics, Mathematics chemistry, biology, biology, chemistry, mathematics, geography geology, or applied mathematics chemistry, biology, biology, chemistry, mathematics, physics/chemistry, geography, geology, applied mathematics or agricultural science In two of physics, Mathematics

TR071 340 455* B.A. HC3 Grade B Grade C HD3 or OC3 or HD3

Advanced GCE (A-Level)

COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE Special Entry Requirements: Leaving Certificate See also: 160-169 TR031, 035, 073, 074, 075, 076, 077: pages Combinations of subjects not permitted: Physics/chemistry with physics or chemistry Agricultural science with biology Applied mathematics with mathematics GCSE Is this the right course for you? Course overview Science (common entry programme) Science at Trinity College leaves plenty of room for flexibility and College leaves plenty of room Trinity Science at is ideal if you want to explore the many avenues open to you as a scientist. Even if you already know what you want to specialise in, you will find that employers value the benefits of a broad- based scientific training and background. It is precisely because of the scope and variety of this field of with choice in College is structured Trinity study that science at mind. Courses in the first two years are designed to introduce you to and train you in the fundamental sciences. By the end of the Senior Freshman (second) year you will have moved far beyond the extent of science as it is taught at school and will At this point you understand better where your real interests lie. have the opportunity to focus on one of sixteen specialist areas for your final two years. Science is a small word and yet it conjures up the whole spectrum and sum of human knowledge about the natural world. So where do you begin? 140 Engineering, Mathematics and Science TR071 Scienceataglance and themethodologyofscientificresearchfromfirstyear. classes, soyouwillbecomefamiliarwithlaboratorypractice Teaching isbylectures,seminars,tutorialsandlaboratory Topics include: 4th years. the physicsdegreeoptionsin3rdand take thiscoursemaynotoneof scientific investigation.Studentswho you totheprinciplesandrulesgoverning course thatwillintroduce is alessdetailed taking mathematicsasafullsubject. This and computingforfirst-yearstudentsnot A short foundationcourseinmathematics Mathematical methods(10credits) n n n n n n n n n n n branches ofscience. mathematical trainingsuitableforall a fullsubjectandprovidesbasic This courseteachesmathematicsas Mathematics (20credits) Mathematics canalsobestudiedasasinglehonorsubjectseepage164. 4th yearspecialisation),seepages143-159forfurtherdetails. sciences. StudentsmustbeawarethattheirchoiceofJuniorFreshmansubjectscanaffect theirchoiceof moderatorship(3rdand Biology; Chemistry;Geography;Geology;Mathematics;Mathematicalmethods;Physics;Foundationphysicsforthelifeandearth 1-4, onpage141. Students choosesubjectsfromthefollowingtoatotalof60credits. The suggestedcombinationsofsubjectsareshowninPatterns Junior Freshman(firstyear)

Course content Differential equations equations Matrices, linear Integration derivatives, Functions, graphs, computing Introduction to statistics Probability and Computing Differential equations Linear algebra Partial derivatives Calculus maxima andminima

Chemistry CH1101 (10credits) and inothersciences. for furtherstudies,bothinchemistry modern chemistry, andformsthe basis introduction tothefundamentalsof The courseprovidesageneral Chemistry for Biology1102 Biology 1101 isaprerequisite n n Biology 1102 (10credits) n n n n Biology 1101 (10credits) Topics include: of modernbiology. Broad-based traininginthefundamentals Biology n n n n n n

The solid-state, gaslaws, The solid-state, Electrochemistry, acidsandbases of Atomic structureandprinciples The Periodic Table andstoichiometry thefundamentalsof Introduction to chemistry General andphysical Ecology biology Plant andanimal Microbiology biology Developmental Genetics molecularandcellular Introduction to kinetics thermodynamics, equilibriaand bonding chemistry biology typically average24classcontacthoursperweek. support thematerialpresentedinlectures.Sciencestudents given at both basic and advanced levels to explain, expand and students inafriendlyandinformalatmosphere. Tutorials are will also be able to discuss course work with lecturers and other Smaller seminarclassesandgrouptutorialsmeanthatyou Geography 1021(10credits) n n n n n n n n n n n n n n n Geology 1101 (10credits) n n n Topics include: required forthiscourse. Previous knowledgeofphysicsisnot Physics (20credits) Geography 1022(10credits)

landscape development Surface processes and Surface processes Global geosystems Global geoecology Global atmospheric Climate change Exploring the universe Exploring the Origins ofmodernphysics interactions Electromagnetic Hearing andseeing The materialworld motion The physicsof Anatural Livingwith delicate balance: Historyoflifeon The livingplanet: Earthasadynamic Earth inspace: include: Geology topics hazards Environmental degradation Environmental Conservation hazards andEarth’s resources chemical andbiologicalsystems Earth andinteractionofthephysical, physical system and oceanicsystems

Engineering, Mathematics and Science 141 Physics – foundation physics for the foundation physics Physics – sciences (10 credits) life and earth course of lectures, practical foundation A the following work and tutorials including biomechanics, topics: physics of motion, seeing, electricity physics of hearing and and magnetism and bioelectricity, nuclear physics and related radioactivity, heat, pressure and medical applications, geological fluids and their biological, No previous and medical applications. is required. knowledge of physics group chemistry and organic chemistry and organic coordination chemistry Aliphatic and aromatic functional Introduction toIntroduction systematic inorganic and Aspects of main group

Chemistry CH1101 is a prerequisite is a prerequisite Chemistry CH1101 for Chemistry CH1102 n Chemistry CH1102 (10 credits) CH1102 Chemistry n n Chemistry CH1102 Biology 1102 Geology 1101 Geography 1022 Foundation physics Chemistry CH1102 Biology 1102 Geology 1101 Geography 1022 Foundation physics Chemistry CH1102 Biology 1102 Geology 1101 Geography 1022 Chemistry CH1102 Biology 1102 Geology 1101 Geography 1022 Semester 2 Pattern 2 Pattern 3 Pattern 4 Pattern 1 Mathematics and four of the following (two from each semester) Chemistry CH1101 Biology 1101 Geography 1021 Mathematical methods and five of the following (two from semester 1 and three from semester 2) Chemistry CH1101 Biology 1101 Geography 1021 Three from each semester Chemistry CH1101 Biology 1101 Geography 1021 Mathematics Physics and two of the following (one from each semester) Chemistry CH1101 Biology 1101 Geography 1021 Semester 1 Junior Freshman (1st year) Course Outline Junior Freshman (first year) Junior Freshman 142 Engineering, Mathematics and Science +353 18961970 or If youneedmore informationonthe TR071 Science courseoutline,pleasedonot hesitatetocontacttheScience CourseOffice, Geography, p.149 Genetics, p.148 Functional biology, p.147 Environmental sciences,p.146 Chemistry, p.144 Biochemistry, p.143 Select oneof: Junior andSeniorSophister(thirdfourthyears) n n n components andaimsto: This moduleisdividedintothree of geographicaldata(10credits) GG2022: Collectionandanalysis n n This modulewillcovertopicsin: GG2021: Changingworlds(10credits) Geography (20credits) n n n n n Mathematics (20credits) in the3rdand4thyear(seepages143-159forfurtherdetails) Students mustbeawarethattheirchoiceofFreshman(1stand2ndyear)subjectscanaffect theirchoice ofspecialisation Biology; Mathematics;Chemistry;Geography;Physics;Geology Students choosethreesubjectsfromthefollowingtoatotalof60credits: Senior Freshman(secondyear)

Develop students’ skills geographical toselect Enable students toavarietyof Introduce students Physical geography Human geography MA22S6: Numericaldataanalysis MA22S4: Mechanics(5credits) MA22S3: Fourieranalysisforscience MA22S2: Vector calculusforscience for MA22S1: Multivariablecalculus interpretation andexplanation. manipulation, analysis,display, of numeracydatamanagement, geographical issues appropriate methodstostudydiverse analysis andresearch methods ingeographicalstudy, techniques (5credits) (5 credits) (5 credits) science (5credits) [email protected]

Physics, p.155 Neuroscience, p.154 Molecular medicine,p.153 Microbiology, p.152 Immunology, p.151 Geology, p.150 n n n n n n n n n n n n n n Geology (20credits) from thefollowing: Students choose5creditmodules Biology (20credits)

GL2204: Structuralgeology, kitchen GL2203: Petrology(5credits) and GL2202: Palaeontology (5credits) GL2201: Mineralogy ananimal BY2210: Plant BY2209: Infectionandimmunity BY2208: Genetics(5credits) (5credits) BY2207: Behaviour BY2206: Ecosystembiologyand BY2205: Microbiology(5credits) (5credits) BY2204: Evolution BY2203: Metabolism(5credits) BY2202: Vertebrate formandfunction structure andfunction BY2201: Cell (5 credits) physics andmapwork(5credits) stratigraphy: (5credits) global change(5credits (5 credits) bio-resources (5credits) (5 credits)

Zoology, p.159 Plant sciences,p.158 Physiology, p.157 Physics andastrophysics,p.155 n n n n n n n This modulewillcovertopicsin: CH2202 (10credits) n n n n n n n n n of modernphysics: This modulecombinesfourelements PY2P20: Modernphysics n n n n of classicalphysics: This modulecombinesfourelements PY2P10: Classicalphysics: Physics (20credits) This modulewillcovertopicsin: CH2201 (10credits) Chemistry (20credits)

Molecular modelling Organic spectroscopy organicsynthesis Introduction to Chemistry ofaromaticcompounds quantumchemistry Theoretical and inorganic Nuclear andmedicinal Main groupchemistry organicsynthesis Introduction to Chemical kinetics Chemical thermodynamics chemistry Coordination theory Molecular orbital Observing the Universe Observing the Nuclear physics Quantum physics Special relativity Thermodynamics introduction Physical optics: Oscillations Current electricity chemistry

Engineering, Mathematics and Science 143

Protein science Membrane biology Cellular regulation Immunology Eukaryotic gene structure Students who wish to study Biochemistry apply to the apply to the wish to study Biochemistry Students who select Biochemistry (TR071) and may Science degree and 4th years. area for the 3rd as their specialist year) prerequisites: Chemistry Junior Freshman (first or Also, Mathematics and Chemistry CH1102. CH1101 Mathematical methods. year) prerequisite: Biology Senior Freshman (second and BY2208. BY2201, BY2203, BY2205 two years of the Science course, For details of the first see page 139. including entry requirements, What will you study? Biochemistry What is Biochemistry?

of new drugs and therapies for cancer, infectious diseases, infectious of new drugs and therapies for cancer, and other pathological conditions. year provide a The courses in the Junior Sophister (third) fundamentals of broad knowledge and understanding of the cells to the complex biochemistry– from the behaviour of simple being. development and organisation of the human include: Topics n n n n n forms an essential research project in the area of biochemistry A Examples of research part of the Senior Sophister (fourth) year. areas from which topics may be chosen include drug design and immunology, parasitology, neurobiology, development, cancer, School of Biochemistry and The metabolism and cell signalling. Immunology also has the best facilities in Ireland for studying the 3D structure of the molecules of life. Biochemistry is the study of the molecular design of life. It Biochemistry is the study of the molecular and function of the provides an understanding of the structure This and RNA). building blocks of life (proteins, lipids, DNA as it helps us subject area is also an integral part of medicine, and disorders to understand the mechanics of how disease where biotechnology, of component essential an also is It occur. fuels, and enzymes processes for the production of foods and of the structure or other proteins are developed. Knowledge also useful for the of proteins implicated in human disease is companies have All major pharmaceutical design of new drugs. help aid their pipeline significant investment in biochemistry to Further information Study abroad www.tcd.ie/Science E-mail: [email protected] +353 1 896 1970 Tel: You will have the option to study abroad in the Junior Sophister You (third) year in most science courses. In the past, for example, Australia, and in a students have studied in the USA, Canada, variety of universities throughout Europe. Optional language classes are available to you in first and second year (see page 13) to facilitate this. Some departments will also actively encourage you to spend your summer months working abroad in a research laboratory. 144 Engineering, Mathematics and Science Tel: +35318961608 www.tcd.ie/Biochemistry management, accountancy, patentlawandmerchantbanking. such ascommunications,informationsystems,teachingand in highdemandcareersnotdirectlyrelatedtobiochemistry communication skills.Consequently, ourrecentgraduatesare critical thinking,analyticalreasoningandpresentation Biochemistry graduatesbenefitfromtheirtrainingintermsof biotechnology, foodscience,pharmaceuticalsordiagnostics. work inhospitalsandcommerciallaboratoriesdealingwith or academicresearch. Alternatively, youwillbequalifiedto and subsequentlytakeupacareerinindustrial,medical decide tocontinueyourstudiesatthepostgraduatelevel biochemistry, cellbiologyandmolecularbiology. You may This courseequipsyoutoworkinallmajoraspectsof university intheUnitedKingdom,FranceorGermany. opportunity forstudentstospendtheirthirdyearstudyingina The SchoolparticipatesinanErasmusschemewhichoffers the Further information Career opportunities Study abroad and electro-responsivematerials,polymerscatalysts. applications asdiversepharmaceuticalsanddrugs,photo- engineers involvedindevelopingnoveltargetcompoundsfor health, medicinesandcommunications.Chemistsaremolecular to modernlifestyleinareasasdiversefoodproduction, and chemicaltechnologyarevitalverymajorcontributors environmental sciencewouldnotbepossible.Modernchemistry disciplines suchasmaterialsscience,molecularbiologyand Chemistry isacentralscience.Withoutit,manymodern n n n disciplines: Junior Sophister(thirdyear)courseswillcoverthethreemain spectroscopic analysesandcomputer-based modelling. chemical techniquesandwillalso beabletocarryoutyourown where youwillgainexperience in moresophisticatedpreparative Lectures arecomplementedby laboratoryexperimentalclasses option oftakingcomplementarycoursesfromotherdisciplines. computer programming,mathsandphysics,youhavethe In additiontherearecoursesonenvironmentalchemistry,

What isChemistry? Chemistry What willyoustudy? materials, seepage167. TR076: Nanoscience,physicsandchemistryofadvanced TR075: Medicinalchemistry, seepage166. TR074: Chemistrywithmolecularmodelling,seepage160. Chemistry isalsoanintegralpartofthefollowingcourses: including entryrequirements,seepage139. For detailsofthefirsttwoyearsSciencecourse, CH2201 andCH2202. Senior Freshman(secondyear)prerequisite:Chemistry Mathematical methods. CH1101 andChemistryCH1102 plusMathematicsor Junior Freshman(first)yearprerequisite:Chemistry years. Chemistry astheirspecialistsubjectforthe3rdand4th apply totheSciencedegree(TR071)andmayselect Students whowishtostudyChemistryfortheirdegree chemisorption andcatalysis electrochemistry, thermodynamics, analyticalchemistry, chemistry, spectroscopy, quantumchemistry, kinetics, Physical chemistry–macromoleculesandinterfacial mechanisms, aminoacidandpeptidesynthesis stereochemistry, heterocyclic chemistry, reaction Organic chemistry–organicsynthesis,spectroscopy, of compounds,inorganicpolymers spectroscopic methods, identification and characterisation catalysis, grouptheory, bio-inorganicchemistry, chemistry,Inorganic chemistry–organometallic

Engineering, Mathematics and Science 145 in the cutting-edge areas areas cutting-edge the in in the traditional areas of chemistry (organic, inorganic inorganic (organic, chemistry of areas traditional the in and physical chemistry), the School of Chemistry has research strengths materials and medicinal and biological chemistry, of Students nano-chemistry and computational chemistry. can select a range of lecture courses from topics as polymers biological cancer, of chemistry the as diverse and synthetic materials, metal chelation therapy, catalysis and molecular recognition and synthetic receptors, providing fascinating illustrations of the These topics are basic modes of chemical reactivity. used to review important chemical principles, to gain and to become insight into the history of discovery, acquainted with cutting-edge research that fills the pages of the scientific literature and occasionally enters those of the popular press. As well as offering a broad choice of topics for study As well as offering

n Further information Did you know? advisory and information services, libraries, public analytical advisory and information services, libraries, also employ laboratories, schools and third-level institutions postgraduate research chemists. Or you may decide to carry out College or in another Trinity leading to a higher degree either in successful routes university in Ireland or abroad. Other equally careers in the business graduates have taken in the past include and financial services sectors, and in management. www.tcd.ie/Chemistry +353 1 896 1726 / 2040 Tel: research Career opportunities Assessment Study abroad The chemical and pharmaceutical industries, which contribute Trinity exports, are excellent employers of some 20% to Ireland’s chemistry graduates. Former graduates of chemistry College’s Glaxo-Smith- are working in companies such as Henkel, Pfizer, Kline and Bristol Meyers Squibb. Patent offices, government You will be assessed by a combination of continuous You assessment and end-of-year examinations. The School of Chemistry has exchange agreements with a The School of Chemistry has exchange agreements large number of other universities where students carry out their final-year research projects, from September to December. Centres where students have completed their research projects Toulouse Berlin, Bologna, in recent years have included Vienna, and Utrecht in Europe and McGill and Duke Universities in North The areas of research cover modern chemical interests America. through chemistry, such as cancer chemotherapy and DNA device fabrication and materials processing, to homogeneous catalysis and supramolecular chemistry. In the Senior Sophister (fourth) year, lectures consist of core lectures consist In the Senior Sophister (fourth) year, of optional courses fundamental material and an extensive range interests. particular own her/his develop to student each allow that extended The practical component of this year is an which you will carry out from September to December. December. project which you will carry out from September to College or in an academic This may be conducted in Trinity wide range of projects at the forefront of laboratory abroad. A areas located chemistry are available within the many research in the School. 146 Engineering, Mathematics and Science ecology, andaMediterraneanfieldtrip. the possibilityofstudentstoattendfieldcoursesin Terrestrial optional tripsoffered byZoologyandPlantsciencesallow attend, aswellamandatoryintroductoryfieldtrip.Inaddition, students haveachoiceofuptothreefieldtripswhichtheycan attend fieldexcursionsintheirJuniorSophister(third)year; Field workisacorecomponentofthecoursestructure.Students for aselectionwhichreflectsparticularstudent’s interests. There shouldbeamplechoicewithinthelistedoptionalmodules modules plussuitablefromcontributingdisciplines. professional field. Theprogrammecomprisesspeciallydesigned students withaninterestinthisrapidlydevelopingacademicand Natural Scienceshasbeendesignedtoprovidefortheneedsof The undergraduatedegreecourseoffered bytheSchoolof law andthesocialsciences. required which may also involve an understanding of economics, applied totheenvironment. A broadscientificknowledgeis is similartootherphysicalorlifescientists,butspecifically our environment.Environmentalscientistshavetrainingthat between thebiological,chemicalandphysicalcomponentsof research discipline–astudyofthevariousinteractions Environmental sciencesisbyitsnatureamultidisciplinary n n n n fieldwork classesinareassuchas: Teaching isbylecture,seminar, practicallaboratoryand

What isEnvironmentalsciences? Environmental sciences What willyoustudy? including entryrequirements,seepage139. For detailsofthefirsttwoyearsSciencecourse, BY2205, BY2206,BY2207,BY2208,BY2209,BY2210. following: BiologyBY2201,BY2202,BY2203,BY2204, Senior Freshman(secondyear)prerequisites:4ofthe & 1102. Junior Freshman(firstyear)prerequisites:Biology 1101 third andfourthyears. Environmental sciencesastheirspecialistsubjectforthe directly totheSciencedegree(TR071)andmayselect Students whowishtostudyEnvironmentalsciencesapply Environmental chemistry Environmental change Global environmental Water technology governance Environmental Tel: +35318961274 www.tcd.ie/Botany/undergraduate/environmental-science industry. for takingahigherdegreeorpursuingcareerinbusiness county councils. The course alsoprovidesanidealbackground consultancy orareworkingwithregulatoryauthoritiesand awareness. Manygraduatesmovestraightintoenvironmental the worldwidedemandgeneratedbyincreasingenvironmental As agraduateinthisareayouwillbeabletotakeadvantageof management andgreenhousegasemissions. waste management,restorationecology, waterquality, habitat In thepast,studentshaveundertakenprojectsonairpollution, will researchandwriteathesisonanenvironmentalproject. information systems.IntheSeniorSophister(fourth)yearyou angiosperm diversityandsystematics,geographical and pollution,stableisotopesgroundwaterquality, experimental design,earthsurfaceprocesses,bioindicators ecology, freshwater biology, environmental history, statistics and Joint moduleswithotherdisciplinesincludefundamentalsof Further information Career opportunities Engineering, Mathematics and Science 147

Plant molecular genetics I Gene expression Broad curriculum (see p. 13) Comparative physiology of eyes and vision Environmental physiology Plant molecular genetics II Plant developmental genetics. Comparative physiology Plant physiology metabolism Plant structure, anatomy, Applied lab techniques Plant molecular biology Developmental biology Parasitology Experimental design and analysis Neurogenetics Further information Career opportunities What will you study? What will A major component of the Senior Sophister (fourth) year is A in specialist areas of functional Tutorials the research project. modules, including biology are also selected as well as taught the following: www.naturalscience.tcd.ie/undergraduate/functional- biology.php +353 1 896 1366 Tel: n n n n n n n Functional biology acts as the perfect springboard for undergraduate students to go on to post-graduate bioscience degrees; e.g. Masters and Ph.D.s in biological/physiological disciplines. Graduates of Functional biology are also ideally placed to contribute to the knowledge economy/society through having careers with biotechnology companies and/or industry, The course gained unique and valuable experience and training. also provides an excellent background for students who want to pursue a career in teaching biology. This course focuses on comparing and contrasting animal and and contrasting animal focuses on comparing This course the disciplines of are provided from Modules plant physiology. Genetics from the School of and Zoology and Plant sciences (third) year provides a The Junior Sophister and Microbiology. while understanding of Functional biology, broad knowledge and component of the course is a lab-based in the final year a major from the disciplines of Plant sciences research project chosen small-group Final-year teaching also occurs through or Zoology. in plant or animal Functional tutorials in areas of specialisation lectures. biology as well as through a broad Junior Sophister (third) year provides in the Work biology and includes core modules in: overview of functional n n n n n n n n n

Students who wish to study Functional biology apply to Students who wish to and may select Functional the Science degree (TR071) area for the 3rd and 4th years. biology as their specialist 1101 year prerequisites: Biology Junior Freshman (first) Mathematics or Mathematical methods & 1102, year) prerequisites: Biology Senior Freshman (second BY2208. BY2201, BY2202, BY2203, two years of the Science course, For details of the first see page 139. including entry requirements, What is Functional biology? Functional biology – the – the biology Functional comparative physiology physiology comparative of organisms Functional biology is the comparative physiology of plants and Functional biology is the comparative physiology kinds of organisms animals; i.e. comparing the way different Many of the function in the context of their structure (anatomy). conserved across mechanisms organisms use for survival are principles. species, allowing the revelation of key functional have evolved Furthermore, the mechanisms which organisms through depend on their interactions with the environment Functional biology has important roles to play time. Finally, mutations and/or deletions of gene in elucidating the effects on gene protein function and environmental effects affecting expression. 148 Engineering, Mathematics and Science n n a combinationoflectures,tutorialsandpracticalcourses. man, andotheranimalsplants.Subjectsaretaughtthrough Courses coverthemoleculargeneticsofbacteriaandviruses, of organisms. this, the genetics course covers a wide field and all major groups and isincreasinglyimportantinmodernmedicine.Reflecting of organismsandtheevolutionspecies.Itiscentraltobiology everything from how cells work to the physiology and behaviour how theywork.Geneticsprovidesanapproachtostudying molecular biology, which has figured out what genes are and phenotypic traitsareinherited–andthemodernfieldof Genetics encompasses both the science of heredity – how n n n n n What willyoustudy? What isGenetics? Genetics see page163. students shouldapplytocourse TR073 –Humangenetics Alternatively, tostudyhumangeneticsexclusively, including entryrequirements,seepage139. For detailsofthefirsttwoyearsSciencecourse, BY2201, BY2203,BY2205andBY2208. Senior Freshman(secondyear)prerequisites:Biology Mathematics orMathematicalmethods. CH1101, ChemistryCH1102, Biology1101 and Junior Freshman(firstyear)prerequisites:Chemistry specialist areaforthe3rdand4thyears. degree (TR071)andmayselectGeneticsastheir Students whowishtostudyGeneticsapplytheScience development andphysiology. thatcontrolplant Plant genetics:studiesthegenes populations andtheroleofthis variation inevolution. Population genetics:geneticvariationin dealswith processes thatdriveevolution. evolutionary relationshipsbetweenorganismsandthe Bioinformatics andevolutionary genetics: organism. different cellscontrolthedevelopment andgrowthofan Developmental genetics:investigateshowgenesin cell death,proliferationordifferentiation. processes inanimalorhumancellsandbacteria,suchas gene expressionandfunctionofgenesinvariouscellular Molecular andcellbiology: behaviour andpsychiatricdisease. and functionofthenervoussystemtheirinfluenceson controlthedevelopment Neurogenetics: studieshowgenes of geneticandstem-celltherapiestotreatthem. causing variousclinicaldisordersandthedevelopment identificationofgenes Medical genetics:includesthe explores thecontrolof investigates

human evolutionarygenetics. cancer genetics,geneticsofvision,behaviouraland responses orplantgenetics.Specialistlecturecoursesinclude blindness, celldeath,neuraldevelopment,bacterialstress an originalresearchprojectinareasuchas:hereditary specialise inareasofparticularinterest,andwillcarryout In theSeniorSophister(fourth)year, youwillbeableto assessment andend-of-yearexaminations. You willbeassessedbyacombinationofcontinuous Tel: +35318961140 www.tcd.ie/Genetics degree willputyouinhighdemand. critical thinkingandproblemsolvingprovidedbytheGenetics a careernotdirectlyrelatedtothescientificsubject,skills of medicine, patentlaworsciencejournalism.Evenifyouchoose in teaching.Othergraduateshavegoneontocareerssuchas counselling, publichealthandepidemiologyprogrammes, medical orclinicaldiagnosticlaboratories,forensics,genetic and pharmaceuticalcompanies,agriculturalorganisations, postgraduate study. Opportunitiesalsoexistinbiotechnology to careersinacademicorindustrialresearchbeginningwith science orareasrelatedtoit.Manygeneticsgraduatesgoon Graduates havegoneontocareersindiversefields,many financial assistanceprovided. research laboratory to spendthesummermonthsworkinginahumangenetics At theendofJuniorSophister(third)year, youmaybeable Assessment Did youknow? Further information Career opportunities Study abroad n research trainingofinternationallyrecognisedquality. superb environmentforundergraduateeducationand university geneticsdepartments. As such,itprovidesa and fundingsixthplaceintheworldrankingsof reflected inanoutstandingrecordofpublication an internationalreputationforworld-classresearch, state-of-the-art researchfacilities. The Institutehas in part,theSmurfitInstituteofGenetics,with GeneticsandMicrobiologyishoused, The Schoolof . This isoftenintheUSA,withsome Engineering, Mathematics and Science 149

Quaternary geomorphology I The origins of humanity Climate change Environmental governance I and II African development Globalisation and Historical geography I and II Hydrology and water resources II Property development, urban planning and the state Quaternary geomorphology II Reconstructing environmental change Understanding environmental change Advanced research methods in geography I Advanced research methods in geography II (which includes Advanced research methods an overseas fieldtrip) Geographic information systems History and philosophy of geography Coastal processes and management I and II Globalisation Hydrology and water resources I Quaternary environmental change and climate Study abroad Assessment In the first year, as students study geography in combination geography in combination as students study year, In the first an average of four lectures subjects, they attend with other (second year) The Senior Freshman per week. per module economic relating to cultural, modules cover issues geography human-modified and to natural and geography, and historical and systems. Research skills are environmental processes a course on collection and analysis developed further through of geographical data which includes a fieldwork component. of geographical data For their Senior Sophister (fourth) year, students undertake students For their Senior Sophister (fourth) year, modules a research dissertation and choose from optional that include: Several of the Sophister year options require field and laboratory work. Students may also opt to take a number of courses outside geography in their Sophister years. There are also additional optional modules (5 credits each) There are also additional optional modules covering a wide range of subjects that include: There are opportunities for students to spend all or part of the Bordeaux, Paris, Utrecht or third year studying abroad at Exeter, Stockholm universities. in Junior Sophister (third) year: in Junior Sophister (third) n n n n n n n n n n n end-of-year combination of continuous assessment and A examination is used. The Sophister years The Sophister modules (5 credits each) There are four compulsory n n n n n n n n

Climate change Global atmospheric and ocean systems Global geoecology Global geosystems Surface processes and landscape development See also: page 83 TR029: Political science and geography, TR077: Earth sciences, page 161 Students who wish to study Geography apply to the apply to the wish to study Geography Students who as select Geography (TR071) and may Science degree and 4th years. area for the 3rd their specialist year prerequisite: Geography 1021 Junior Freshman (first) and/or Geography 1022 year) prerequisite: Geography Senior Freshman (second GG2021 and GG2022. two years of the Science course, For details of the first see page 139. including entry requirements, other Geography may be combined with one Alternatively, social science discipline within the subject from an arts or a TSM is (TSM) programme. two-subject moderatorship Both subjects are normally studied joint honor programme. or both subjects in the fourth for three years and one An honors degree is awarded in both subjects. For year. see page 92. subjects that combine with Geography, Course content Why study Geography? Geography from the fields of conservation, environmental degradation and environmental hazards. In addition, students may select to take ‘Geography 1022’ which In addition, students may select to take ‘Geography 1022’ introduces key concepts relating to the interactions between humans and their environment by examining case studies n n n n n All students take ‘Geography 1021’ which considers the All students take ‘Geography 1021’ following themes: The Junior Freshman (first year) Geography course aims to focusing on provide a solid grounding in physical geography, materials that are dealt with in greater depth in later years. areas such as business and public service. Geography is truly interdisciplinary as it spans a broad spectrum Geography is truly interdisciplinary as it spans As physical sciences. of the social, biological, informational and are well placed the world becomes interconnected geographers on social and to bring their understanding and skills to bear geographers, An important attribute of environmental issues. is their ability and one that is highly regarded in the workplace, a wide range of to combine multidisciplinary knowledge with report-writing, transferable skills, including critical thinking, These can be applied to careers numeracy and IT-literacy. such as which directly incorporate a geographic dimension, and to wider environmental consultancy or urban planning, 150 Engineering, Mathematics and Science development. insurance), foreignaffairs, leisureandtourismoverseas as wellpositionsinsuchareasfinancialservices(including planning, environmentalconsultancyandresearchteaching geography studentsinrecentyearsincludeurbanandregional are widelyregardedasassets.Careerstakenupbygraduating valued intoday’s jobmarket,whereadaptabilityandflexibility discipline andtraininginhighlyrelevanttransferableskillsis geography graduates. The combinationofabroad-based A wide rangeofcareeroptionsispotentiallyavailableto Tel: +35318961576 www.tcd.ie/Geography Career opportunities Further information Did youknow? n video documentariesaspartoftheirassessedwork. Iceland, MallorcaandZambia,inmakingdigital have beeninvolvedinacademicstaff-led fieldwork in geographystudents In recentyears,Sophisteryear compulsory courses: In theSeniorSophister(fourth)yearyouwilltakefour and datapresentation. evolution oflife.Inaddition,youwilllearnskillsincomputing of geologicaltime;investigationthesubsurface;and which causethemtobend,buckleandcrack;themeasurement will alsostudytheirresponsetoenormousforcesintheEarth formed themandtheenvironmentinwhichthistookplace. You each oftherockscontainsinformationonprocessesthat provided inallmajorbranchesofgeology. You willlearnhow In theJuniorSophister(third)year, athoroughgroundingis (third andfourthyear)geology. Fieldwork isanessentialandintegralpartofSophister Freshman (firstandsecond)yearsseepages140-142. For detailsofthetopicscoveredinJuniorandSenior society isbased. with theoriginandconcentrationofmaterialsonwhichour dinosaurs, volcanoes,meteoritesandearthquakes.Italsodeals organisms. Itembracesthestudyofsuchdiversetopicsas composition andevolutionofthisdynamicplanetitsliving Geology isthescienceofEarth.Itinvestigates n n n n n n n n n n n n n n subjects include: covering bothacademicandappliedareasofgeology. Optional You willalsoselectfiveoptionalsubjectsfromawiderange What willyoustudy? What isGeology? Geology including entryrequirements,seepage139. For detailsofthefirsttwoyearsSciencecourse, GL2201, GL2202,GL2203,GL2204. Senior Freshman(secondyear)prerequisite:Geology Junior Freshman(first)yearprerequisite:Geology 1101 area forthe3rdand4thyears. degree (TR071)andmayselectGeologyastheirspecialist Students whowishtostudyGeologyapplytheScience Laboratory project Climate change Palaeobotany,organic petrology palynologyand Introduction tomicropalaeontology Planet formationandtheearlyEarth Metamorphism petrology Global igneous quality andgroundwater Hydrogeology evolution andlandscape Continental tectonics andexploration Petroleum geology geology Geology ofIrelandandeconomic andseminars Geological literature Fieldwork based invariouspartsofEuropeandalsoNorth America) fieldworkhavebeen Project (recentprojectsincorporating

Engineering, Mathematics and Science 151

As there is also a lot you will carry out a and also cover specialist Gene regulation Membrane biology Microbiology and virology Core concepts in immunology Cells and molecules of the immune system Infectious diseases and vaccines allergies and cancer Autoimmunity, Protein science Students who wish to study Immunology apply to the apply to the wish to study Immunology Students who as select Immunology (TR071) and may Science degree and 4th years. area for the 3rd their specialist year) prerequisites: Chemistry Junior Freshman (first or Also, Mathematics and Chemistry CH1102. CH1101 Mathematical methods. year) prerequisite: Biology Senior Freshman (second and BY2208. BY2201, BY2203, BY2205 two years of the Science course, For details of the first see page 139. including entry requirements, What will you study? Immunology What is Immunology? research project within one of the department’s active active research project within one of the department’s immunology research groups In the Senior Sophister (fourth) year Additional topics include: n n n of interest in immunology from the pharmaceutical sector, it is sector, of interest in immunology from the pharmaceutical for skilled graduates anticipated that there will be a high demand into the future. In the Junior Sophister (third) year you will share many of your particularly in the areas courses with students of biochemistry, of cell and molecular biology. Immunology topics covered include: n n n n n This is a degree in which students become expert in the This is a degree in which students become and immunology. complementary disciplines of biochemistry involved in living Biochemistry is the study of all processes carry out all organisms. It encapsulates how cells replicate, an orderly manner. their specialised functions and then die in diseases and medical It seeks to define the basis for different and most exciting disorders. Immunology is one of the fastest studying the growth areas of biological science and involves in recognising molecules and cells of the body that are involved in immunology has and fighting infection and disease. Research and new therapies helped in the development of new vaccines multiple sclerosis for diseases, such as rheumatoid arthritis, College has a worldwide disease. Trinity and Crohn’s research and it is reputation for excellence in immunology a recognised strategic strength of TCD. topics in both biochemistry and immunology.

As a student of geology, you will undertake a two-week As a student of geology, Spain. field trip to a tectonically active region in n Further information Did you know? Career opportunities Study abroad Study www.tcd.ie/Geology Tel: +353 1 896 1074 Tel: Recent graduates have found professional career opportunities found professional career opportunities Recent graduates have civil engineering firms, geological and with mining companies, oil companies, organisations environmental consultancies, information systems, and government based in computing and of There is currently a global shortage geological surveys. highly valued in more geoscientists. Geology graduates are also the finance sector) generalised fields of employment (e.g. in transferable skills and their their many due to their adaptability, sets. experience at dealing with incomplete data There are opportunities for students to spend part of their to spend part of opportunities for students There are with have formal agreements year abroad, we Junior Sophister but other (France), and Clermont-Ferrand Uppsala (Sweden) locations are also possible. 152 Engineering, Mathematics and Science management. areas suchasteaching,informationsystems,accountancy, and gone ontostudymedicineorpharmacy, andevencrossedinto However,commercial laboratories. previous graduateshavealso academic research.Somegraduateswillworkinhospitaland and subsequentlytakeupacareerinindustrial,medicalor will beideallysuitedtocontinuestudyingatpostgraduatelevel developments inimmunologycurrently, graduatesofthiscourse areas ofbiochemistryand/orimmunology. Giventheexciting On completionofthiscourseyouwillbequalifiedtoworkinall university intheUnitedKingdom,FranceorGermany. opportunity forstudentstospendtheirthirdyearstudyingina The SchoolparticipatesinanErasmusschemewhichoffers the Tel: +35318961608 www.tcd.ie/Biochemistry Career opportunities Study abroad Further information and genetics. techniques, andwillalsobeproficientinmicrobialbiochemistry at bothcellularandmolecularlevels,usingawiderangeof microbiologist isaversatilescientistandstudiesmicrobes of microbialprocessesforapplicationsinbiotechnology. A It alsostudiesthecontroloftheseeffects andtheharnessing and detrimental,onplants,animals,mantheenvironment. and viruses)togetherwiththeiractivitieseffects, beneficial processes ofmicro-organisms(suchasbacteria,protozoa,fungi Microbiology, asascience,investigatesthestructuresandlife the microbialworldisyettobediscovered! about microbesandsomeestimatessuggestthatover95%of are allcausedbymicrobes.Despitethis,westillknowverylittle antibiotic-resistant Staphylococcusaureus(MRSA)infection bovine spongiformencephalopathy(‘madcowdisease’)and Diseases suchas AIDS, malaria,cholera,avianinfluenza, multitude ofinfectiousdiseasesinhumans,animalsandplants. nutrients foroursurvival.Ontheotherhand,microbescausea our digestivesystemandgeneratingessentialvitamins and minerals,providingoxygentoouratmosphere,fuelling aspects oflifeonEarth. This includesrecyclingallnutrients that microbesareessentialforthemaintenanceofmany the contextofdisease,onlyrecentlyhasitbeenfullyrealised Although microbeshavebeenstudiedfor300years,mainlyin molecular microbiology. which housessomeworld-class researchersinmedicaland Microbiology intheMoyneInstitute ofPreventiveMedicine, in themicrobiologysectionofSchoolGeneticsand In thethirdyearandfinalyear, youwillmainlybebased microbiological moduleswithinthesubjectofbiology. allowing youtodevelopyourstudyskills.Partofthiswillinclude consolidating yourfundamentalscientificknowledgeand of sciences,facilitatinganunderstandinghowtheyinterrelate, During thefirsttwoyears,youwillbeexposedtoabroadrange the course? Microbes andmicrobiology Microbiology What will you study during during study you will What including entryrequirements,seepage139. For fulldetailsofthefirsttwoyearsSciencecourse, BY2201, BY2203,BY2205andBY2208. Senior Freshman(secondyear)prerequisites:Biology Mathematical methods,andBiology1101. CH1101, ChemistryCH1102, plusMathematicsor Junior Freshman(firstyear)prerequisites:Chemistry as theirspecialistareaforthe3rdand4thyears. the Sciencedegree(TR071)andmayselectMicrobiology Students whowishtostudyMicrobiologyshouldapply Engineering, Mathematics and Science 153

Immunology Protein chemistry Eukaryotic gene structure Clinical aspects of cancer and infection Stem cells and gene therapy Drug adsorption and metabolism Endocrinology Membrane function Cellular regulation Students who wish to study Molecular medicine apply to medicine apply wish to study Molecular Students who may select Molecular degree (TR071) and the Science years. for the 3rd and 4th their specialist area medicine as year) prerequisites: Chemistry Junior Freshman (first or Also, Mathematics and Chemistry CH1102. CH1101 Recommended: Biology 1101 Mathematical methods. year) prerequisites: Biology Senior Freshman (second and BY2208. BY2201, BY2203, BY2205 two years of the Science course, For details of the first see page 139. including entry requirements, What will you study? Molecular medicine Molecular medicine? What is Molecular Science topics include: n n n can be directly translated into patient care. such degree College is the only Trinity Molecular medicine at will be given lecturesprogramme available in Ireland. Students within at the cutting-edge of current scientific knowledge immunology, the overarching research themes of cancer, clinical to addition in microbiology, and genetics neuroscience, Hospital, which will focus on the lectures given at St. James’s application of research knowledge to the clinic. medicine the molecular In the Junior Sophister (third) year, course will provide a broad knowledge and understanding of various fundamental science disciplines, biochemistry, some and microbiology and genetics immunology, biology, cell topics unique to the molecular medicine course as listed below. Molecular medicine topics include: n n n n n n Molecular medicine is a joint degree programme offered by offered Molecular medicine is a joint degree programme and the School the School of Biochemistry and Immunology changing needs of of Medicine and has been inspired by the between the two medical research. It is a unique collaboration with a strong schools, aimed at creating a science programme theory to therapy emphasis on translational research, i.e. a advances approach to learning whereby medical research

You You

Emerging pathogens Molecular pathogenesis (disease mechanisms) of bacterial and protozoal infections Regulation, issues and standards in current microbiological practice Clinical microbiology Gene regulation and expression in bacteria and eukaryotic microbes Bacterial cell surfaces and their proteins Further information Career opportunities and novel methods for disinfection in hospitals. novel and In the final year, you will also undertake a 9-week, full-time you will also undertake In the final year, laboratory. project under supervision in a research at the cutting-edge of research on topics like genetic work will drugs, anti-malarial new of design bacteria, transfer between www.tcd.ie/microbiology Tel: +353 1 8961190 Tel: Many graduates go on to do a higher degree in Ireland or abroad degree in Ireland or higher do a on to Many graduates go and enter a rewarding career in many of the areas mentioned or continue a research career in a university. Graduates in microbiology have a wide range of expertise and Graduates in microbiology have a wide range or pure research. are considered versatile scientists for industry and medical This makes them sought after by pharmaceutical in assurance staff research laboratories as research and quality drug and medical device manufacture, as analytical or R&D staff health public utilities, the food and beverage industries,by the by service, by teaching and training establishments and publishing houses, in life science sales and product development, medical relief organisations and many other areas. Such employment may find you working with multinational or small companies in Ireland or abroad, working with leading-edge biotechnologies in the production of drugs, enzymes, antibiotics, vaccines or agricultural products. n n n n n n In the final year you will also choose from optional courses In the final year you edge of research and knowledge reviewing the leading in topics such as: Extensive laboratory and computer training cover the safe Extensive laboratory micro-organisms, separation of their handling of pathogenic genetic analysis, biotechnological components and products, methods. techniques and research In the 3rd and 4th years, you will take a core course covering take a core course 4th years, you will In the 3rd and Microbial and Cell biology, Microbial molecular aspects of of these topics As some Applied microbiology. and pathogenicity and genetics, immunology related to biochemistry, are closely disciplines. courses from these take complementary you will also 154 Engineering, Mathematics and Science Tel: +35318961608 www.tcd.ie/Biochemistry science andmedicaldisciplines. where there is a demand for the analytical skills developed in the systems, communicationsandmanagement,law, andbanking, Other possibilitiesincludesuchcareersasteaching,information biotechnology, foodscience,pharmaceuticalsordiagnostics. to workinhospitalsandcommerciallaboratoriesdealingwith Institute of Molecular Medicine. Alternatively, you will be qualified including theSchoolofBiochemistryandImmunology towards aMastersorPh.D.inseveraldisciplineslifesciences research. Forexample,itispossibletocontinueyourstudies level andsubsequentlytakeupacareerinmedicaloracademic You maydecidetocontinueyourstudiesatthepostgraduate aspects ofmolecularbiology, biochemistry, andcellbiology. Graduates ofthiscoursewillhavetheabilitytoworkinallmajor A or Germany. third yearstudyinginauniversitytheUnitedKingdom,France scheme whichoffers theopportunityforstudentstospendtheir of celldeath. The Schoolalsoparticipatesinan metabolism, theimmunesystem,geneticdiseases,andcontrol cellular parasitology, viralevasionmechanisms,cellsignalling, cancer, neurobiology, neurologicaldisease,molecularand cycle andcelldivision,cytoskeleton,developmentalbiology, areas fromwhichtopicsmaybechosenincludethecell of Clinical Medicine, St. James’s Hospital. Examples of research Immunology, on the main College campus or in the Department to performtheirprojectintheSchoolofBiochemistryand Senior Sophister(fourth)year. Studentswillhaveachoice immunology or clinical medicine forms an essential part of the research project Further information Career opportunities in theareaofbiochemistry, cellbiology, Erasmus Parkinson’s disease,schizophreniaanddepression. brain diseasessuchasMultiplesclerosis, disease, Alzheimer’s causes, andtoproducemoreeffective treatmentsformajor of modern neuroscience research is to elucidate the underlying neurological and psychiatric disease. In this regard, a major goal in medicine,consideringthedebilitatingandcostlyeffects of Research intheneurosciencesisofconsiderableimportance understand howwethink,move,perceive,learnandremember. the intricatemachineryofnervoussysteminanattemptto study ofthenervoussysteminhealthanddisease.Itprobes Neuroscience isthedisciplineconcernedwithscientific n n n n n n n n n n n Junior Sophister(third)yearcoursesinclude: experimental design,datahandlingandresearchskills. disorders. You willalsobetrainedinscientificmethodologyand to behaviour, imagingthebrain,anddrugtreatmentofbrain its responsetoinjuryanddisease,therelationshipofbrain Other modulesfocusonthedevelopmentofnervoussystem, as onthestructureandoperationofnervoussystem. fundamentals of modern molecular and cellular biology, as well several faculties. The course involves in-depth instruction in the as aresultmodulesareprovidedbyseveralSchoolswithin Neuroscience linksneurobiologywithcognitivescience,and What isNeuroscience? Neuroscience What willyoustudy? including entryrequirements,seepage139. For detailsofthefirsttwoyearsSciencecourse, BY2201, BY2202,BY2203andBY2204. Senior Freshman(secondyear)prerequisites:Biology Mathematical methods.Recommended:Biology1101. CH1101, ChemistryCH1102. Also: Mathematicsor Junior Freshman(first)yearprerequisites:Chemistry as theirspecialistareaafterthesecondyear. Science degree(TR071)andmayselectNeuroscience Students whowishtostudyNeuroscienceapplythe Research skills techniques Applied laboratory ofpharmacology General principles Biochemistry andimmunology andmolecularphysiology Cellular biology Developmental Introduction toneurogenetics I Neurochemistry I Neurophysiology Neuroanatomy Introduction toneuroscience

Engineering, Mathematics and Science 155

three-month research project Mechanics and special relativity Electromagnetism Quantum mechanics Laser and modern optics Solid-state physics Students who wish to study Physics or Physics and wish to study Physics Students who the Science degree (TR071) and astrophysics apply to two courses as their specialist may select one of these 4th years. subject for the 3rd and year prerequisites: Mathematics, Junior Freshman (first) Physics. year) prerequisites: Senior Freshman (second Mathematics, Physics. two years of the Science course, For details of the first see page 139. including entry requirements, part of the following courses: Physics is also an important Theoretical physics, page 169. TR035: of advanced TR076: Nanoscience, physics and chemistry materials, page 167. Physics, Physics and Physics astrophysics You will also take specialist courses in areas such as You nanoscience, astrophysics, nuclear and elementary particle physics, superconductivity and computer modelling. in core subjects, including: skills in theory, data analysis and instrumentation. data analysis and skills in theory, College enjoys a worldwide reputation, and Trinity Physics at for study and provides an exceptionally stimulating environment the Senior Sophister for subsequent postgraduate research. In (fourth) year you will carry out a College or Trinity in a modern research laboratory either in and many find this at another institution in Ireland or abroad, topics ranged part of the course particularly rewarding. Project in semiconductors, to monitoring of from photogalvanic effects uranium enrichment, to computational analysis of climate models to biophysics of proteins. Studies in physics cover experimental and theoretical training n n n n n Physics explores our universe in all of its diversity – from Physics explores our universe in all of its from quanta particles to planets, from crystals to chaos, Its to quasars and from superstrings to superconductors. applications are to be found in modern communications, of vital in computers, lasers and many other technologies flexible physics degree will help you develop A importance.

a major research Journal club Neuroimmunology, neuroinflammationexperimental and Neuroimmunology, neuropathology Neuropharmacology Neuropsychology Neurogenetics Neurophysiology II Neurochemistry II Further information Career opportunities Research projects are currently available in the following Research projects are currently available Alzheimer’s disease, research areas: Neurobiology of Neurobiology cannabis, and (‘Ecstasy’) MDMA of Neurotoxicity Neurobiology of of memory and learning, Neuroinflammation, sleep Human depression, of Neurobiology disease, Parkinson’s research. project that is carried out in one of the several neuroscience out in one of the several neuroscience project that is carried College Institute of the Trinity research groups within The research ). Neuroscience (www.tcd.ie/neuroscience and will lead to by a literature review, project will be preceded a dissertation. An important part of your final year is An important part of your www.tcd.ie/Neuroscience +353 1 896 8484 Tel: You may also study for a higher degree in neuroscience, may also study You pursue a research biological or psychological research, and career in an academic, government, pharmaceutical, (some recent biotechnology or medical research organisation College Institute of Trinity graduates are now employed by the Neuroscience). If you do not want to pursue a research career, the course provides transferable skills suitable for a wide variety of careers in teaching, business, management and industry. Some graduates also go on to take professional degrees in medicine, speech therapy or allied health-related sciences. As a graduate of neuroscience you can expect to find As a graduate of neuroscience you can expect general scientific employment in organisations that utilise your recent graduates training as well as your specialist skills (some Abbott and Quintiles). Biopharma, are now employed by Wyeth n n n n n n Senior Sophister (fourth) year courses include: (fourth) year courses Senior Sophister n 156 Engineering, Mathematics and Science and attheEuropeanSpace Agency inMadrid. the NASA GoddardSpaceFlightCenterintheUnitedStates at theUniversitiesofPotsdamandRegensburginGermany, at students haveworkedattheBelgianNuclearResearchCentre, project atalaboratoryorobservatoryabroad.Inrecentyears astrophysics maygettheopportunitytocarryouttheir Final-year studentsinbothPhysicsand of workingatanobservatoryelsewhereinIrelandorabroad. physics oranastrophysicsresearchprojectwiththeopportunity holes andsupernovae.Final-yearstudentscarryouteithera modern developmentsinastronomy, suchasdarkmatter, black stars, interstellarmatterandgalaxies. There isalsoafocuson study ofourownsolarsystem,planetarysystemsaroundother In thefinalyearastrophysicslecturesprovideamorein-depth optical andradiotelescopes. of astrophysicalobservationinthethird-yearlaboratory, using relativity andmoderncosmology. There ishands-onexperience stellar evolution,galaxiesandanintroductiontogeneral astronomical instrumentation,spectroscopy, spaceplasmas, In thethirdyearastrophysicscoursesrangeovermodern with astrophysicscoursesinthefinaltwoyears. substituting roughlyonequarterofthegeneralphysicscourses choose tostudyforadegreeinPhysicsandastrophysicsby At theendofSeniorFreshman(second)year, youmay still amajorpartofhumanendeavourinscience. the universebeyondcontinuestofascinateus. Astrophysics is wonder atthenightsky. The explorationofoursolarsystemand Since beforethedawnofhumancivilisationmanhasgazedin Study abroad Physics andastrophysics research

is veryattractive. managerial oractuarialcareerforwhichatechnicalbackground the degree.Itcouldalsobeausefulprimarytrainingforlegal, employers valuetheskillsofproblem-solvingthatcomewith computing, aswellinawiderangeofcareersforwhich biophysics, hospitalandhealthphysics,automation are diverseopportunitiesinelectronics,telecommunications, and productionfacilities,orthemeteorologicalservice. There institutions, governmentandindustrialresearchorganisations as inteaching. You mayalsofindacareerinacademic elsewhere inmodernhightechnologyindustries,aswell Physics graduatesarealwaysindemandIrelandand Tel: +35318961675 www.physics.tcd.ie Did youknow? Career opportunities Further information n n universities andinstitutesaroundtheworld. in collaborationwithresearchgroupsotherleading Masters andPh.D.degrees.Muchofthisresearchis universities arecurrentlydoingresearchleadingto 100 physicsgraduatesfrom Trinity Collegeandother physics departmentinIreland(northorsouth).Over Physicsin The Schoolof Trinity Collegeisthebiggest finance, bankingandinsurancesector! Ireland alone. That meansmorejobsthaninthe industry andover80,000jobsintheRepublicof based sectorsaccountforover80%ofmanufacturing and theIrishEconomy(2007)showedthatphysics- A recentreportbytheInstituteofPhysicson Engineering, Mathematics and Science 157

Further information www.medicine.tcd.ie/physiology Tel: +353 1 896 2723 Tel:

. This project will individual research project. as their specialist area for the 3rd and 4th years. area for the 3rd as their specialist year prerequisite: Mathematics Junior Freshman (first) Recommended: Biology 1101 or Mathematical methods. and 1102. year) prerequisites: Biology Senior Freshman (second and BY2208. BY2201, BY2202, BY2203 two years of the Science course, For details of the first see page 139. including entry requirements, Students who wish to study Physiology apply to the wish to study Physiology Students who select Physiology (TR071) and may Science degree Career opportunities What will you study? What is Physiology? Physiology When you graduate you will be able to use your general scientific training and specialised knowledge of physiology You may pursue to find employment in a wide variety of jobs. further training in physiology and become a research scientist in a government agency or a hospital, the pharmaceutical industry, Some graduates undertake further study in health- a university. related fields such as medicine or physiotherapy. be based in Trinity College or in one of its associated hospital Trinity be based in departments and will include a literature survey and production of a written dissertation. Some typical recent research projects of cannabis on brain cells, have looked at the toxic effects gastric motility in patients with pancreatitis, respiratory function in lung disease, the cellular mechanisms of memory formation, cardiovascular adaptations in athletes and muscle performance warm-up protocols. after different During the second half of the Senior Sophister (fourth) year you will undertake an research skills. In the Physiology Department at Trinity College, which is part College, Trinity In the Physiology Department at physiology of the School of Medicine, we focus on human by disease, although a comprehensive and how it is affected studying understanding of physiology will also involve There is a particular comparisons in other mammalian species. research interests emphasis on themes which reflect major and responses in our department, including brain function you will be As a student of physiology to physical exercise. a range of cell provided with a detailed understanding of in scientific and organ systems, and will receive training data analysis and experimental design, methodology, Physiology is the study of how cells work, how they co-operate Physiology is the study of how cells work, organs function in organs like the heart or brain and how these knowing how the together in the body as a whole. Because how it goes wrong in body works is essential for understanding basis of human sickness and disease, physiology is the scientific and animal medicine. 158 Engineering, Mathematics and Science Courses include: climate changeimpacts. conservation ofallformsplantlifeandtheirresponsetoglobal Trinity Collegespecialisesinthestudyofevolutionand integrity ofhabitats. whilst conservingthebiodiversityoflivingorganismsand provide foodandenergyforanexpandinghumanpopulation century. Human manipulation of plants in the future will need to climate changewillbeoneofthebiggestchallengesthis of globalclimatechange.Dealingwiththethreatsfrom we use,andarecoretotheunderstandingofprocesses the foodweeat,oxygenbreathe,mostofmedicines The study of plants is of vital importance; they are the source of of freshandmarinewaters. Plants rangefromthelargestforesttreestosingle-celledalgae pursued inthefield,botanicgardenandlaboratories. Plant sciencesisthescientificstudyofplants. Thesestudiesare n n n n n n and GranCanaria. Recent fieldcourseshavebeen heldinGuyana, Thailand, courses whichalternatebetweenEurope andthe Tropics. All studentsaregiventheopportunity toparticipatein research projectintheSeniorSophister(fourth)year. active researchlinesandemphasisisplacedonyourown Herbarium supportteaching. the CollegeBotanicGardenandinternationallyrecognised The laboratoriesandgreenhouseson Trinity College’s campus, What willyoustudy? What isPlantsciences? Plant sciences including entryrequirements,seepage139. For detailsofthefirsttwoyearsSciencecourse, BY2205, BY2206,BY2207,BY2208,BY2209,BY2010. following: BiologyBY2201,BY2202,BY2203,BY2204, Senior Freshman(secondyear)prerequisites:4ofthe & 1102. Junior Freshman(firstyear)prerequisites:Biology 1101 years. sciences astheirspecialistareaforthethirdandfourth to theSciencedegree(TR071)andmayselectPlant Students whowishtostudyPlantsciencesapplydirectly Pollination biology Pollination Plant molecularbiology Long-term environmentalchange change andglobalclimate Plant physiology Ecology andconservation Plant biodiversity All coursesarederivedfrom field

Tel: +35318961274 www.tcd.ie/Botany are alsowidelyapplicableinbusinessandindustry. The skillsyouacquireintheSophister(thirdandfourth)years to goontakeahigherdegreein Trinity Collegeorelsewhere. well asteachingatsecond-level. Alternatively, youmightdecide consultancy, environmentalprotectionoragriculturalresearchas to plantbiology, suchasnatureconservation,environmental When yougraduatecanmovedirectlyintoacareerrelated Further information Career opportunities Engineering, Mathematics and Science 159

. In previous years projects have included . In previous years projects have included Ecology Physiology Animal behaviour Biodiversity Developmental biology form and function Vertebrate Parasitology Applied molecular biology Career opportunities Further information What will you study? What will There are also additional options selected from the There are also additional options selected environmental or medical zoology programmes. major component of the Senior Sophister (fourth) year is the A research project African children, conservation of squirrels, deep parasites in climate change sea fisheries and others on biodiversity, selected from in specialist areas are Tutorials and pollution. evolution wildlife biology, marine biology, freshwater biology, biology and developmental molecular biology, and behaviour, parasitology. Many graduates are pursuing academic and research careers, Many graduates are pursuing academic and the agricultural in Ireland and overseas. Others have entered and aid agencies, as and fisheries sectors, the wildlife service, advisers and technical experts and as inspectors and managers. Zoology graduates have furthermore taken up College Trinity publishing of wildlife magazines and educational literature, film making and careers in the media, fish farming, computer software development, second and third-level teaching, museum work, tourism, environmental lobbying with organisations such as Greenpeace, environmental consultancy and wildlife conservation and management. www.tcd.ie/Zoology +353 1 896 1366 Tel: The course highlights the major concerns of modern zoology in concerns of modern highlights the major The course introduces and biology, environmental and medical relation to fieldwork analytical techniques, biological and other you to cell data handling procedures. and computer-aided a broad Junior Sophister (third) year provides in the Work includes core courses in: overview of zoology and n n n n n n n n Students who wish to study Zoology apply to the Science apply to the Science wish to study Zoology Students who Zoology as their specialist and may select degree (TR071) 3rd and 4th years. area for the 1101 year prerequisites: Biology Junior Freshman (first) Mathematics or Mathematicals methods. and 1102, year) prerequisites: Biology Senior Freshman (second BY2208. BY2201, BY2202, BY2203, two years of the Science course, For details of the first see page 139. including entry requirements, What is Zoology? Zoology Zoology is the scientific study of the animal kingdom, along with Zoology is the scientific study of the animal This involves building its evolution, diversity and environment. kinds of animals knowledge of both the structure of different that and how they function, and the complex relationships their surroundings. govern how animals relate to each other and on three areas of our Zoology provides fundamental information and human health. society: the environment, food production 160 Engineering, Mathematics and Science work. special molecularmodellingcourses, practicalworkandproject Core componentsoftheChemistry degreearetakenalongwith The courseisbasedontheChemistry degree(seepage144). in arangeofareassuchasdrugdesignandmaterialschemistry. molecular modellingtounderstandandsolvechemicalproblems a chemistrydegreebutarealsointerestedinlearningtouse The programmewillsuityouwellifwouldliketoobtain n n n n and reactivityofmoleculessolidsincluding: applications. This coursefocusesonmodellingthestructure modelling haveleadtoanexplosivegrowthinarangeof understand and explore chemistry. Advancements in molecular Molecular modellingistheuseofcomputerto modelling What isMolecularmodelling? Chemistry withmolecular Course overview Is thistherightcourseforyou? materials, page167 TR076: Nanoscience,physicsandchemistryofadvanced TR075: Medicinalchemistry, page166 TR071: Chemistry, page144 See also: Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: The theory behind the modelling approaches themodelling The theorybehind proteins, drugmoleculesandcomputationaldesign Modelling organic and bio-organic molecules including DNA, and behaveduringchemicalreactions arearrangedinmaterials ofhowelectrons The modelling catalysts etc. and nano-materialsincludingoxides,semiconductors, ofthestructureandpropertiesmaterials The simulation

Grade C HC3 Grade C HC3 B.A. 400 5 TR074 Mathematics Mathematics biology chemistry or or biology physics/chemistry chemistry, In oneofphysics, In oneofphysics,

an academicorresearchlaboratoryabroad. mid-December. ThismaybedoneinTrinity Collegeorin a computationalproject As a Senior Sophister (fourth-year student) you will undertake computational experimentsusingmolecularmodelling. class timeisspentincomputerlaboratoriesperforming In the Junior Sophister (third) year, about half of your laboratory and modellinginsolid-statematerialschemistry. modelling proteinstructure,drugdesign,moleculardynamics, including generalmolecularmodelling,quantummechanics, chemistry withadditionalcoursesinmolecularmodelling In thethirdandfourthyearsyouwilltakecorecoursesin The Sophisteryears week intheFreshman(firsttwo)years. lectures andtutorialsaround6hoursoflaboratorytimeper There areapproximately19hoursofsupervisedstudyin applications. introduce theconceptsofmolecularmodellingandtohighlight spent incomputerlaboratories.Speciallecturesaregivento some oftheexperimentalchemistrylaboratoryclasstimeis in theSciencecourse– TR071 (seepage139).However, and mathematicsoneofbiologyorphysicsasstudents You willstudythesamefoundationcoursesinchemistry The Freshmanyears financial services andmeteorology. materials chemistry (semi-conductors/magnetic materials), (computational drugdesign),chemical (developingcatalysts), employed directly in scientific computing include: pharmaceutical and business.Examplesofindustries wherepeopleare Irish economy. Chemists also fits comfortably into management industries, oneofthelargestand fastestgrowingsectorsofthe and researchtoworkinginthechemicalpharmaceutical in otherprofessions.Careeropportunitiesrangefromteaching prospect foremployersbothwithincomputingenvironmentsand developed computationalskillsmakegraduatesanattractive open (see TR071 – Chemistry page 144). In addition the specially opportunities availabletoregularchemistrygraduatesremain The degreeisfundamentallychemistry-basedandsothe McGill andDukeuniversitiesinNorth America. Vienna, Berlin,Madrid, Toulouse andUtrechtinEurope have completedtheirresearchprojectsinrecentyearsinclude out theirfinal-yearresearchprojects.Centreswherestudents large numberofotheruniversitieswherestudentsmaycarry The SchoolofChemistryhasexchangeagreementswitha assessment andend-of-yearexaminations. You willbeassessedbyacombinationofcontinuous Career opportunities Study abroad Assessment , typicallyfromlateSeptemberto

Engineering, Mathematics and Science 161 In two of: physics, Mathematics chemistry, biology, biology, chemistry, mathematics, physics/chemistry, geology, geography, applied mathematics or agricultural science biology, chemistry, mathematics, geology, geography or applied mathematics In two of physics, Mathematics

TR077 12 455 B.A. HC3 Grade B Grade C HD3 or OC3 or HD3

COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE Special Entry Requirements: Leaving Certificate Advanced GCE (A-Level) GCSE Combinations of subjects not permitted: Physics/chemistry with physics or chemistry Agricultural science with biology Applied mathematics with mathematics See also: TSM, page 92 TR001: TR071: Science, page 139 Earth sciences Earth sciences Earth This degree programme focuses on Planet Earth, and in surface particular the composition and structure of the Earth’s layers, atmosphere and oceans, the dynamic processes that influence and shape our world, and the formation and distribution of resources that we depend upon. Notable areas of study include climate change, geomorphic hazards (earthquakes, landslides, volcanism, flooding), pollution and the availability and exploitation of resources, including energy The degree aims to produce articulate and informed resources. graduates with a broad knowledge of Planet Earth by providing students with a firm grounding in those sciences that relate directly to the surface of the Earth and to surface-forming and atmospheric and oceanic processes. Particular emphasis is placed on the development of critical thinking, a scientific approach to understanding, and training in relevant, transferable skills, including laboratory- and field-based analytical techniques.

“I began an undergraduate degree in Computational “I began an undergraduate Chemistry (now called Chemistry with molecular College in 1999. I chose this Trinity modelling) in sets and course out of my childhood love for chemistry The Nintendo, and didn’t really know what to expect. physics, degree allowed me to develop skills in chemistry, was not until mathematics and computer science, but it the power a final year research project, that I realised systems. (and fun) of computer modelling of chemical position This experience drove me to accept a Ph.D. and I spent in the group of Professor Graeme Watson, properties three years studying the electronic structure time, I had the of post-transition metal oxides. During this opportunity to use some of the largest supercomputers on my in the world, publish research papers based to see an experimental simulations, and most excitingly, After group from Oxford University verify my predictions! for the Colorado to work graduating, I moved to Denver, of new U.S. Department of Energy on the development In 2009, materials for converting sunlight into electricity. the European I was awarded a research fellowship from and continue Union to move to University College London, I In 2011 my research on energy materials and processes. Chemical secured a position in the centre for Sustainable had the at the Universirty of Bath. I have Technologies opportunity to present my research around the globe, everywhere from Hawaii to Seoul, and I currently hold The Shanghai. a visiting fellowship to Fudan University, goals of science are universal, and pursuing a career in science has allowed me to experience a world I never knew existed.” Currently: Marie Curie Research Fellow, University Research Fellow, Currently: Marie Curie College London Dr. Aron Walsh Dr. College Dublin Trinity Ph.D., School of Chemistry, Graduate Profile Further information Further Contact: Prof. Graeme Watson Contact: Prof. E-mail: [email protected] 896 1357 +353 1 Tel: www.tcd.ie/Chemistry/undergraduate/molecular-modelling 162 Engineering, Mathematics and Science programme. some modulesdrawnfromoutsidetheEarthsciencesdegree Sophister year, studentsalsohavetheopportunitytotake degree programmes(seepages149-150).IntheirSenior a varietyofmodulesfromtheexistingGeographyandGeology The Sophister(thirdandfourth)yearsenablestudentstotake (see page13). for earthscientistsandamodulefromtheBroadCurriculum geographical data);Geochemistryforearthscientists;Physics Geography (ChangingworldsandCollectionanalysisof Structural geologyandMapwork,plusamoduleofFieldwork); Geology (Mineralogy, Palaeontologyandstratigraphy, Petrology, In theSeniorFreshman(second)year, studentstakecoursesin and Introductiontophysicalchemistry. geography II(human-environment);Maths;Foundationphysics, Geology; IntroductiontogeographyI(physical); In theJuniorFreshman(first)yearstudentstakesixmodules: they arealsoasourceofmanythesolutions! underpin manyoftheproblemscurrentlyfacedbyhumankind, potentially hugelyrewarding:notonlydotheearthsciences and oceans. The degreeisbothhighlychallengingandalso influencing theinhabitedsurfaceofEarthanditsatmosphere provides aninsightintothecomplexitiesofphysicalprocesses geology, environmentalsciences,physicsandchemistry, College, positionedontheinterfacebetweengeography, to asinglediscipline. The Earthsciencesdegreeat Trinity an understandingofreal-worldproblemsthatarenotlimited are seekinggraduateswhocancombineanalyticalrigourwith In anincreasinglyinterconnectedandcomplexworld,employers Ireland. for studentstobasetheirresearchprojectworkoutside one overseasfieldcourse,togetherwithopportunities degree. Inaddition,theEarthsciencesdegreeincludesatleast carry outpartoralloftheJuniorSophister(third)year with alargenumberofotheruniversitieswherestudentsmay The SchoolofNaturalScienceshasexchangeagreements assessment andend-of-yearexaminations. Most modulesareassessedbyacombinationofcontinuous Assessment Course overview Is thistherightcourseforyou? Study abroad

Tel: +35318961713 E-mail: [email protected] www.naturalscience.tcd.ie/undergraduate/earth-science.php Earth sciencesdegree. and researchallpotentiallyoffer careersforgraduatesfromthe oil andgas,riskassessment,environmentalanalysis,teaching, management ofresources,includingmineralreservessuchas planning, overseasassistance,theassessment,exploitationand Areas suchasenvironmentalconsultancy, environmental Further information Career opportunities Engineering, Mathematics and Science 163

deals with studies the mechanisms explores the control of of mutation and its role in cancer Medical genetics: includes the identification of genes development causing various clinical disorders and the Neurogenetics: studies how genes control development and function of the nervous system and their influences Molecular and cell biology: Computer programming: provides an essential skill for evolution: and human Population genetics Cancer genetics and mutation: of genetic and stem-cell therapies to treat them of genetic and stem-cell therapies to treat on behaviour and psychiatric disease gene expression and function of genes in various cellular processes, such as cell death, proliferation or differentiation this field, where large amounts of data must be analysed, and one which is easily transferable to other careers genetic variation in populations and the role of this variation in evolution, especially in humans Course overview Course Subjects are taught through a combination of lectures, tutorials and practical courses. The Sophister years specialised studies In the 3rd and 4th years you will undertake in areas such as: n n n n n n This course provides you with a strong base in the basic strong base in the basic provides you with a This course as well as in chemistry and mathematics, biology, sciences of population and – molecular, principles of genetics the classical bioinformatics and molecular evolution. quantitative genetics, of your degree programme, the Over the four-year period the importance of studies in course will also demonstrate the mouse. Seminar and tutorial model organisms, especially from various disciplines, with staff programmes, organised your studies, and encompass such are an integral part of between genetics and the social subjects as the interactions general the and law, and philosophy linguistics, ethics, sciences, genes, society and culture. relationship between The Freshman years years you will In the Junior and Senior Freshman (first two) chemistry and mathematics, concentrate on the areas of biology, of genetics in and will also be introduced to the principles separate tutorials. some of the In each of the first two years you will take chemistry and same courses as Science students: biology, year and biology mathematics in the Junior Freshman (first) and 2209, chemistry modules BY2201, 2203, 2204, 2205, 2208 (second) year – see and mathematics in the Senior Freshman weekly genetics page 140-142. In addition you will have a tutorial with faculty from the Department. In two of physics, Mathematics biology, chemistry, chemistry, biology, physics/chemistry, mathematics and applied mathematics chemistry, biology, mathematics and applied mathematics Mathematics In two of physics,

TR073 15 520 B.A. HC3 Grade B Grade C OC3 or HD3 or OC3

The discovery of the molecular basis of many inherited disorders The development therapies of genetic and stem-cell-based for inherited disorders The ability to trace the evolution of mankind finger-printing to forensic science The application of DNA Advanced GCE (A-Level)

COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE Special Entry Requirements: Leaving Certificate GCSE Combinations not permitted: Physics/chemistry with physics or chemistry Applied mathematics with mathematics genes of Human genetics (TR073) focuses on the (TR071) humans, while the Genetics option in Science genes. examines plant, human and other animal Science course Students who apply for the general-entry as their (TR071) have the option of selecting Genetics fourth) years specialist subject for the Sophister (third and of the course. See page 148. Is this the right course for you? What is Human genetics? Human genetics Human Human genetics is a knowledge-driven, dynamic and exciting go on to careers in As most graduates of this programme field. research, you must be prepared to take this route as a career option. n n n n Human genetics is the study of genes – or heredity – in humans. Human genetics is the study of genes – or of these genes on both individuals It also examines the effects and societies. It has developed rapidly in the last decade as new technology has made it possible to study genes in much greater detail. Examples of remarkable advances in knowledge include: 164 Engineering, Mathematics and Science Human geneticsdegreewillputyouinhighdemand. skills ofcriticalthinkingandproblemsolvingprovidedbythe choose acareernotdirectlyrelatedtothescientificsubject, such asmedicine,patentlaworsciencejournalism.Evenifyou might alsointerestyou.Othergraduateshavegoneintocareers teaching. Geneticcounsellingisarapidlyexpandingfieldthat forensics, publichealthandepidemiologyprogrammes,in organisations, medicalorclinicaldiagnosticlaboratories, biotechnology andpharmaceuticalcompanies,agricultural research institute,orinindustry. Opportunitiesexistin degree ortoacareerinresearch,whetheruniversity, Many Humangeneticsgraduatesgoontostudyforahigher financial assistanceprovided. research laboratory to spendthesummermonthsworkinginahumangenetics At theendofJuniorSophister(third)year, youmaybeable assessment andend-of-yearexaminations. You willbeassessedbyacombinationofcontinuous genetics andhumanevolutionarygenetics. courses includecancergenetics,geneticsofvision,behavioural human evolutionandpsychiatricgenetics.Specialistlecture blindness, celldeath,neuraldevelopment,stem-cellbiology, an originalresearchprojectinareasuchas:hereditary specialise inareasofparticularinterest,andwillcarryout In theSeniorSophister(fourth)year, youwillbeableto Tel: +35318961140 www.tcd.ie/Genetics at Trinity College? Career opportunities Study abroad Assessment genetics Human study Why Further information internationally recognisedquality. for undergraduateeducationandresearchtrainingof departments. As such,itprovidesasuperbenvironment sixth placeintheworldrankingsofuniversitygenetics in anoutstandingrecordofpublicationandfunding international reputationforworld-classresearch,reflected state-of-the-art researchfacilities. The Institutehasan We arehousedintheSmurfitInstituteofGenetics,with . This isoftenintheUSA,withsome any environment that requires strong numerical and logical skills. and logical strong numerical any environmentthatrequires broad mathematicaltrainingthat will,inturn,allowyoutowork This four-yearprogrammeisdesigned toprovideyouwitha students. a longperiodinprovidingdiversecareeropportunitiesformany will requirefurthertraining. The course hasbeensuccessfulover career inactuarialwork,financeoraccounting,althoughthese then thiscoursewillsuityouwell.Itisalsoagreatstartfor interested inapplyingmathematicalsolutionstoproblemsolving, If youhaveanaturalabilityinmathematicsandaregenuinely mathematical areas. world class,whilealsocateringforthosewithtalentsindifferent experience frommanypartsoftheworld,courseaimstobe into methods.Withanacademicstaff thatbringsexpertiseand numeracy, abilityinabstractreasoningandtheskilltoturnideas for mathematicsgraduatesinthejobmarketwhichvalues is anexcellentchoiceforanyonehopingtomeetthedemand the areasthatmostsuityourinterestsandtalents.Mathematics basic areasofmathematicsandthenallowyoutospecialisein The courseaimstoprovideyouwithafirmfoundationinallthe Mathematics Course content Is thistherightcourseforyou? Course overview TR035: Theoretical physics,page169 See also: programme, and TSM studentsmustbemoreselective. workload islessintensethanthatofthesinglehonor mathematics modules.However, for TSM studentsthe Single honorand TSM studentsfollowthesame For subjectsthatcombinewithmathematicsseepage92. degree isawardedinbothsubjects. programme. TSM isajointhonorprogramme. An honors other subjectwithinthetwo-subjectmoderatorship(TSM) TR001 (TSM):Mathematicsmustbecombinedwithone TR031: Mathematicsisstudiedasasinglehonorcourse. Advanced GCE(A-Level) DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODES: Leaving Certificate Special EntryRequirements: TSM points:

HB3 Grade B B.A. 465* 30 TR031 See noteonpage28 Mathematics Mathematics 525-570 25 TR001 (TSM) Engineering, Mathematics and Science 165

The research of the School of Mathematics was School of Mathematics The research of the to research in favourably compared particularly departments in a recent other Irish Mathematics study of the public research independent bibliometric base. n Further information Did you know? Did you Assessment Study abroad Career opportunities study or intensive research. A degree in mathematics opens up the possibility of a career A have found in a variety of industries and sectors. Graduates skills have employment in computing, where mathematics and services financial The application. practical and immediate first destinations internet security sectors are also common teaching, for graduates. Other options include statistics, actuarial work, finance, and all areas of pure accountancy, involve further and applied mathematics. Many of these www.maths.tcd.ie +353 1 896 1949 Tel: You will be assessed by a combination of continuous will be assessed by a combination You examination, with all work assessment and end-of-year last two years counting towards your undertaken during your final degree result. to spend the Junior Sophister (third) year may choose You exchange at a European university as part of the Erasmus programme.

independent research Introduction to computer architecture and programming Introduction Classical mechanics (this leads on to many of the Theoretical physics mathematical modules essential for the degree) to statistics (this opens the way for many Introduction subsequent optional modules) (this will include practical work) Applied and computationalApplied and mathematics to solve practical problems physics The mathematics of theoretical methodologyStatistical models and Pure mathematics which exploresPure mathematics basic concepts and abstract theories In the Senior Freshman (second) year you will continue to study In the Senior Freshman (second) year you modules of your algebra and analysis. In addition you will select choice from a range that includes exploring some of the Junior topics new choose may you or depth, greater in topics Freshman This allows you to modules (see p. 13). or ‘Broad Curriculum’ begin tailoring the degree to your own strengths and areas of interest. There are approximately twenty hours of classes per week There are approximately twenty hours of classes in the Junior Freshman (first) year. All students take common modules in their first semester, and modules in their first semester, All students take common until, in subsequent semesters is offered gradually more choice and fourth-year student) you will be able as a Sophister (third to specialise in the areas that appeal most to you. to specialise in the areas An important aspect of the course is an The Sophister years In the Sophister (third and fourth) years you will have the opportunity to choose subjects from a selection of over 20 wide-ranging options. Many subjects cover topics from the first but additional possibilities include computer and second year, engineering, mathematical economics, cryptography and computer-aided design. project conducted under the supervision of a member of staff. n n n In addition, during your first semester you will be introduced to In addition, during your first semester you will continue you the following topics. In the second semester, with two of them. In the Junior Freshman (first) year there are core modules In the Junior Freshman only topics that in algebra and analysis, which introduce not but also are fundamental to a wide range of mathematics ideas that is a structured way of dealing with mathematical They are quite intensive. absolutely universal to mathematics. The Freshman years The Freshman n n n The modules offered can be grouped into four areas: can be grouped into offered The modules n 166 Engineering, Mathematics and Science industry. knowledge relevanttotherapidlygrowingpharmaceutical are simultaneouslyinterestedindevelopingskillsandexpert cure diseases,ifyouhaveanaturalflairforchemistryand you wanttounderstandthebiologicalreasonsbywhichthey Yes, ifyourdreamistodesignandpreparenewdrugs, drugs andtheunderstandingofbiologicalfunctions. have aparticularexpertiseinmoleculardesign,thesynthesisof pharmaceutical industry. As wellasbeingexpertchemists,they Medicinal chemistsarethecreativetalentbehindmodern What isMedicinalchemistry? Medicinal chemistry Is thistherightcourseforyou? materials, page167 TR076: Nanoscience,physicsandchemistryofadvanced TR074: Chemistrywithmolecularmodelling,page160 TR071: Chemistry, page144 See also: Applied mathematicswith Agricultural sciencewithbiology Physics/chemistry withphysicsorchemistry Combinations notpermitted: GCSE Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

OC3 or HD3 Grade C Grade B HC3 B.A. 475* 28 TR075

Mathematics In twoofphysics, mathematics or applied geography geology, mathematics, chemistry, biology, science or agricultural mathematics applied geography, geology, physics/chemistry, mathematics, chemistry, biology, Mathematics In twoof:physics,

medicinal chemistry. for yourgroupwillintroduceyoutotheideasandtechniquesof pages 140-142.Inaddition,specialsessionsheldspecifically of furtherbiology(20units)ormathematics–see chemistry and20prescribedunitsofbiologywiththeoption year. IntheSeniorFreshman(second)yearyouwilltake (1101 &1102) andmathematicsintheJuniorFreshman(first) programme, takingchemistry(CH1101 &CH1102), biology In thefirsttwoyearsyouwillfollowScience(TR071) The Freshmanyears understanding theirbiologicalactions. to thedesignandproductionofnewmedicinalcompounds chemistry butfocuseson,andextendsinto,topicsofrelevance This degreeprovidesyouwithasoundgeneralgroundingin n n n n n n n n chemistry courseswillinclude: In theJuniorSophister(third)year, yourspecialmedicinal medicinal chemistryunits. chemistry inordertoallowfortheintroductionofnew emphasis beingplacedonphysicalchemistryandinorganic The overlapwillbemainlyinorganicchemistry, withless overlap withtheChemistryprogramme(page144). of medicinalchemistry, althoughtherewillbeconsiderable the coursewillbranchoff intothemorespecialisedaspects In theJuniorandSeniorSophister(thirdfourth)years The Sophisteryears Course overview Did youknow? n in industry) Industrial chemistry(shortcourseonmedicinal (studyofdrugsbasedonthesteroidskeleton) Steroid drugs drugs inthisarea) (studyofthedevelopmentnew Anti-malarial chemistry that cancombatthemicroorganismscausedisease) agents(compounds andanti-infective Anti-microbial anti-cancer agents Anti-viral and diseases) Drug design(howchemistsnewdrugsforspecific withthebody) (howdrugsinteract Pharmacology ofmedicinalchemistry Basic principles many womenwithbreastcancer. in Swords(Co.Dublin)andhassavedthelivesof Taxol, whichismanufacturedbyBristolMyersSquibb discovery anddevelopmentofnewdrugssuchas aretheprofessionalsbehind Medicinal chemists

Engineering, Mathematics and Science 167 Mathematics In two of physics, mathematics, or applied mathematics chemistry, chemistry, physics/ biology, applied chemistry, mathematics and mathematics Mathematics In two of physics, chemistry, biology, biology, chemistry, Mathematics

TR076 10 410 B.A. HC3 Grade A Grade Grade C Grade C

OA2 or HC3 or OA2

(A-Level) COURSE CODE: PLACES 2011: POINTS 2010: AWARDED: DEGREE Special Entry Requirements: Leaving Certificate or Advanced GCE (A-Level) Advanced GCE Combinations not permitted: Physics/chemistry with physics or chemistry Applied mathematics with mathematics See also: Theoretical physics, page 169 TR035: TR071: Science, page 139 TR074: Chemistry with molecular modelling, page 160 page 166 TR075: Medicinal chemistry, GCSE What is Nanoscience and What is Nanoscience and Nanoscience, physics and and physics Nanoscience, Advanced materials? chemistry of advanced materials The ability to create new technologies or devices would not be possible without the use of advanced materials. Energy is an important issue for any new device, and making devices smaller approaching the nano-scale can reduce the energy cost, or nanodevices These nanostructures while increasing speed. can behave in surprising ways which are not like miniaturised versions of the macroscopic devices. Ultimately this behaviour is explicable by quantum mechanics but new methods of fabricating or interacting with such nanostructures is what nanoscience is all about, ideally to the benefit of technology and to people. Nanoscience incorporates applications in photonics, medical diagnostics, ultra-fast electronics and many other areas Advanced materials which in addition use advanced materials. include superconductors, polymers, lasers and optoelectronics

.

research project Further information Career opportunities Assessment Study abroad www.tcd.ie/Chemistry/undergraduate/medicinal-chemistry +353 1 896 3411 Tel: Medicinal chemistry would also serve as an excellent primary degree for a graduate course in medicine. and Deloitte & Touche. and Deloitte & As with graduates in other types of chemistry, the skills acquired acquired skills the chemistry, of types other in graduates with As to employers during this course will make you highly attractive pharmaceutical in a wide variety of areas. In addition to the and teaching industry itself, business, finance, administration You will be assessed by a combination of continuous will be assessed You assessment and end-of-year examinations. out their final-year research projects, from October to December, October to December, out their final-year research projects, from and Montpellier Copenhagen, Liverpool, Madrid, Regensburg, in Bologna universities. of medicinal are all possibilities open to you as a graduate Former graduates of this course are working in chemistry. Abbot, GlaxoSmithKline, Servier companies such as Wyeth, To date, arrangements have been made for students to carry date, arrangements To This may be carried out either in Trinity College under the College under the out either in Trinity This may be carried of staff, in a chemistry department supervision of a member laboratory. or in a commercial at an overseas university, Practical work in the final year will consist of a Practical work in the In the Senior Sophister (fourth) year, you will cover the year, Sophister (fourth) In the Senior nervous central and cardiovascular the of chemistry medicinal as well and drug delivery, chemistry systems, combinational and modern analytical medicinal chemistry as computational on chemistry (focusing studies in medicinal methods. Case drug types), will also feature on your specific diseases or programme. 168 Engineering, Mathematics and Science nanosciences). techniques (withspecificexamples oftheirapplicationsinthe interface effects, computersimulationandadvancedgrowth polymers andmetaloxides,superconductivity, surfaceand electronic and optoelectronic devices, conducting and insulating state physicsandchemistry, non-linearoptics,materials for nanoscience andothertopics,includingmoreadvancedsolid The SeniorSophister(fourthyear)coursefurtherexplores nanofabrication andnanocharacterisation. in CRANNusingtheirstate-oftheartfacilities of modernmaterials. techniques forthesynthesis,preparationandcharacterisation The practicalcoursewillintroduceyoutoawiderangeof microelectronic technology. spectroscopy, group theory, materialspreparationand lasers, thermodynamics,electrochemistry, macromolecules, on solidstatephysicsandchemistry, quantummechanics, The courseintheJuniorSophister(third)yearincludeslectures specialised coursesinmaterialsphysicsandchemistry. In theSophister(thirdandfourth)years,youwillstudy The Sophisteryears and 6hoursinlaboratoryclasseseachweek. There areapproximately15hoursoflectures/tutorials the propertiesofmaterialsandotheraspectsnanoscience. the SeniorFreshman(2ndyear)therewillbespecialcourseson – whichisIreland’s researchcentrefornanoscalematerials.In Adaptive NanostructuresandNanodevices)– and Chemistry, andinCRANN(CentreforResearchon from worldleadingexpertsbasedintheSchoolsofPhysics and modernaspectsofnanosciencematerialsscience (pages 140-142). There willbespecialtutorialsonhistorical programme, takingchemistry, physicsandmathematics In thefirsttwoyearsyouwillfollowScience(TR071) The Freshmanyears in bothchemistryandphysics. or nanodevicesitisadvisabletohaveathoroughgrounding develop, controlanduseadvancedmaterials,nanostructures to theareasofnanoscience. To understandhowtomake, with thedevelopmentofnewtechnologiesandtheirapplication of chemistryandphysicstosolvepracticalproblemsassociated This degreewillteachyouhowtouseandapplytheprinciples industries andtechnologiesthatareshapingourfutures. and haveastrongdesiretoapplyyourscientificskills This coursewillappealtoyouifareinterestedinscience airlines andhealthcare.Innanosciencesizematters. and electronics,totelecommunicationsbroadcasting, and theycanbefoundinapplicationsrangingfromcomputers Course overview Is thistherightcourseforyou? Some laboratorytrainingisprovided www.crann.tcd.ie

to learnaboutdifferent countriesandcultures. students todeveloptheirpracticalskillsinmaterialsscienceand in Australia, Belgium,France,GermanyortheUSA. This allows Many studentscarryouttheirfinalyearprojectabroad,mainly assessment andend-of-yearexaminations. You willbeassessedbyacombinationofcontinuous Tel: +35318961726/2040 www.tcd.ie/Chemistry/nanoscience materials, akeyresearchareain Trinity Collegeitself. also opportunitiestocarryoutpostgraduatestudyinadvanced as thesemiconductor, polymerandopticalindustries. There are employment incutting-edgehightechnologyindustries,such This degreewillprovideyouwithaflexiblequalificationfor University ofPotsdam(UniversitätPotsdam)Germany. The ScrippsResearchInstitute,LaJolla,California;andthe micro- andnano-electronicsresearchcentreinLeuven,Belgium; Laboratories whereprojectshavetakenplaceincludetheIMEC as nano-technology, andsmartbiomimeticmaterials. students dotheirprojectsininnovativeresearchareassuch nanostructures ornanodevicesinreal-lifesituations.Many become familiar with theapplicationsofadvancedmaterials, project, frequently abroad in an industrial laboratory In thefinalyearyouwillalsocarryoutaresearch Career opportunities Study abroad Assessment Further information Did youknow? n College. by theSchoolsofPhysicsandChemistryin Trinity research intothenanoworld.CRANNwaspioneered in Trinity Collegeandhasstateoftheartfacilitiesfor materials. ItishousedinthenewNaughtonInstitute research intheCRANNcentrefornanoscale Many graduatesfromthiscoursegoontodo , to , to Engineering, Mathematics and Science 169 Course content Cosmology, astrophysics, chaos, relativity and quantum Cosmology, In study. will you that topics exciting the of some are mechanics the practical classes you will study the latest ideas in magnetism, laser technology and semiconductors. superconductivity,

and physics and physics In mathematics In mathematics TR035 40 500* B.A. HB3 Grade B

COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE Special Entry Requirements: Leaving Certificate Advanced GCE (A-Level) See also: page 164 TR031: Mathematics, TR071: Science, page 139 of advanced TR076: Nanoscience, physics and chemistry materials, page 167 Course overview Is this the right course for you? Is this the right course for What is Theoretical physics? Theoretical physics Theoretical The course combines much of the mathematics and physics curricula, including several modules specifically designed with Theoretical physics programme in mind. In the Freshman the (first and second) years students take 40 credits in maths and 20 credits in physics (from a total of 60 credits). In the Sophister (third and fourth) years students take, on average, 30 credits There are approximately in maths and 30 credits in physics. 24 hours of lectures, tutorials and laboratory classes per week. If you enjoy mathematics and seeing how physical theories can If you enjoy mathematics and seeing how universe on every be developed to unlock the secrets of the scale from the quark to the Big Bang, you will be stimulated by this course. If you want to keep a wide range of options open for Theoretical physics. It consistently the future, you can do this in attracts a spirited and talented class that makes the most of the experience. Trinity Theoretical physics explores the natural world at its most Theoretical physics explores the natural world guided by fundamental level, using mathematical theories the foundation for experimental investigation. For some it is For others it an academic career in mathematics or physics. medicine, in industry, provides the basis for many career options Trinity College provides a course finance and computing. law, Its which ranges widely across physics and mathematics. skills and versatility. graduates are in demand for their technical 170 Engineering, Mathematics and Science teaching. physics, informationtechnology, scientificcomputingand journalism, weatherforecasting,telecommunications,medical demand byemployersindiverseareasincludingpatentlaw, background andskillsthatthecoursedevelopsareingreat an infiniteworldofpossibilitiesbeckons. Thebroadscientific experimental physicsaswelltheoreticalphysics. Alternatively, Harvard, andImperialCollegeLondon)inmathematics institutions throughouttheworld(suchasCambridgeUniversity, Many ofourgraduatesproceedtoPh.D.degreesinleading up theassessmentprocess. Continuous assessmentandend-of-yearexaminationsmake Tel: +35318961949/2019 www.maths.tcd.ie orwww.physics.tcd.ie Maths is tobetakenineachyear. A totalof60ECTScredits the Sophisteryears practical/project modulesin 5 creditlectureand10 of theFreshmanyearsand (each of10credits)ineach divided intotwomodules The teachingofphysicsis Physics Career opportunities Assessment Further information n (1st &2ndyears) Junior &SeniorFreshman n n n 20 creditsphysics 40 creditsmaths, and groupstudyprojects There arelaboratoryclasses Astrophysics. Chaos andcomplexity, interactions, Specialrelativity, physics, Electromagnetic Quantum physics,Nuclear and waves,Optics,Materials, Thermal physics,Oscillations The physicsofmotion, modern physicsaretaken: Topics inbothclassicaland

Algebra Equations ofmathematical Mechanics Analysis physics

n n n n n n n n (3rd year) Junior Sophister 30 creditsphysics 30 creditsmaths,

physics II physics I There is also a laboratory There isalso Astrophysics Ior Condensed matter Condensed matter Atomic andnuclear Statistical physics Quantum mechanics theory Classical field skills develop communication class, andworkshopsto Computer simulationI physics and electrodynamics

solving ability develop yourphysicsproblem There arealsotutorialsto computational physicsproject. In additionyouwillcompletea n n Optional coursesarein: n n n n n n n (4th year) Senior Sophister credits) 35 creditsphysics(total60 25-35 creditsmaths,25- available eachyear and aprojectoptionare Other mathematicalmodules

Advanced topics Nanoscience High energyphysics photon Electron and theory Condensed matter Partial differential General relativity Differential geometry theory Quantum field physics equations

Engineering, Mathematics and Science 171

www.scss.tcd.ie/ Have an understanding and potential of the role, application government and society in business, industry, of IT skills Have well-developed business, communication and IT policies and strategies Be able to create and develop IT operations Be able to manage IS and IT Be able to design, develop and implement appropriate topics Have in-depth knowledge of one or more specialist IT that interest them IT solutions IT Entry Requirements: complete the Diploma in Students who successfully may apply for entry to this two-year Information systems to the award of B.Sc. (Hons.) in degree course, leading Information systems. at a sufficiently high level Holders of other qualifications to the Diploma in Information and deemed to be equivalent for direct entry to the degree systems may also apply course. work experience will be taken For all candidates: relevant experience is not essential in order into consideration, but to apply. Application Procedure: to apply This is not a CAO course. Students are required and Statistics. directly to the School of Computer Science by 30 June 2012 Completed applications must be returned for entry to the academic year 2012/13. to availability. Late applications will be considered subject Details of how to apply are available at undergraduate/bscis Further information B.Sc. Degree in Information systems Information n n n n n n www.scss.tcd.ie/undergraduate/bscis E-mail: [email protected] +353 1 896 1765 Tel: This flexible two-year honours degree course is intended for This flexible two-year honours degree course and managers those who wish to become senior professionals are equipped in business information technology (IT). Graduates industry and in a range of to manage in all sectors of the IT The syllabus functions in business, industry and government. drawn from includes technologies, techniques and methods practice. Lectures research and internationally-accepted best week with occasional are delivered on up to three evenings per classes at weekends. On completion of the course the student will:

www.scss.tcd.ie/ Diploma (2 years) in Information systems systems (2 years) (Hons.) in Information B.Sc.

Understand the principles, methods, architectures tools and used in the development and management of IS and IT Be aware of pressing current issues the use concerning skills, developed Possess business, communication and IT through extensive practical assignments and project work Be able to design, develop and implement appropriate IT solutions IT in practice of IT undergraduate/bscis Application Procedure: to apply This is not a CAO course. Students are required and Statistics. directly to the School of Computer Science by 30 June 2012 Completed applications must be returned for entry to the academic year 2012/13. to availability. Late applications will be considered subject Details of how to apply are available at: Minimum Entry Requirements: equivalent, Six passes in the Leaving Certificate, or English and with a minimum grade C3 at ordinary level relevant Mathematics. In addition to these requirements, work experience will be considered. years of age Applicants who will be at least twenty-three may be on 1 January of proposed year of admission the minimum admitted as mature students without having matriculation qualifications. will be taken For all candidates: relevant work experience in order into consideration, but experience is not essential to apply. This four-year programme comprises two distinct programme comprises This four-year components: n n Diploma in Information Information Diploma in Information systems systems Information systems (Part-time/evening) n n n n On completion of the course the student will: This flexible two-year course is intended for information This flexible two-year course is intended technology (IT) professionals and for those who wish to work in Graduates are equipped to apply skills information technology. such as systems development and design, project management and technical support in business, industry and government. The syllabus includes technologies, techniques and methods drawn from research and internationally-accepted best practice. Lectures are delivered on up to three evenings per week with occasional classes at weekends. 172 Health Sciences Dental hygiene Nursing –general(Adelaide) Nursing –general Midwifery Medicine Human nutritionanddietetics Human healthanddisease Dental technology Dental science Dental nursing Health Sciences 173 188 188 186 181 180 179 178 176 174 Nursing –psychiatric Bachelor innursingstudies(part-time) Bachelor inmidwiferystudies(part-time) Direct Entry(non-CAO): Radiation therapy Physiotherapy Pharmacy Occupational therapy Nursing –children’s andgeneralintegrated Nursing –intellectualdisability 200 199 198 196 194 192 188 188 188 Health Sciences 173 Radiography – portfolio of experience Administration of local anaesthesia Human diseases and general pathology Periodontology & Implantology Research methods Cariology & paediatric dentistry Psychology and social concepts Introduction to orthodontics Basic preventive and therapeutic oral care Restorative and prosthetic materials and therapy Dental radiography Head and neck anatomy Pharmacology Computer skills Public dental health services Presentation and communication skills Explorative outreach fieldwork in the public sector Explorative clinical session in DDSH Clinical practice training (3 sessions a week) Applied psychology Health promotion & project work Smoking cessation counselling Professional responsibilities Introduction to clinical practice Microbiology and infection control Oral pathology and surgery Physiology and medical emergencies Course overview Course Course content

Module 5: Evidence based practice (20 ECTS) n n n n n n n n Module 2: Clinical practice part I (30 ECTS) n n n n n (15 ECTS) Module 3: Clinical and outreach practices n n n n n n Second year modules Module 4: Health promotion practice (10 ECTS) n n n n This two-year course is based in the Dublin Dental University the Dublin Dental University course is based in This two-year and academic, project-based College. It has Trinity Hospital at Dental out in the Dublin which are carried clinical components Services Executive and general University Hospital, Health is on small-group interactive hospital settings. Emphasis projects, evidence-based learning, learning, health promotion be integrated with undergraduate will You and clinical practice. and dental nursing students for some dental science students elements of the programme. some modules are The curriculum has a modular design and prerequisites for others. First year modules (15 ECTS) Module 1: Preparation for clinical practice n n n n

TR802 8 440* Diploma COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARD: Garda Vetting: vetting. Students will be required to undergo Garda See page 27 for further details. to a negative HBsAg test result. page 202. See Precautions against infectious diseases Entry Requirements: Leaving Certificate pass in English, mathematics and in four other subjects, A biology, one of which must be physics, chemistry, agricultural science or physics/chemistry. of a standard Of the six subjects presented two must be of at least grade C3 on higher Leaving Certificate The remaining four subjects must be presented papers. Leaving to a standard of at least grade D3 on ordinary Certificate papers. of admission to this course are made subject All offers This is a restricted entry course. This is a restricted be submitted by 1 February of the Applications MUST proposed year of entry. a questionnaire in March to be Applicants will receive completed and returned. Is this the right course for you? What is a Dental hygienist? Dental hygiene (diploma) hygiene Dental If you have an interest in working in oral health, and particularly You preventative oral health, then this course is right for you. will need to be able to develop good patient care skills, so an empathic personality and good communication skills are initiative show and player team good a be to need You important. to achieve the best for people in your care. The dental hygienist provides preventative oral care to both The dental hygienist provides preventative needs in children and adults including those with special This collaboration with a registered dentist in a clinical setting. includes treatments to prevent or control periodontal (gum) and counselling in relation to advice disease and dental decay, The dental hygienist lifestyle habits such as diet and smoking. also provides oral health education to both individuals and groups of people and can be involved in the planning, delivery The and evaluation of oral health promotional programmes. dental hygienist works within the dental team and with other groups of health care workers to provide a holistic approach to patient care. 174 Health Sciences in Ireland. This registrationismandatoryforworkingasadentalhygienist as adentalhygienistontheRegisterofIrishDentalCouncil. Dublin entitlesgraduatestoregisterimmediatelyaftergraduation The DiplomainDentalhygieneconferredby Trinity College care andafinalwrittenclinicalexamination. clinical creditsdemonstratingofareasonablelevelpatient in variousclinicalprocedures,completionoflogbooks, community-based healtheducationproject,competencetests Assessment isbywrittenexaminationsduringthetwoyears,a n n n n n n n n n n After qualifyingasadentalhygienistyouwillbeableto: n n n Module 6:ClinicalpracticeII(30ECTS) Tel: +35316127369 E-mail: [email protected] Contact: LecturerinDentalhygiene: CatherineWaldron RDH,MSc. www.dentalhospital.ie sector. in hospitalsandinstitutionalsettingswithinthecommercial or specialistdentalpractices,intheHealthServicesExecutive, employed oremployed. You mayfindemploymentingeneral As adentalhygienist,youhavetheoptionofbeingself

practice Your degreeandprofessional Assessment Further information Career opportunities of primaryhealthcare a dentalteaminoralhealthpromotionandtheprovision Place temporary dressings and re-cementcrowns dressingsand Place temporary dentalhygieneprocedures anaestheticfor Administer local Take dentalradiographs mouthandinformthedentist inthe Recognise abnormalities anddesensitising preparations Apply fluoride-containing Place fissuresealants theteeth Debride andpolish andassessthelevels Carry outprocedurestomeasure oral educationalactivities andevaluate Plan, implement Describe theroleofdentalhygienistandfunctionwithin practice Internal clinical practice External clinical clinicalsessions Observational temporarily agents totheteeth of oralhealthandhygiene for groupsandindividuals (SelecttheEducationlink)

involved withtheadministrationofdentalsurgery. provision ofdentaltreatment. The dental nursemayalsobe to workcloselyprovidingsupportandassistanceduringthe ability touseinitiative,goodmanualdexterityandbeprepared include thefollowing:communicationandorganisationskills, Skills requiredofstudentsconsideringdentalnursingshould care. preparation andmaintenanceofthedentalsurgery, andpatient Main dutiesincludeinfectioncontrol,chair-sideassistance, in thedeliveryofdentaltreatment. an auxiliaryprofession,supportingmembersofthedentalteam Dental nursesarevaluablemembersofthedentalteam. This is Voluntary RegisterofDentalNurses. and acquirethequalificationsforentrytoDentalCouncil You learnabouttheday-to-dayrunningofadental practice and practicalcompetenceneededtoworkinadentalsurgery. and dentalhealtheducation. This coursegivesyoutheskills The moderndentalnursetrainsinallaspectsofclinicalpractice emergencies andpatientcare. prevention, chair-sideassistance,managementofmedical care. The maindutiesofadentalnurseinclude:infectioncontrol all aspectsofpatienttreatmentandplaysavitalrolein and managementofthedentalpractice,assistsdentistin The dentalnurseplaysanimportantroleintheorganisation What isaDentalnurse? Dental nursing(diploma) See page27forfurtherdetails. Students willberequiredtoundergoGardavetting. Garda Vetting: Certificate papers to astandardofatleastgradeD3onordinaryLeaving papers. The remainingfoursubjectsmustbepresented of atleastgradeC3onordinaryLeavingCertificate Of thesixsubjectspresented,twomustbeofastandard agricultural scienceorphysics/chemistry. one ofwhichmustbephysics,chemistry, biology, A passinEnglish,mathematicsandfourothersubjects, Leaving Certificate Entry Requirements: AWARD: POINTS 2010: PLACES 2011: COURSE CODE: Diploma 355* 25 TR801 Health Sciences 175 (from the main menu select: Assessment Career opportunities Further information Please contact the Dental Nurse Tutor Tel: +353 1 6127238 Tel: Tutor Please contact the Dental Nurse E-mail: [email protected] www.dentalhospital.ie Education, Undergraduate programmes) Year 1 is assessed by written examinations, practical 1 is assessed Year and an oral examinations, continuous clinical assessment presentation. by written examinations, a multi-station 2 is assessed Year experience, case practical examination, a portfolio of clinical study written report and an oral presentation. As a graduate of Dental nursing, you will be able to find work in a variety of working environments including dental hospitals and Health Service Executive dental clinics, as well as in general and specialist dental practices. Depending on the work setting, advancement in the field may include: senior dental nurse, clinic marketing representatives for practice manager, nurse manager, relevant companies, and oral health promotion. Successful completion of this programme will permit entry onto Register of Dental Nurses, Ireland. the Dental Council Voluntary

Practice management Health psychology Clinical Dentistry III Head and neck anatomy Oral health and the community Social concepts in patient care Clinical dentistry II Introductory module Microbiology and cross-infection control Dental and oral pathology Physiology and medical emergencies Clinical dentistry I Computer studies Course content Course overview Is this the right course for you? the right course Is this

n n Second year modules n n n n n n n n n n n First year modules The programme consists of lectures, tutorials, demonstrations The programme consists of lectures, tutorials, will be assessed on a continuous You and practical experience. of theory to practice. basis regarding suitability and application appropriate By the end of the course, you will have developed will be integrated You skills in patient and team management. hygiene and dental with undergraduate dental science, dental the course to ensure technology students for some elements of teamwork throughout the dental profession. effective In second year, you will spend time on external placements in In second year, in general dental a health-service executive dental clinic and practices throughout the Dublin area. This two-year course is divided into practical and academic This two-year course Both the formal academic teaching and (modular) components. experience are gained at the Dublin Dental your practical clinical College. Trinity University Hospital at Yes, if you have an interest in working as part of a dental team in working as part if you have an interest Yes, You will need to be able to develop good patient skills and be will need to be able to develop good You a caring and while having effectively, able to communicate is an advantage. understanding personality in the delivery of oral healthcare. in the delivery 176 Health Sciences relationship withpatients,co-workers andthewidercommunity. you alsohaveanabilitytobuild acaringandprofessional individuals. The natureofdentistrymakesitessentialthat like tospecificallyfocusonoral healthcareanditsimpacton Yes, ifhealthcare ingeneralinterestsyouandifwould the removalofteeth. replacement ofmissingteethandsurgicalproceduressuchas restoration ofdamagedteeth,thecorrectionirregularities, and dentaldiseases. Treatment involvesareassuchasthe care, includingprevention,diagnosisandtreatmentoforal can safelyandeffectively deliverthefullrangeofprimarydental This five-yearprogrammeisdesignedtoensurethatgraduates Dental science Is thistherightcourseforyou? Course overview See page27forfurtherdetails. Students willberequiredtoundergoGardavetting. Garda Vetting: See precautionsagainstinfectiousdiseasespage202. to anegativeHepatitisBantigen(HBsAg)testresult. All offers ofadmissiontothiscoursearemadesubject Agricultural sciencewithbiology Physics/chemistry withphysicsorchemistry Combinations ofsubjectsnotpermitted: Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

HB3 + HC3 Grade B+C

B.Dent.Sc. 580* 32 TR052

In twoof:physics, grade Borbetter mathematics at present GCSE physics youmust a qualificationin biology chemistry or OC3/HD3 orbetter mathematics at must present in physicsyou a qualification science. or agricultural physics/chemistry chemistry, biology, In twoof:physics, If youdonothave If youdonothave

learning whichisarequirementforallhealthcareprofessionals. aims toprovidegraduateswiththeskillsnecessaryforlife-long encourages studentstoengageinself-directedlearningand achieve thelearningobjectives.Problem-basedalso supervision) toundertakeresearchfindoutabouthow learning objectivesandstudentsorganisethemselves(under will beapplied.Structuredproblemsaresettomeetspecified relevant tothefutureclinicalsituationsinwhichknowledge and physiologyinanintegratedmanneracontextthatis students tolearnsubjectssuchaschemistry, biochemistry Problem-based learning(PBL)isdesignedtoencourage their progressthroughouttheprogramme. ensuring thatstudentsreceiveconsiderablestaff inputinto through yourprofessionalcareer. The classsizesaresmall evaluate andupdateyourknowledgeclinicalpractice format, which aims to provide you with the skills to continuously The curriculumisdeliveredinaproblem-basedlearning(PBL) standard withemphasisontheuseofinformationtechnology. at Trinity College. The clinicalfacilitiesareofaveryhigh This courseisbasedintheDublinDentalUniversityHospital n n n n n n n areas (approximately30hoursperweek): During thefirstdentalyearyouwillcoverfollowingsubject The firstdentalyear of qualifieddentalstaff fromthesecond yearonwards. You willprovidepatientcareunderthestrictsupervision provided asappropriate. simulations, audiovisualande-learningopportunitiesarealso will develop in laboratories and clinics. Lectures, demonstrations, with thedevelopmentofpracticalandclinicalskillsthatyou problems presentedandfacilitatedbystaff. These topicstiein (PBL) thatconsistofstudent-leddiscussionsontopicsand The courseisdeliveredmainlythroughsmall-grouptutorials than forstudentsofothercourses. (five years)andintenseastheacademicyearismuchlonger attention to detail with small margins for error. The course is long physically andmentallydemandingasitrequiresconsiderable You shouldalsoenjoyundertakingclinicalpracticethatis Problem-based learning(PBL) Why studyatTrinity College? Course content Ethics andlaw Behavioural science (ECDL) Computer applications Introduction todentistry learning Physics project-based Anatomy workshopsandlectures PBL tutorials(6hours/week)

Health Sciences 177

(from the main menu select: Your degree and professional professional degree and Your Further information Assessment Study abroad Career opportunities practice (B.A., B.Dent.Sc) While most graduates enter general practice, many also enter While most graduates enter general practice, care for special the health board dental service, which provides operated by the needs patients and children in health clinics smaller number of openings exist in A regional health boards. or registrars. dental schools and hospitals for house officers specialist areas. These positions can lead on to training in university a or research postgraduate include possibilities Other teaching career. The degree Bachelor of Dental Science (B.Dent.Sc) College Dublin entitles graduates to Trinity conferred by www.dentalhospital.ie Education, Undergraduate programmes) +353 1 896 1789 / 1690 Tel: E-mail: [email protected] In keeping with the PBL-style curriculum, a wide variety of a wide variety with the PBL-style curriculum, In keeping There are end-of- in all years. methods are used assessment skills tests practical tests, written assessments, term integrated examinations, written reports and oral/ of competence, clinical short The written assessments include verbal presentations. short answer and multiple choice type questions. essay, year can participate in an Erasmus Students in the fourth Sweden, with dental schools in Norway, exchange programme the fourth and fifth dental years, Spain and the UK. Between variety wide a in placements voluntary undertake students some countries. of international locations such as developing are excellent. Career prospects for graduates of dentistry register immediately after graduation as a dentist on the Register of the Dental Council of Ireland and those who are EU citizens may register with the regulatory bodies of other countries in the European Union (such as the UK, France, etc.). Germany, Graduates who wish to practice in countries outside the to undergo or Canada will be required EU such as the USA additional training and pass specified examinations.

Prosthodontics which involves of artificial the various type replacements for missing teeth Experimental design, data collection and analysis Public dental health with an emphasis on disease prevention care of special needs as well as on the and epidemiology, patients dental health which includes orthodontics (braces) Children’s and dental care specific to children Restorative dentistry which involves fillings and crowns; periodontology which includes treatment for gum disease Human diseases, including both medical and surgical aspects The principles of experimental design, data collection and analysis the biological and medical sciences Relevant elements of of a practising dentist appropriate to the needs Health and safety Normal function at cell and system levels and the integration levels and the integration at cell and system Normal function of body systems their relationshipBacteria, viruses and to the human immune system Clinical of systemic and oral disease signs and symptoms Basic clinical for the treatment of patients skills necessary Clinical training begins in the second year with students learning Clinical training begins in the second year and diagnosis. the vital basic skills of history taking, examination will start providing Approximately half way through the year you very simple treatments for patients. In addition you will develop communication skills with particular In addition you will develop communication and explain the reference to patient care, learn how to interpret oral disease with clinical signs and symptoms of systemic and begin to practice the particular reference to dental practice and patients. Courses in clinical skills necessary for the treatment of relevant knowledge the second year are complementedby of the appropriate to elements of the biological and medical sciences the needs of a practising dentist. n n n n n n Topics you will study in years three, four and five include: you will study in years three, four and Topics Years three, four and five three, four and Years be encouraged During the later years of the course you will oral health and to take an approach to the management of evidence. scientific available best the on based is which disease aware of related In tandem with this, you will also need to be communities. In general healthcare issues for individuals and these three years you will provide more complex patient care. n n n n n n n The second dental year The second year are to ensure of the second dental The objectives that you develop an understanding of: an understanding that you develop 178 Health Sciences ensure effective teamworkthroughoutthedentalprofession. Dental sciencestudentsforsomeelementsofthecourseto dental appliances. You willbeintegratedwithundergraduate alloys, makeporcelainrestorationsandcreatehigh-quality relevant materialscienceandlearnhowtoaccuratelycast dental of dentaltechnology. You willgetagoodbackgroundinthe understanding andtechnicalskillsinallofthebasicdisciplines This three-yearcourseisdesignedtogiveyouahighlevelof your technicalskills. laboratory, bothtolearnlaboratorymanagementanddevelop and technology. Inthethirdyear, youwillbebasedinadental basic sciences,andinallaspects oflaboratorytechniques College, thiscourseincludeslecturesandpracticalsinthe Based intheDublinDentalUniversityHospitalat Trinity good manualdexterityskills,youmaybesuitedtothiscourse. an interestinoralhealth,arecreativelymindedandpossess team fabricatingprostheticdentaldevices. Therefore, ifyouhave As a dental technologist,youwillbeworking aspartof the dental (ordinary degree) Course overview Dental technology Course content Is thistherightcourseforyou? appropriate relevantexperienceindentaltechnology. not satisfytheaboverequirementsbutcandemonstrate Applications mayalsobeconsideredfromthosewhodo Certificate papers. to astandardofatleastgradeD3onordinaryLeaving papers. The remainingfoursubjectsmustbepresented of atleastgradeC3onordinaryLeavingCertificate Of thesixsubjectspresentedtwomustbeofastandard agricultural scienceorphysics/chemistry. one ofwhichmustbephysics,chemistry, biology, A passinEnglish,mathematicsandfourothersubjects, Leaving Certificate Entry Requirements: completed andreturned. Applicants willreceiveaquestionnaireinMarchtobe proposed yearofentry. Applications MUST besubmittedby1Februaryofthe This isarestrictedentrycourse. DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: B.Dent.Tech 360 6 TR803 n n Third year n n n Second year n n n n First year Tel: +35316127256 E-mail: [email protected] Education, Undergraduateprogrammes) www.dentalhospital.ie equipment companyortomoveintoforensicwork. assist youinbecomingarepresentativefordentalmaterials/ studies –dentalmaterialsscienceorresearch.Itwouldalso laboratory owner;teachdentaltechnology;partakeinfurther technologist workinginadentallaboratory, becomeadental This courseallowsyoutopursueacareerasdental examined byexternalandinternalexaminers. undertake aliteraturereviewanddissertationwhichwillbe and recordthisexperienceinalogdiary. Inadditionyouwill In yearthreeyouwillundertakeproductionworkforpatients and two. combined withend-of-yearwrittenexaminationsinyearsone Continuous assessmentinthepracticalaspectsofyourworkis first andsecondyears. There areapproximately30hoursofclassesperweekinthe Assessment Further information Career opportunities Completion of dissertation Completion of prosthodontics, removableparitaldenturesandorthodontics. theoryandpracticeforprosthetics,fixed Dental technology prosthodontics, removableparitaldenturesandorthodontics. theoryandpracticeforprosthetics,fixed Dental technology Material science Business studies prosthodontics, removableparitaldenturesandorthodontics. theoryandpracticeforprosthetics,fixed Dental technology Computer studies Chemistry Physics (fromthemainmenuselect:

Health Sciences 179

Project

A major component of the fourth major component of the fourth A The School of Medicine in Trinity College is a member Trinity The School of Medicine in medical of EuroLife, a consortium of leading European and training schools which aims to enhance research in the medical sciences that underpin developments in human healthcare. n Career opportunities Further information Assessment Did you know? areas may be in the areas of cancer biology; investigation of areas may be in the areas engineering; exercise and rehabilitation; brain disorders; tissue and inflammatory disorders to name gastrointestinal disorders but a few. between the The course will emphasise the crucial links sectors scientific, clinical, health promotion and pharmaceutical and the health of the and their role in advances in patient care wider population. Graduates will therefore be ideally qualified to participate in health-related research or health promotion within academia or industry and will also be excellent candidates for B.Sc. is also an A entry to graduate medicine programmes. appropriate qualification for entry into a broad range of other careers (e.g. teaching, management). Department of Physiology, Contact: Dr Neil Docherty, School of Medicine E-mail: [email protected] + 353 1 896 2076 Tel: The Sophister (third and fourth) years (third The Sophister which of modules and fourth years, a combination In the third are systems and pharmacology of specific organ cover diseases focused Delivery of clinically gastrointestinal disease. taken, e.g. is included. specialist clinicians material by you will undertake advanced modules As a fourth-year student, of disease and cutting-edge advances on the molecular basis in biomedical science. laboratory-based project in year will be a comprehensive supervised by leading researchers in biomedical research affiliated teaching hospitals. College and its Trinity by a combination of continuous will be assessed You assessment and end-of-year examinations. In one of physics, In one of physics, chemistry, chemistry, physics/chemistry chemistry Biology Biology Grade C HC3 TR056 33 505* B.Sc. HC3 Grade C

COURSE CODE: COURSE PLACES 2011: POINTS 2010: AWARDED: DEGREE Special Entry Requirements: Leaving Certificate Advanced GCE (A-Level) Course overview Is this the right course for you? What is Human health and Human health and disease health and Human disease? You will study the structure and function of the human body You perspective through lectures, tutorials from a ‘molecule to man’ physiology biochemistry, and laboratory classes in cell biology, Modules based on critical thinking, problem- and anatomy. based learning, presentation skills and research and statistics will further contribute to the development of a core skill set, as outlined above. The Freshman (first two) years The programme will suit you if you want to obtain a degree that provides comprehensive instruction in all aspects of basic human biology and applied biomedical science. A central feature of the learning experience is the development A in the following areas; of a core set of real-life, transferable skills data analysis, public laboratory technique, group project work, and critical presentation, report writing, research methodology thinking. The Human health and disease degree brings to life the The Human health and disease degree brings and function in the fascinating connections between structure process in depth, including It explores the disease human body. prevent disease. For how medical therapies act to treat or even biochemistry allows example, understanding brain structure and and this in turns us to appreciate how neurones communicate ways to and effective helps biomedical researchers to find new Alzheimer’s Disease. treat and prevent 180 Health Sciences to themanagementofdisease. disciplines topromotehealth,preventdiseaseandcontribute Dietitians applytheirknowledgeoffood,nutritionandrelated Dietetics isoneofthehealthandsocialcareprofessions. dietetics, medicine,communicationsandpublichealth. disciplines includingbiochemistry, physiology, cellbiology, It spansabroad-rangingarea,overlappingwithmanyother Nutrition isabranchofsciencedevotedtothestudynutrients. awarded jointlybyDIT and TCD. the B.Sc.(honors)degreeinHumannutritionanddieteticsis individual andcommunitylevel.Onsuccessfulcompletion, and theirapplicationtohumanhealthwellbeing,atboth education inthescienceofnutritionandpracticedietetics institutions. The courseisdesignedtoprovideanintegrated of Technology (DIT)and TCD. Studentsareregisteredinboth This four-yearfull-timecourseisrunjointlybytheDublinInstitute demands onyour time. are importantattributes. The coursewillplace considerable Good interpersonalskillsandan abilitytoworkwithothers particular interest in the relationship between food and health. You willneeda strong interestinsciencesubjectsanda dietetics Course overview Human nutritionand Is thistherightcourse foryou? Website: www.dit.ie/study/internationaloffice/howtoapply Dublin 6 143-149 LowerRathminesRoad Dublin Instituteof Technology The InternationalStudentOffice be directedto: Applications frominternationalnon-EUstudentsshould Website: www.dit.ie/study E-mail: [email protected] Fax: +35314023399 Tel: +35314023445 Dublin 6 143-149 LowerRathminesRoad Dublin Instituteof Technology The Admissions Office details areavailablefrom: and matureentryapplicationsareconsidered.Further In additiontostandardCAOapplications,advancedentry Application Procedure requirements contacttheDIT. Institute of Technology (DIT).Forfulldetailsofadmission This isajointcoursebetween TCD andtheDublin Special EntryRequirements: DEGREE AWARDED: POINTS 2010: COURSE CODE:

B.Sc. (Hum.Nut.&Diet.) 540 DT223

n n n n n subjects. You willstudy: will developabroadunderstandingoftherelevantpre-clinical During theJuniorandSeniorFreshman(firsttwo)yearsyou The Freshmanyears and capabilityinresearchdevelopment. others inanethicalandadaptablemanner, andtofosterinterest of theoryintopractice,theabilitytoworkandcommunicatewith the developmentofanalyticalandcriticalthinking,integration of scientific knowledge relevant to human nutrition anddietetics, The modules in this course are designed to enable the acquisition defend itorally. the resultsofyour final-yearresearchproject, and present professional placements. You willalsowriteathesis toreport Continuous assessmentsarecarried outduringyour conducted insomesubjects. make uptheassessmentprocess. Oralexaminationsare assessment ofcoursework,practicalworkandassignments End-of-year writtenexaminations,togetherwithcontinuous community settingsinIreland. Practical placementsarearrangedinavarietyofhospitaland will befollowedbyaperiodofcollege-basedconsolidation. one attheendofeachfirstthreeyears.Eachplacement programme. These placementsaredividedintothreeblocks, Practice placementsareacompulsoryelementofthe Professional placements European or American university. final year, withtheoptiontocarrythisoutinapartner You willundertakeathree-monthresearchprojectinthe subjects studiedtoanadvancedlevel(nutrition,dietetics). medicine andtherapeutics,medicalscience)thedegree specialist subjectsareintroduced(management,epidemiology, foundation subjectsarestrengthened(Researchmethods), In theJuniorandSeniorSophister(thirdfourth)years, The Sophisteryears n n nutrition expertintheindustrialsector. level asadietitian,publichealthnutritionistortowork Graduates fromthiscourseareequippedtopracticeatentry Course content Assessment Communications, Behavioural science Behavioural Communications, cycle Nutritionthroughthelife Food studies,Nutritionscience, Microbiology/Immunology Cell biology, Physiology, Biochemistry Physics, Chemistry, Clinicalchemistry Professional practice studies Professional practice Research methodologyandstatistics Health Sciences 181

If you do not have In two of physics, If you do not have a qualification in physics you must present mathematics at OC3/HD3 or better chemistry or biology a qualification in physics you must present GCSE mathematics at grade B or better chemistry, biology, biology, chemistry, physics/chemistry or agricultural science In two of physics, www.cao.ie www.cao.ie

Grade B + Grade C HB3 + HC3 + HB3

TR051 123 731* M.B. (Bachelor in Medicine), and B.Ch. (Bachelor in Surgery) Obstetrics). B.A.O. (Bachelor in

COURSE CODE: COURSE PLACES 2011: POINTS 2010: DEGREES AWARDED: This is a restricted entry course. This is a restricted be made online via Applications MUST 2012. not later than 1 February register for the HPAT-Ireland Applicants must also January 2012 admission test by 20 ). (via www.hpat-ireland.acer.edu.au matriculation for required grades all achieve must Students ONE SITTING requirements and course requirements in GCE of their Leaving Certificate/Matriculation/Advanced (A-level) examinations. See note 3B (page 32) for further details. Special Entry Requirements: Leaving Certificate Advanced GCE (A-Level) Combinations of subjects not permitted: Physics/chemistry with physics or chemistry Agricultural science with biology See page 202 for vaccination requirements with regard to Hepatitis B, Hepatitis C and Tuberculosis. to Hepatitis B, Hepatitis C and Garda Vetting: Students will be required to undergo Garda vetting. See page 27 for further details. Medicine ) ) www.nutritionsociety.org qualification in dietetics in the Republic of Ireland. The in the Republic of Ireland. qualification in dietetics by the Irish Nutrition & Dietetic degree is recognised Association (BDA), Dietetic Institute (INDI), the British Association (ADA), and the American Dietetic the Nutrition Society. This course is leading the only one to a professional

The Irish Nutrition and Dietetic Institute (www.indi.ie The Nutrition Society ( “I was always attracted to the study of nutrition because “I was always attracted to the study of nutrition health I was fascinated by the possibility of enhancing I read the though implementing dietary changes. When I and DIT Trinity by curriculum of the course offered the perfect combination of science thought that it offered This is one of the few and practical skills I was looking for. courses where you can study nutrition and dietetics at the same time, so when you graduate you have the practical skills backed up by scientific evidence. Being a mature I felt a bit nervous about leaving student with a family, my job to embark on a full-time undergraduate course. I do not regret anything as I have always found However, last year professional lecturers ready to help. Moreover, which gave me the peace of scholar, Trinity I became a mind of having my fees covered now and the possibility of College is Trinity funding for future postgraduate studies. internationally recognised for its cutting-edge research in many areas and the possibilities after graduating from the course are endless: they range from becoming a clinical dietitian to becoming a researcher in the area or being an Nutrition entrepreneur and setting up your own company. is a relatively young science that has still a lot to be discovered and I am looking forward to making my small contribution to that.” Patricia Dominguez Castro n Student Profile Further information Did you know? Career opportunities Career Additional information can also be obtained from: Additional information can also be obtained n n www.medicine.tcd.ie/nutrition-dietetics When you graduate, you will be well placed to find work as a well placed to find graduate, you will be When you a hospital or in the community. clinical nutritionist in dietitian or a food to work in, for example, also be qualified will You nutrition product sales and marketing. company or in clinical have also chosen academic careers in Some of our graduates research or education. 182 Health Sciences Care Centre. National Rehabilitation Hospital, Peamount Hospital, Bloomfield St. Patrick’s Hospital,Our Lady’s Hospice,HaroldsCross, Rotunda Hospital, The RoyalVictoria EyeandEarHospital, Street), OurLady’s Hospital forSickChildren(Crumlin), The Naas GeneralHospital,NationalMaternityHospital(Holles Mental Hospital(Dundrum),Children’s Hospital(Temple Street), Coombe Women’s andInfantsUniversityHospital, The Central Specialist affiliatedhospitalsinclude: tertiary levelhospitals. They haveseveralspecialistunits. incorporating theNationalChildren’s Hospital,areup-to-date St. James’s Hospitalandthe Adelaide andMeathHospital Trinity College’s twomaingeneralteachinghospitals, n n n n n n n n The majorcharacteristicsofmedicineat Trinity Collegeare: becoming afullyregisteredmedicalpractitioner. resident houseofficer(intern)inanapprovedhospital(s)before graduation youarerequiredtospendoneyearserviceasa Bachelor inSurgeryandObstetrics.Following programme leadingtothedegreesofBachelorinMedicine, Students ofmedicineat Trinity Collegewillfollowafive-year education. Today itisaninternationalleaderinbiomedicalresearchand and hasplayedacentralroleinthegoldenageofIrishmedicine. The SchoolofMedicineat Trinity Collegewasfoundedin1711 contribution. where teamworkwillbeequally asvaluableyourindividual need tofeelcomfortableinapeople-oriented environment medicine isultimatelyaboutthe careofpeople,youwillalso high andtherewillbeconsiderable demandsonyourtime. As highly rewardingexperience. The academicrequirementsare The medicalprogrammeat Trinity Collegeisachallengingbut College? Teaching hospitals Trinity at Medicine study Why Is thistherightcourseforyou? Prioritisation of personal and professional development personalandprofessional Prioritisation of thepatientasanactivepartner Recognition of continuous assessment formatsincluding Promotion ofmultipleassessment and coursecontent programme toensurealignmentwiththestatedoutcomes oftheassessment andrevision Continuous review rotations ofclinical Defined programme interpersonal skills oftechnicaland Early andcomprehensivedevelopment adeepstrategicapproach Facilitation ofactivelearningand context materialanddeliveryin Integration ofscientificandclinical

Health Sciences 183

To develop a knowledge and understanding of the To pharmacological basis of therapeutics consider the range of drugs and treatment strategies To available for disease prevention and control To gain insight into the human condition To Most learning will take place in small-group tutorials. There will also be core lectures provide an insight into the mechanisms of the To development of pathological processes at molecular level build on the understanding of basic biochemistry acquired To in the first year of the course and to consider how that knowledge may be used for diagnosis of disease states To enable students the three-dimensional to understand To body structure of the human macroscopic Human physical development at cell, organ, and function levels systems and whole body develop an of understanding how structure relates to To emphasis on the biomechanical function with particular and surgical implications to current diagnostic imaging introduce students To use in the diagnosis of disease techniques and their and abdomen, of the limbs, thorax Anatomy – structure dissection and lectures studied through human Small-group learning tutorials with as related lectures and scenarios All topics will be multidisciplinary appropriate. contributing to this will be set in a human context. Disciplines and physiology anatomy integrated module include biology, consider medicine, health and theories illness from To Arts and Social sciences drawn from the Humanities, Teaching methods: Teaching This module is largely lecture-based and also uses computer- based practical programmes. Teaching methods: Teaching Aims: n n n n The second medical year In this year there are seven modules. medicine Module 1: Molecular and translational Aims: n Module 2: Clinical biochemistry Aims: n Module 3: Principles of pharmacology and practical scientific research Modules 3 and 4: Human form and function 3 and 4: Human Modules Aims: n n n n n n Module 5: Science and humanities Aims: n

The principles of biochemistry, genetics, and immunology genetics, The principles of biochemistry, at a basic level Small-group learning tutorials with related lectures as All topics will be multidisciplinary and scenarios appropriate. will be set in a human context. Disciplines contributing to anatomy, biology, this integrated module include chemistry, biochemistry and immunology physiology, to facilitate learning Aspects of teamwork and also the ability to give and receive constructive criticism and to self-assess realistically The areas of basic science that impact on man and his survival in the environment Ethical issues that may arise in the safe delivery of health care and the The skills that contribute to active learning and critical development of information-handling skills thinking of health care through the family case study Lectures deal with the physical and psychological aspects Small-group psychology tutorials using clinical scenarios To provide students with their first professional experience To Family case study where students, guided by a family with a young physician, make a number of visits to a family development of baby and observe the physical and mental the baby and its assimilation into its family To give students an understanding of concepts of normality To human development in physical and psychological enable students the evolution of man and to understand To of individuals in relation to the functioning and relationships society and environment equip students thorough and integrated knowledge with a To of normal human function and behaviour of general human development Course content Course Teaching methods: Teaching Teaching methods and topics: Teaching n n n Module 2: Evolution and life Aims are to assist students to explore: n n n n n n n n n Aims: n Module 1: Human development, behavioural sciences and ethics The first medical year The first of five modules. is delivered as a set The course 184 Health Sciences n Aims: practice professional and clinical of Fundamentals 7: Module n n n n Aims: Module 6: Aetiology andmechanismsofdisease n n Aims: module. therapeutics, physiologyandpsychiatryallparticipateinthis The disciplinesofanatomy, biochemistry, pharmacologyand Module 5:Neuroscience n Aims: Module 4:Headandneckanatomy n n departments, and pulmonary functionlaboratoriesare organised. gerontology daycarecentres,diagnosticimagingandcardiology on suturing,catheterisation,phlebotomy, etc. Attendance at role playandvideorecording,skillslaboratory, and workshops Modes ofdeliveryincludecommunicationworkshopswith workshops. This moduleconsistsoflectures,practicalsandinteractive of amultidisciplinaryhealthcareteam To assistthedevelopmentofstudentasamember skills patients, inparticularexcellentlisteningandcommunication that studentshaverationalandempatheticinteractionswith To skillsnecessarytoensure focusdirectlyontherangeof interpreting simpleinvestigations taking aclinicalhistory, performinganexaminationand patients. Studentslearnarangeofpracticalskillsincluding skills essentialforthedeliveryofasafe,effective serviceto To setting,thetechnical firstinalaboratory develop,at small-group tutorials uselectures,laboratorypracticalsand All disciplines To topathogens responses considerhuman-host globalisation and thechallengeswhicharepresentedasaresultof To ofpreventionandcontrolinfection exploreaspects nature andsignificanceofmicrobesinthe21stcentury To understandingofthe developfurtheran reviseand of thehumanbrainandlectures Anatomy –Neuroanatomy, throughdissection studied biophysics tobehaviour, inhealthanddisease To aspectsofthenervoussystem,from considerall and isdeliveredbylecturesthroughhumandissection isincludedinthismodule The anatomyoftheheadandneck

Aims: 4: Principlesofmedicalpractice Module and practice surgical of Principles 3: Module n n Aims: Module 2:Laboratoryandinvestigativemedicine n n n Aims: Module 1:Pharmacologyandtherapeutics There aresixmodules. The thirdmedicalyear n n n Aims: practice Module 5: Advanced clinicalandprofessional n n n n n n organism levels and consequentlydisruptfunctionatorgan,system To processesaffect detailhowdisease considerin thecell microbes inthecausationofhumanhealthanddisease To oftherole deepentheunderstanding expandand evidence basecontainedinpeer-reviewedjournals information inrelationtodrugtherapyandassessthe To tocriticallyappraise appreciationofhow developan in hospitalandforthewidercommunity To ensurethatstudentscanprescribesafelyandeffectively treatment ofawiderangecommondiseases To broadknowledgeofthe ensurethatstudentshavea member ofamultidisciplinary healthcareteam To ofthestudent asa furtherassistthedevelopment skills patients, inparticularexcellent listening andcommunication students haverationalandempathetic interactionswith To to ensurethat practicetherangeofskillsnecessary and interpretingsimpleinvestigations including takingaclinicalhistory, performing anexamination service topatients.Studentslearnarangeofpracticalskills technical skillsessentialforthedeliveryofasafeeffective To atfirstinasetting,the furtherdevelop, laboratory location worldwide be spentinanydisciplineorareaoftheirchoice least oneelectiveineitherJulyor August whichmay in groupsoftwo.Studentsarealsoadvisedtodoat in thefirstweekofSeptember. Studentsareteamattached withageneralintroduction team attachmentsbegin Clinical professional teamwork To formulti- andprovideopportunities encourage accurately andtoappreciatetheneeddoclinicalaudit To student’s developthe capacitytoreflectandself-assess hospital setting To studentwithexperienceofpracticeinthe providethe evidence-based medicine To facilitatethepracticeofeffective, patientcentred, earlier years to applytheskills,knowledgeandattitudesdevelopedin To environmentinwhich provideasafe,structuredclinical Health Sciences 185

Further information Intern year Career opportunities Study abroad Assessment of medicine. The majority of hospital attachments take place in St. James’s James’s St. in place take attachments hospital of majority The Meath Hospital Adelaide and Dublin and the Hospital in Tallaght; Hospital in the National Children’s incorporating place in regional hospitals training also takes however some areas dedicated to particular and in hospitals around Ireland Trinity College Dublin College Trinity +353 1 896 1075 Tel: E-mail: [email protected] www.medicine.tcd.ie Medical School Office On completion of the medical course a doctor must spend On completion of the medical course a doctor at a hospital or one year as a resident medical officer/intern being eligible for full hospitals recognised for the purpose before The University does registration with the Irish Medical Council. practise in To not assume responsibility for these appointments. with the General Great Britain and Northern Ireland, registration Medical Council in the UK is necessary. to choose from when you will have plenty of options As a doctor, Most people it comes to making a decision about your career. wait until their year as an intern is complete before committing to Some then enter general practice, while one area over another. many more continue their training as a general physician or you might, Alternatively, surgeon, or in a related specialist field. as others have done, prefer to work in an area such as hospital management, or make research your priority by opting for a career in academic medicine. From the beginning of the third medical year students must From the beginning of and credit for clinical exposure attend hospital continuously number of units including a general may be obtained in a of The School overseas medical centre. hospital abroad or an elective links with Columbia University Medicine currently has DC), University of (Washington (NY), Georgetown University and Johns Hopkins University Pennsylvania (Philadelphia PA) a undertake to opportunity the of avail may Students (Maryland). France. Tours, of one-year Erasmus exchange at the University and includes The assessment structure is wide and varied skills, as well in-course assessment of practical and clinical written and oral as case studies, research projects, formal examinations. examinations and objective structured clinical

in a structured and meaningful way in a structured and meaningful To learn to present their material verbally to their peers learn to present their To have an opportunity explore at some depth and with to To impacts scientifically or clinically on guidance, a topic that medicine the current practice of understand the problems the importance of teamwork and To ways in which that arise during group collaboration and the they may be managed To ensure that students gain experience ensure in searching To develop a critical approach to published material To of their findings learn to prioritise aspects To and learn to collate information to deliver a succinct To the scientific literature and obtaining appropriate material literature and obtaining the scientific their findings and factual report of In these group projects, students are offered a choice of project In these group projects, students are offered school. Students titles by the various departments in the medical a meeting with select the project of their choice and, following they work in groups of 10 to review the project leader, the staff They also make a verbal literature and draw up a written report. presentation to the class. three years of the course. There is, of course, some acquisition acquisition some course, of is, There course. the of years three of important new knowledge and most of this is achieved mentors and consultants of range wide a with interaction through The both on the wards and at various hospital conferences. each of member integrated an becomes student undergraduate team to which s/he is attached and is expected to participate This expectation will activities. fully in all aspects of that team’s inevitably involve some early morning and late evening work. The duration of team attachments vary from two weeks to two months so that each student is exposed to a wide range of are excellent library facilities There general and specialist areas. There is a available on both of the major teaching hospital sites. range of special structured tutorials included in the final year to ensure comprehensive cover of important areas for all students. During these two years the emphasis is on continuous enhancement of the skills and attitudes acquired in the first The fourth and fifth medical years After completing year three successfully, you may be permitted After completing year three successfully, to undertake a to take a year out from the medical course This is subject subject. moderatorship in science in an approved of the head of to the availability of places and the agreement in Biomedical An intercalated M.Sc. department concerned. who successfully sciences is also available to medical students The M.Sc. is a two-year gain a 1st or 2:1 in third-year modules. part-time in the second. programme, full-time in the first year and The subjects undertaken are molecular medicine, neuroscience students the opportunity and bioengineering. Both courses offer to gain experience in scientific research if you are interested in the possibility of a career in academic medicine. Medical Moderatorship and Intercalated M.Sc. in Biomedical sciences n n n n n n Aims: n Module 6: Evidence-based medicine and elective 1 practice 186 Health Sciences Midwifery See page27forfurtherdetails. Students willberequiredtoundergoGardavetting. Garda Vetting: to HepatitisB,HepatitsCand Tuberculosis. See page202forvaccinationrequirementswithregard the practiceareawhereyouwillbeonplacement. organised bythehealthserviceproviderresponsiblefor Screening (includingamedical)andvaccinationwillbe written assessmentbytheNursingCareersCentre. to Trinity College.However, youwillbeinvitedtoattenda submit amature-studentsupplementaryapplicationform of theproposedyearentry. You arenotrequiredto Applications mustbereceivedbytheCAO1February Note formatureapplicants: GCSE DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODES: Leaving Certificate Special EntryRequirements:

O/HD3 Grade C Grade C O/HD3 B.Sc. (A.Obs.) 435* 25 TR913 Mathematics chemistry physics or science or agricultural physics/chemistry physics, chemistry, Mathematics In oneofbiology, In oneofbiology, 168 15 (Mature) TR914

time inCollege. you areinapositiontofullyengagewiththecourseduringyour both physicallyandemotionallysoyoushouldensurethat places extrademandsonstudents’ time.Itcanbe demanding, Like allprofessionalcoursesinhealthsciences,Midwifery midwifery practicecomponent. midwifery degreeprogramme–atheoreticalcomponentand culturally sensitivemanner. There aretwocomponentstothe meet theneedsofwomenandtheirfamiliesinanindividualised, This programmewillprovideyouwiththeknowledgeandskillsto period ofinternshipinmidwiferypractice. usual academicholidays. The finalyearwillincludea36-week hospitals andwilltakeplaceduringtheacademicyearwith learning inuniversityandmidwiferypracticethematernity and The RotundaHospital. The firstthreeyearscombine linked maternitycareproviders: The CoombeWomen’s Hospital This four-yearprogrammewillbeoffered inpartnershipwithtwo and birth,towomentheirbabiesfollowingbirth. of care and promoting choice and control to women in pregnancy midwife. The midwifeisthekeyprofessionalprovidingcontinuity a physiologicalpregnancyandbirthisthecoreofpractice ownership ofherbirthexperience.Careforwomenexperiencing that isindividualtoeachwomanandrecognisesthewoman’s collaboration. The midwifeusesmidwiferyskillstoprovidecare to midwiferypracticeandisbasedonmutualtrust,support partnership betweenthewomanandmidwifeisfundamental The term‘midwife’ means‘withwoman’. The conceptof n n n n n n n n The programmecontentwillcoversuchareasas: laboratory practicals. of approximately6hoursperdayinlectures,tutorialsand 3-4 days in theory classes each week and each day will consist teaching, tutorials and practice classes. You will typically spend Hospital. Teaching methodsincludelectures,small-group and inthe Trinity CentreforHealthSciencesinSt.James’s Trinity CollegeSchoolofNursingandMidwifery, D’OlierStreet The theoreticalcomponentofthecoursewillbetaughtin Course content What isaMidwifeandmidwifery? Theoretical component Maternal and social care services inIreland social care services Maternal and Health promotion Research Social theoryformidwiferypractice approaches sciences, psychology, pharmacology, non-pharmaceutical formidwiferypracticetoinclude:biological Knowledge base and legalissues Professional, personal,ethical skills andinterpersonal Communication andskills Midwifery practice–knowledge Health Sciences 187

Further information Midwives have an option to develop their career in many ways; progress is along three broad pathways: practice, different The opportunities are management, education and research. endless. Midwives educated in the Republic of Ireland may move freely within the European Union and in most countries worldwide. http://nursing-midwifery.tcd.ie/undergraduate/pre-registration/ E-mail: [email protected] +353 1 896 2692 Tel:

Career opportunities Assessment Which maternity care provider Midwifery practice component practice Midwifery will you train with? As a graduate you will be eligible to apply to have your name entered in the midwives division of the Register of Nurses Altranais and begin your career as a An Bord maintained by midwife. Midwives may choose to work in a variety of health The majority of midwives practise within the Health care settings. Service, in maternity hospitals, maternity units of large and small general hospitals, in private maternity hospitals, etc. Midwives can also practice independently and there is a small-group of There are also a number of midwife-led midwives who do so. initiatives being developed. Assessment of learning in midwifery practice is an important component of the programme and will take place throughout the programme. Other forms of assessment include written examinations and assignments, presentations, debates, teaching sessions, etc. After you accept an offer to this programme, you will receive a After you accept an offer This pack contains a form College. Trinity welcome pack from provider you would asking you to indicate which maternity care with on a first-come, prefer to be linked with. Requests are dealt be assigned your first-served basis. Where possible you will exceeds the if the number of applicants first choice, however, your second number of places available you will be assigned arises it may be reserve list is held and if a vacancy A choice. possible to transfer to your first choice. Midwifery practice placements take place throughout the four four the throughout place take placements practice Midwifery will begin your first midwifery You years of the programme. November of the first year of the practice placement in have spent programme. Before this placement you will midwives and lecturers with week per day one approximately in the maternity hospitals. For the practice component you will be based in one of the will be based in one component you For the practice and Infants Women providers: the Coombe maternity care students Hospital. Midwifery Hospital or the Rotunda University practice placements, for example, will also undertake other and surgical. In the first three years mental health, medical to complete three, four to six- students will be required which will consist of 30-35 hours week practice placements, practice per week in a practice (approximately) supernumerary of internship final year will include a 36-week period The setting. in midwifery practice. 188 Health Sciences and generalintegratednursing Intellectual disabilitynursing,Children’s nursing, Psychiatric nursing, General Nursing: Leaving Certificate Special EntryRequirements: DEGREE AWARDED: (mature applicants): general integrated TR912 Children’s and general integrated: TR911 Children’s and (mature applicants): TR098 Intellectualdisability TR097 Intellectualdisability: (mature applicants): TR096 Psychiatric TR095 Psychiatric: (mature applicants): TR094 GCSE ‡ TR093 (mature applicants): TR092 General TR091 General: TR913/914: Midwifery, page186 See also: See page27forfurtherdetails. Students willberequiredtoundergoGardavetting. Garda Vetting: page 202. the practiceareawhereyouwillbeonplacement.See organised bythehealthserviceproviderresponsiblefor Screening (includingamedical)andvaccinationwillbe a writtenassessmentbytheNursingCareersCentre. to Trinity College.However, youwillbeinvitedtoattend submit amature-studentsupplementaryapplicationform of theproposedyearentry. You arenotrequiredto Applications mustbereceivedbytheCAO1February Note formatureapplicants: Seenote16,page33.

‡ ‡ General, Adelaide General, Adelaide:

O/HD3 Grade C Grade C O/HD3 B.Sc. (Cur.) 5 15 13 17 25 20 4 29 14 92 2011: PLACES Mathematics chemistry physics or science or agricultural physics/chemistry physics, chemistry, Mathematics In oneofbiology, In oneofbiology, 179 480* 151 360* 153 360* 174 380 166* 400* 2010: POINTS

Psychiatric nursing n n General nursing hospital. Trinity College’s sixlinkedhealthserviceprovidersare: duration oftheirprogrammeandbecomeanintegralpartthe Students remainwiththesamehealthserviceproviderfor years) isoffered inpartnershipwithsixhealthserviceproviders. This four-yearnursingprogramme(Children’s andgeneralis4.5 never farfromthecentreofstudentlife. proximity to Trinity College’s maincampus,Nursingstudentsare opportunity tomeetandinteractwiththeirclassmates.Withits and MidwiferybuildingonD’OlierStreet,offering studentsan students aretaughtpredominantlyintheSchoolofNursing discipline asyouspecialisewithinyourchosenarea.Nursing study coremodules,andformcohesiveclasseswithinyourown community. You willmeetstudentsfromalldisciplinesasyou in Trinity College,youwillbecomepartofavibrantstudent With overonethousandundergraduatenursingstudents course –atheoretical componentandaclinical component. to follow. There aretwocomponentstothenursingdegree and caring nursing practice in the discipline of nursing you choose professional valuesnecessary to providehigh-quality, competent This coursewillgiveyoutheknowledge, skills,attitudeand time inCollege. you areinapositiontofullyengagewiththecourseduringyour both physicallyandemotionallysoyoushouldensurethat places extrademandsonstudents’ time.Itcanbedemanding, Like allprofessionalcoursesinhealthsciences,nursing nurse. understanding personalityandoutlooktoenjoyworkingasa capable ofworkingaspartateam,andhavecaring You willneedtohaveakeeninterestinhealthcare, be n Children’s &generalintegratednursing n n Intellectual Disabilitynursing n n Course overview Course content Is thistherightcourseforyou? St. James’s Hospital National Children’s Hospital(AMNCH)at Tallaght The and MeathHospitals,incorporatingthe Adelaide the NationalChildren’s Hospital(AMNCH)at Tallaght The and MeathHospitals,incorporating Adelaide Moore Abbey St. Anne’s SistersofCharityJesusandMary, Stewart’s HospitalServicesLtd,Palmerstown St. Patrick’s Hospital Mid-Leinster Health ServiceExecutiveDublin

Health Sciences 189

– e.g. training, – including a – specialising in the care – specialising in the care – specialising in the care of persons with and their families Medical nursing of infants, children and adolescentsMedical nursing and specialist within a family-centred framework (general placements) of infants, children and adolescentsSurgical nursing and specialist within a family-centred framework (general placements) Emergency nursing of infants and children Accident and within a family-centred framework nursing of infants, children and Operating theatre adolescents within a family-centred framework Mental health issues for children and adolescents within a family-centred framework Community nursing Maternity and neonatal care within a family-centred framework Education and development of the adult Education and development living areas work, activation and behaviour Disorders of human including of persons with disorders of human behaviour, those with intellectual disability Acute nursing intellectual acute nursing needs, including those with disability who have physical disability/illness communication, Specialist areas – e.g. physiotherapy, speech and language, and physical education Management therapy and forensic psychiatry) therapy and Specialist areas (e.g. addictionSpecialist studies, child and behaviour special care units, psychiatry, adolescent person older Care of the nursing Adult general Management of the child Education and development developmental experiences across balance of caring and specialist settings a variety of generic and Which health service provider will you train with? Children’s and General nursing Children’s n n n n n n n will you disciplines nursing the of one to offer an accept you After This pack contains College. Trinity receive a welcome pack from a form asking you to indicate which health service provider you would prefer to be linked with. Requests are dealt with on a first- come, first-served basis. Where possible you will be assigned if the number of applicants exceeds your first choice; however, the number of places available you will be assigned your second reserve list is held and if a vacancy arises it may A choice. be possible to transfer to your first choice. Most students are allocated their first choice of health service provider. n n n n nursing Intellectual disability n n n n n n

(including primary health care, Psychiatric nursing (acute and long-term care Community-based care and rehabilitation Home nursing/community voluntary and statutory agencies, intellectual disability) Operating theatre Maternity care in mental health) Surgical nursing – general/specialistSurgical nursing (including day care, outpatients, coronary care, high dependency units) Accident & Emergency and outpatients nursing Children’s Mental health nursing person Care of the older Medical nursing – general/specialistMedical nursing (including day care, outpatients, coronary care, high dependency units) n n Psychiatric nursing n n n n n n n n General nursing n Clinical component with one of the For the clinical component you will be linked practice placementshealth service providers and will also have Psychiatric & in a variety of clinical settings. For General, of 45 weeks Intellectual disability disciplines, this will consist each year of the taking place in four- to six-week blocks in you willprogramme. During the fourth year of the programme The placement. undertake a 36-week roster of continuous course will consist of 58 and general integrated Children’s weeks of practice placements along with a 36-week roster weeks of practice placements along with a As the course progresses you will be prepared to undertake a As the course progresses you will be prepared clinical placements in your chosen discipline. number of different These include: of continuous placement. The rostered placement spans the The rostered of continuous placement. fourth and fifth years of the course. For the theoretical component, students will undertake modules students will undertake modules For the theoretical component, with all nursing disciplines and modules of study that are shared Nursing, The subjects of study are that are discipline-specific. with the and Sociology, Biological sciences, Psychology (see the table below for module emphasis being on Nursing two students will concentrate on nursing, titles). In years one and In years three, four biological, behavioural and social sciences. develop and enhance and five (where applicable), students will nursing their knowledge, skills and attitudes for professional practice. Theoretical component Theoretical will be of the course of the theoretical component The majority of Nursing and Midwifery College School Trinity taught in the from the Street, minutes is located on D’Olier building, which the held on other sites including Classes are also main campus. Health for Centre Trinity the in and campus College Trinity main methods include Teaching Hospital. Sciences in St. James’s classes, clinical skills laboratories, lectures, tutorials, practical learning and reflective workshops. group teaching, web-based 190 Health Sciences The Freshman(firstandsecond)years The firstclinicalplacementofthecoursetakesplaceafter Christmasvacationinthefirstyear in individualstudy. When notonclinicalplacementyoucanexpecttospendatleast 25hourseachweekinguidedstudyandapproximately10 Elective/Broad Curriculum(seep.13)(yr2) Psychological themesfornurses(yr2) Advanced anatomyandphysiology(yr2) Professional conceptsfornursing(yr2) The sociologyofhealthandillness(yrs12) Introduction topsychology(yr1) Scientific basisfornursing(yr1) Historical, legalandtheoreticalfoundationsofnursing(yr1) Communication andessentialskillsfornursingpractice(yr1) Health promotionandresearch(yr1) Shared learningmodules(Alldisciplines) Modules ofstudy Healthcare needsofchildandfamily(yr2) The sickchild(Part A) (yr2) Introduction tochildren’s nursing(yr1) All modulesaspergeneralnursing,plus: Children’s andgeneralnursing: Foundations ofdiseaseandpharmacologicalintervention(yr2) perspectives (yr2) Frameworks forintellectualdisability:policyandpractice Approaches tonursingpractice(yrs1&2) Holistic understandingsofcare(yr1) Concepts ofintellectualdisability(yr2) The lifespanofthepersonwithintellectualdisability(yr2) Introduction tothepersonwithintellectualdisability(yr1) Intellectual disabilitynursing: Psychopharmacology (yr2) Caring forthepersonwithphysicalillhealth(yr2) Working withpeopleenduringmentalhealthproblems(yr2) Working withpeopleacutementaldistress/illness(yr2) Psychotherapeutic approachesandmentalhealthnursing(yr2) Psychotherapeutic skillsandmentalhealthnursing(yr1) Recognising mentaldistress/illness(yr1) The natureofmentalhealthnursing(yr1) Theoretical perspectivesonmentalhealth/illness(yr1) Psychiatric nursing: Foundations ofdiseaseandpharmacologicalintervention(yr2) General nursing4(yr2) General nursing3(yr2) General nursing2(yr2) General nursing1(yr2) Community nursingandcareoftheolderperson(yr1) Nursing inspecialistservices(yr1) Introduction togeneralnursing2(yr1) Introduction togeneralnursing1(yr1) General nursing: Discipline-specific modules .

Health Sciences 191

Further information staff are in short supply worldwide. You will also be qualified You are in short supply worldwide. staff to continue your education and to further specialise should a wide School of Nursing offers Trinity The you wish to do so. range of postgraduate courses for furthering your studies. particularly in the Nurses also take up careers in industry, marketing of healthcare products. You should have no problem getting employment as nursing You http://nursing-midwifery.tcd.ie/undergraduate/pre-registration/ E-mail: [email protected] +353 1 896 2692 Tel: Discipline-specific modules Discipline-specific General nursing 5 (yr 3) General nursing 3) General nursing 6 (yr 3) Acute care nursing (yr sciences and clinical skills (yr 3) Advanced biological (yr 4) rehabilitation, palliative care and pain management Disability, Psychiatric nursing of specialist client groups (yr 3) Introduction to the needs in the community (yr 3) Mental health nursing with the older person (yr 3) Working with people who experience multiple and complex needs Working and clinical skills (yr 3) (yr 4) Contemporary issues in mental health nursing Intellectual disability nursing Therapeutic interventions for care 2 (yr 3) 2 (yr 3) Frameworks for intellectual disability practice A) (yr 3) disability 2 (Part Physical health in persons with an intellectual disability 2 (Part B) (yr 3) Physical health in persons with an intellectual nursing (yr 4) Contemporary issues in intellectual disability and general nursing Children’s All modules as per general nursing, plus: The sick child (Part B) (yr 3) child (yr 4) The adolescent and their family – the healthy nursing (yr 4) Contemporary aspects of children’s (yr 4) nursing) Continuing healthcare (children’s practice (yr 5) Growth and development for professional

Career opportunities Assessment Research (yrs 3 and 4) Research to nursing (yr 3) and sociology applied Psychology (see p. 13) (yr 3) Elective/Broad Curriculum for professional practice (yr 4) Growth and development policy (yr 4) Management and health you will be on a 36-week roster of continuous placement where applicable), During fourth year (and fifth year, Shared learning modules (All disciplines) modules (All Shared learning An Bord Altranais. An Bord As a graduate you will be eligible to apply to have your name entered in the relevant division(s) of the Register of Nurses Altranais and work as a nursing An Bord maintained by and The Children’s professional in your chosen discipline. general nursing programme combines the general programme which results in a programme and integrates a children’s programme which spans the seven ages of man and allows for registration as both a children’s and a general nurse with for registration as both a children’s A combination of examinations, essays, clinical projects, clinical combination of examinations, essays, clinical A skills, laboratory techniques, literature reviews (review of past and current literature relating to the subject matter), reflective practice (thinking about an experience and reflecting on its meaning) and clinical assessments is used. The Sophister (third, fourth & fifth) years fourth & fifth) (third, The Sophister 192 Health Sciences n n n Occupational therapyinterventionsconsider: their day-to-dayqualityoflife. them, occupationaltherapistsaimtoenablepeopleimprove enabling peopletoengageinactivitiesthatholdmeaningfor by physical,social,attitudinalandlegislativeenvironments.By participation ineverydayactivitiescanbesupportedorrestricted work andleisureactivities.Occupationaltherapistsbelievethat meaningful activitiesofeverydayliving,forexampleselfcare, of occupationaltherapyistoenablepeopleparticipatein health andwell-beingthroughoccupation. The maingoal Occupational therapyisaprofessionconcernedwithpromoting The World FederationofOccupational Therapy maintainsthat What isOccupationaltherapy? Occupational therapy See page27forfurtherdetails. Students willberequiredtoundergoGardavetting. Garda Vetting: See Precautionsagainstinfectiousdiseasespage202. Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE: potential to liveasindependentalifepossibleandreachtheirfull and institutionalenvironmentinwaysthatenablepeople enhances performance;andinfluencingthesocial,cultural environment sothatitdoesnotimpedebut,ifpossible, The environment the individual’s abilities making changestotheseactivitiessothattheybettermeet work-related activitiespeoplevalueintheirdailylivesand The occupation and socialability level ofphysical,cognitive(thinking),affective (emotional) The individual person – examining the self-care, leisure and self-care,leisureand – examiningthe – manipulating or adapting the physical oradaptingthephysical – manipulating

– improvingormaintainingtheir

Grade C HC3 B.Sc. (Cur. Occ.) 495 40 TR054 In oneof:physics, In oneof:physics, biology chemistry or science or agricultural physics/chemistry chemistry, biology,

centres. Examplesofwhatoccupationaltherapistsdoinclude: community, hospitals,rehabilitationunits,schools,and,reform Occupational therapistsworkinavarietyofsettings,including n n n n n n n reflective attitude. to solvingproblemsandfosters aresearch-orientedand This four-yeardegreecourseincorporates apracticalapproach policy, exposestudents tothewiderfacilitiesof Trinity College. College Green,forexamplepsychology, anatomyandsocial city centre.Courseswhichtakeplaceonthemaincampusin the linerunningbetween Tallaght andConnolly Stationinthe 2 milesfromthemaincampusandisbesideaLuasstationon and workingwithotherhealthprofessionals. The centreisabout nursing. This givesamultidisciplinary dimensiontostudying studying medicine,physiotherapy, therapeutic radiographyand houses otherhealthsciencesdisciplinesincludingstudents school include a capacity for tele-conferencing. The Trinity Centre James’s Hospital.State-of-the-artteachingfacilitiesattheO.T. Sciences inanewpurpose-builtcomplexthegroundsofSt. Occupational therapyisbasedinthe Trinity CentreforHealth understanding ofwhatisinvolvedinthisprofession. Visiting anoccupationaltherapydepartmentwillgiveyouagood with diverseabilitiesissomethingyouenjoyandfindstimulating. solutions toamultitudeofproblemsandifworkingwithpeople Yes, ifyouareacreativethinkerwhoisopento finding College Course content Trinity at therapy Occupational Is thistherightcourseforyou? to happen job itselfandtheworkplace)toenablethis,wherepossible, to returnworkandthenmodifythatperson’s work(the Assessing theabilityofsomeonewithacquiredbraininjury their independence computers andotherassistivetechnology, toincrease and appliances,includingwheelchairs,dressingaids, toselectandeffectivelyEnabling people useequipment and maintainactivityintheirlives waystopromotehealth Advising communitygroupsabout so thattheycanlivemoreindependentlyinthecommunity intellectual disabilitiesdevelopskillssuchasbudgeting thatenablepeoplewith programmes Running life-skills skills ofchildrenwithcerebralpalsy Using playactivitiestoimprovetheandmovement successful experiences of achievement,developpersonalskillsandfacilitate using activitiessuchascookingamealtofostersense Working andschizophrenia withpeopledepression and saferforhim/hertouse Adapting thehomeofanelderlypersontomakeiteasier

Health Sciences 193 The course is the longest establishedThe course is the longest university- course in Ireland and based occupational therapy record of employment in has an excellent track uses many innovative teaching Ireland and abroad. It education, problem-based methodologies, e.g. peer traditional methods. Students learning, as well as more collaborate on projects that involve both and staff of practice. research and service delivery in new areas advocacy For example, students facilitate a staff-led and are project for people with intellectual disabilities of a involved in leisure-based groups for residents for nursing home and occupation-focused services students with mental health difficulties. n Did you know? Further information Other examples include work in schools and in private practice, schools and in private include work in Other examples who are in and people people who are homeless and work with clinics. and stress management run healthy living prison; others – move into management occupational therapists number of A health/ departments or other occupational therapy managing many offers the course Additionally, social care related services. study. opportunities for further www.medicine.tcd.ie/occupational_therapy E-mail: [email protected] +353 1 896 3210 Tel: 20 weeks ), which means as . You will You group research project. Career opportunities Study abroad Assessment As a qualified occupational therapist from Trinity College, Dublin, Dublin, College, Trinity from therapist occupational qualified a As you will be well equipped to pursue a very rewarding career service of range wide a in groups age all of people with working Federation of The course is approved by the World settings. Therapists (www.wfot.org.au Occupational soon as you complete your degree you are qualified to work as an occupational therapist in Ireland as well as abroad. Many parts all in working are course College Trinity the from graduates of the world. Most occupational therapists, over time, develop specialised expertise in areas such as physical rehabilitation, paediatrics, intellectual disability, mental health, hand therapy, services for the elderly and community occupational therapy. opportunities in Ireland are expanding, particularly in Work school settings and in primary care community practices areas. Students may elect to spend one or more of their professional date students have studied/ To practice training blocks abroad. Australia, and Canada trained in Belgium, Scotland, in supervised professional practice. essays, project Assessment includes written examinations, based competency and project, research a presentations, work, education. assessment while on supervised practice have opportunities to develop important self-directed learning have opportunities to develop important self-directed practice. Over the and research skills, which are key areas for a total of course of these two years, you will spend During the Sophister (third and fourth) years you will further During the Sophister (third and fourth) years and practice develop your knowledge of the theories, principles of health/social of occupational therapy; gain an understanding of practicing in care systems and policies and of the importance Service learning is continued and an evidenced-based manner. you Additionally, incorporates a peer education methodology. will be expected to complete a The Sophister years The Freshman years The Freshman include (first two) years studied in the Freshman The courses and therapy theories occupation, occupational the study of anatomy, to older adults, with people from children interventions methods and studies, research disability psychology, physiology, in subjects to ‘learn by doing’ will be encouraged You statistics. such as communications related to personal development solving and in courses that teach the and creative problem skills of practice such as assistive professional and technical will be required to engage in service learning You technology. and will use experiential learning and through voluntary work knowledge and skills in an activity of group work to develop years, there are a total of your choice. During the first two professional practice in a variety of weeks in supervised 11 care facilities around the country. health and community 194 Health Sciences more enjoyable. this areawillbeimportantand makeyourfouryearsofstudy As muchofthecourseisscientificallyled,astronginterestin in bothindustryandthehealthcaresector. Trinity Collegeopensawidevarietyofprofessionalopportunities practise asacommunityorhospitalpharmacist,Pharmacyat While thisdegreeisanessentialrequirementifyouwishto from theirmedications. healthcare professionalis to help peopleachievethe best results to namejustafew. Inmanyrespects,theirroleasakey long-term carefacilities,andwithinthepharmaceuticalindustry work inavarietyofsettings–communitypharmacies,hospitals, medicines, andhowtheyworkwithinthebody. Pharmacists and syntheticinorigin,includingtheirchemistry, theirusesin Pharmacy isthestudyofallaspectsdrugs,bothnatural What isPharmacy? Pharmacy Is thistherightcourseforyou? undergraduate/apply/entry-pharmacy forfurtherdetails. is alsoavailable.See Graduate Entry:A graduate entryroutetothisdegree GCSE Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

www.tcd.ie/Admissions/

OC3 or HD3 Grade C Grade B Grade C HC3 HC3 B.Sc. (Pharm.) 540* 75 TR072

Mathematics Chemistry mathematics or applied geography geology, mathematics, physics, biology, science agricultural geology or geography, mathematics, applied mathematics, physics, biology, Mathematics In oneof In oneof Chemistry

n n n n course are: Some ofthesubjectscoveredduringfouryears (first) year. 1 tutorialperweekoverthecourseofJuniorFreshman approximately 16hoursoflectures,6laboratorysessionsand sciences, andinthepracticeofpharmacyitself. There are an all-roundeducationinboththebasicandpharmaceutical The Pharmacysyllabushasbeendesignedtoprovideyouwith n n n n n n n n Course content or bybeingpreparedaseptically must bemadefreeofmicrobesbyeithersterilisation organisms causesomanydiseases.Somemedicines are particularlyimportantinpharmacybecausethese Microbiology: fungiandviruses. Studiesbacteria, These by interactingwithbasicsystemswithincellsandtissues drugs aremetabolisedandhowtheyactorcausetoxicity Biochemistry: A tothewaysinwhich basicintroduction such asblood,theheart,digestiveandnervoussystems the anatomyandphysiologyofallmajorbodysystems, prerequisite tothestudyofpharmacology. Physiologycovers Physiology: microbiology anddevelopmentalbiology and medicineswork.Italsoincludesintroductorygenetics, basis tolifesothatyoucanbetterappreciatehowdrugs Biology: A andcellular tothemolecular basicintroduction diseases pharmacy andareactiveinthe treatmentandpreventionof well assubstancesextractedfrom them,whichareusedin Pharmacognosy: Thestudyofplantsandanimals, as and injections evaluation ofalltypesmedicinessuchastablets,creams subject isconcernedwiththeformulation,productionand Pharmaceutics andpharmaceuticaltechnology:This proteins methods canbeusedtodevelopnewdrugs,especially understanding ofhowgeneticsandbiotechnological Pharmaceutical biotechnology: Developsan and thechemistryofdrugmetabolism discovery anddesign,molecularmodeofactiondrugs used inmedicines. Additional topicsincludeadvanceddrug sources, identification,analysisandstabilityofthematerials Pharmaceutical chemistry: to formulationdesign,performanceandstability physiochemical principlesofpharmacyimportance Physical pharmacy:Coversthefundamental practice ofpharmaceuticalanalysis Pharmaceutical analysis:Dealswiththetheoryand design andisolation Medicinal chemistry: calculations andstatistics you withtheapplicationofbothinpharmaceutical Teaches bothmathematicsanddatahandlingtoassist Pharmaceutical calculationsanddatahandling: The biology of the human body is an essential humanbodyisan The biologyofthe Covers theprinciplesofdrug Deals withaspectsofthe

Health Sciences 195 The Pharmacy degree alone does not entitle you to practice degree alone does The Pharmacy as a pharmacist. College students are required Trinity After the four years in one year training period, known as to undertake a further the ‘pre-registration year’ or ‘pharmacy internship year’. year may be taken in a range The pre-registration training including hospital, community of pharmaceutical settings the under work will you where environments, industrial and will be entitled to You pharmacist. supervision of a tutor with the Pharmaceutical Society register as a pharmacist successful completion of the pre- of Ireland (PSI) on the Licence Examination. the PSI’s registration year and with the The B.Sc. (Pharm.) degree is in full compliance pharmacists, EU directives governing free movement of EU the throughout work and register to graduates entitling with the (including Northern Ireland) following registration Pharmaceutical Society of Ireland. Máirín Ryan Dr. pharmacy “Following a pre-registration year in hospital practice I took up a position as clinical pharmacist Hospital and subsequently assumed in St. James’s clinical outpatient and inpatient of delivery for responsibility I then did a pharmacy services for HIV/AIDS patients. Therapeutics, Ph.D. in the Dept. of Pharmacology and College focussing on pharmacoeconomics Trinity I subsequently moved from clinical of HIV therapy. at the National practice to become the Chief Pharmacist a lecturer in Centre for Pharmacoeconomics. I am now and pharmacoeconomics in the Dept. of Pharmacology Therapeutics and the lead investigator for a program of Africa. I am also economic analyses of HIV clinical trials in a member of the scientific advisory board for the Infectious Diseases Institute at Makerere University in Uganda. medical College Trinity I and two graduates from the AIDS Foundation school co-founded the Réalta Global in 2004, a registered charity which focuses on improving poverty Africans with HIV/AIDS and other outcomes for related conditions. In 2007, I was appointed as Director of Assessment at the Health Information Technology Health responsible Authority where the team will be and Quality for conducting health technology assessments to inform national health policy and service decisions. I feel that my training as a pharmacist has been an invaluable basis for my work to date, obviously as the starting point for developing clinical pharmacy skills but also in my current role. Health technology assessment is a research-driven process which involves compiling all of the evidence around investment in new technologies including drugs and assessing that evidence to inform the best decisions for patient care; which is essentially what pharmacists are trained to do.” The Pharmacy degree and and degree The Pharmacy Graduate Profile professional qualification professional

and will research project This subject examines what This subject examines

Are we able to predict the physical stability of amorphous Are we able to predict the physical stability drug/polymer composites? SAR studies of 6-fluoroquinolones Molecular probes for proteins which regulate cancer-cell nuclear proliferation: chemistry and modelling of novel receptor targeting agents and biological activity Development of quick reference guides for pharmacists about medicines An investigation of new approaches for diagnosing diabetes role for dopamine in a potentially between lethal interaction A ‘Ecstasy’. and MDMA caffeine Production and characterisation of porous microparticles Establish new bioassay for the detection of anticancer compounds in complex plant extracts – chemistry Essential Oil analysis of two Irish species Quality of medicines information on the internet is essential if drugs are to be used effectively to treat effectively if drugs are to be used is essential also gives The course humans and in animals. disease in benefits the therapeutic of factors affecting an appreciation risks of medicines and adverse delivery of a model protein designed for pulmonary Pharmacology: Develops knowledgePharmacology: about how drugs cellular level that biochemical and molecular, work at the Practice of pharmacy: Practice of pharmacy: pharmacists do in each of the areas of professional practice practice professional of areas the of each in do pharmacists working with patients, their and because this involves the health service it also includes families and others in subjects as well as a study sociological and psychological of the health service Further information Career opportunities Assessment

www.tcd.ie/Pharmacy Tel: +353 1 896 2809 Tel: Your career prospects as a Pharmacy graduate are excellent. Your hospital and Employment opportunities exist in community, as well as in state services such as industrial pharmacy, medicines licensing. In addition, you can opt to undertake research, or apply for entry to one of the postgraduate courses in hospital, industrial or community pharmacy. A combination of continuous assessment and oral and written combination of continuous assessment and A end-of-year examinations is used. Practical examinations are also an important means of assessment. Senior Sophisters (fourth-year students) submit a dissertation based on their projects. n n n n n n n n n n n n In the final year, you will undertake a you In the final year, on an aspect of pharmacy practice also prepare a dissertation your choice. hospital or industry option of linked to a community, chosen the following as subjects for In the past students have investigation: 196 Health Sciences Student Profile Student Profile College isdefinitelyanexperienceIwouldrecommend!” being highlightsoftheyear. StudyingPharmacyin Trinity the yearwithannualMystery Tour andPharmacyBall years ofthecourse.Manyeventsareheldthroughout students thechancetosocialisewiththeirclassandother aspect tothecoursewithourownsociety, DUPSA,giving with anyissuesthatmayarise. There isalsoagreatsocial lecturers arealwaystheretoanswerquestionsordeal However, helpisathandifthereareanyproblems,and range ofsubjects,thecoursecanbechallengingattimes. students. Withmanylecturesandlabpracticalsinawide lecturers andarealsenseofcomradeshipbetweenthe of Pharmacyhasafriendlyatmospherewithapproachable many happymemoriesofmytimeinCollege. The School but ithasalsogivenmeaclose-knitgroupoffriendsand and qualificationtoworkinadiverserangeofcareers, Not onlyhasaB.Sc.Pharmequippedmewiththeskills the SchoolofPharmacyhasbeenanamazingexperience. I hadnoideawhattoexpect.Fouryearslater, mytimein “On myfirstdayasaPharmacystudentin Trinity College, Naomi Hodgins employment prospectsupongraduation.” graduates atthemoment;Icanlookforwardtogreat Trinity. Ihavemadesomefriendsforlifeandunlikemany I feelthatitwasaprivilegetohavestudiedPharmacyat no doubtthatthiscoursecanbechallengingattimes,but be missed,culminatingwiththePharmacyBall. There is several socialeventsthroughouttheyearwhicharenotto have. The pharmacystudentsociety, DUPSA,organises always availabletohelpwithanyproblemstheymay really taketimetogetknowtheirstudentsandare courses. The smallclasssizesensurethatthelecturers something whichisn’talwaysreflectedinotherlarger sense ofidentityandcommunityamongstthestudents, small numberofstudentsonthecoursehelpscreateareal attractive toprospectiveemployers.Ithinktherelatively balance thatreallymakespharmacygraduatesuniquely pharmacy practice.Ifeelthatafterfouryears,itisthis for anysciencedegreeandtheclinicalskillsessential balanced betweenboththeacademicknowledgerequired career upongraduation. The degreecourseisreallywell of things,butwouldalsolikethecertaintyarewarding Trinity isperfectforanyonewhoenjoysthe scientificside I canhonestlysaythattheB.Sc.Pharm.programmeat unsure aboutwhatdirectionIwouldtakeatthirdlevel. “I hadakeeninterestinScienceschoolbutwasstill David Corcoran(SeniorSophister2011) (Senior Sophister2011) of whatexactlyisinvolved. physiotherapists workwillgiveyouagoodunderstanding Visiting alocalgeneralhospital orotherareawhere and youwillneedtohaveconsiderableemotionalstability. Physiotherapy isbothphysicallyandacademicallydemanding or specialiseinparticularareasofthediscipline. workers amongothers. Alternatively theymayworkfromclinics therapists, psychologists,occupationaltherapistsandsocial team thatincludesphysicians,nurses,speechandlanguage Physiotherapists maybepartofamultidisciplinarymedical manipulative procedures,andavarietyofelectricaltreatments. operations. The methodsemployedincludeexercisetherapy, sports injuries,arthritis,orthoserecoveringfromstrokesand and conditions,includingthosewithbackneckproblems, involves treatingpatientsofallageswitharangeillnesses movement attheheartofwhatitmeanstobehealthy. It Physiotherapy – or physical therapy – places full and functional Physiotherapy Is thistherightcourseforyou? What isPhysiotherapy? See page27forfurtherdetails. Students willberequiredtoundergoGardavetting. Garda Vetting: See Precautionsagainstinfectiousdiseases,page202 Agricultural sciencewithbiology Physics/chemistry withphysicsorchemistry Combinations ofsubjectsnotpermitted: GCSE Advanced GCE(A-Level) Leaving Certificate Special EntryRequirements: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

OC3 or HD3 Grade C Grade B HC3 B.Sc. (Physio.) 530* 40 TR053

Mathematics In twoofphysics, or mathematics chemistry, biology, science or agricultural mathematics physics/chemistry, chemistry, biology, Mathematics In twoofphysics,

Health Sciences 197

All students will have clinical placements at Trinity Trinity All students will have clinical placements at associated teaching hospitals of St. College’s where there is an Tallaght AMNCH in and James’s established expertise in most areas of physiotherapy. These placements allow students to gain experience in some of the specialist areas of physiotherapy coronary care, respiratory care, including neurology, health, care of the elderly, orthopaedics, women’s sports and out-patients. n Further information Career opportunities Did you know? Assessment At the end of second year you will start clinical placements start clinical placements of second year you will At the end These and experienced tutors. of skilled under the supervision private day centres or within in hospitals, clinics, may be taken practice. and community www.medicine.tcd.ie/physiotherapy / 1 +353 1 896 2110 Tel: Successful completion of the course entitles you to membership Successful completion of the course entitles the of the Irish Society of Chartered Physiotherapists, accrediting body for physiotherapy in Ireland. world and you will Physiotherapists are sought throughout the or to specialise, be able to work with a wide range of conditions There is also great scope for you to continue to as you wish. such as manipulative develop your skills and expertise in areas respiratory, cardiology, sports injuries, neurology, therapy, research, education, management or private practice. The Sophister years The Sophister (third) year half of the time is spent on In the Junior Sophister the other half on clinical placements in academic studies and in certain subjects, End-of-year written examinations and tests make up the theoretical assessment structure. such as anatomy, during your In addition, you will be continuously assessed exams on the skills clinical placement and will have practical of a patient element of the course, including your assessment while on a clinical placement. a variety of settings both within and outside the Dublin area. a variety of settings both you will undertake an (fourth) year, In the Senior Sophister a topic related to physiotherapy in investigative project on study in an area of your choice. conjunction with advanced choices available include care of the Examples of subject injuries and pain. health, sports women’s paediatrics, elderly,

. In the third and fourth years students – the use of exercise in prevention research project Manipulative procedures – includes the use of soft tissue massage and manipulations to improve mobility Exercise therapy and treatment Pathology Biomechanics and movement – includes procedures Electrotherapy procedures – includes the use of electrotherapy to alleviate pain, improve circulation Physiology Anatomy Physics Chemistry to improve strength, mobility and balance and re-educate muscles and improve circulation Course content Physiotherapy at Trinity College at Trinity Physiotherapy You will also start to study various conditions and specialities You frequently seen in physiotherapy such as respiratory conditions and musculoskeletal conditions. n n n n n n n n n Courses covered in the first two years include: The Freshman years you will have As a Freshman (first and second year) student week divided between approximately 20 hours of teaching each lecture and practical classes. There are two components to Physiotherapy: theory and There are two components to Physiotherapy: is on laying clinical practice. In the first year the emphasis the second year a foundation of theoretical knowledge and procedures used introduces students to the clinical skills and taught mainly in the by physiotherapists. Clinical sciences are second and third years. The major objective of this four-year course is to enable you The major objective of this four-year course the ability to work to become a competent professional with independently with patients. spend up to fifty percent of their time on clinical placement. spend up to fifty percent of their time to develop In the fourth-year students have an opportunity physiotherapy and specialist knowledge in a particular area of undertake a The centre is about 2 miles from the main campus and is beside miles from the main campus and is beside The centre is about 2 Connolly and Tallaght line running between a Luas station on the Station in the city centre. Physiotherapy is based in the Trinity Centre for Health Sciences Centre for Health Sciences Trinity is based in the Physiotherapy This Hospital. James’s built complex at St. in a purpose allows disciplines and other health science complex houses to share courses with those in the other physiotherapy students a multidisciplinary approach to studying health sciences to give and working. 198 Health Sciences practical sessions, workshopsandtutorials. and thesubjectsaretaughtthrough lectures,laboratory-based in thelasttwoyears. The contacthoursarehighinthiscourse two yearsandmoreontheclinical andresearchcomponent emphasis beingmoreonthetheoretical componentinthefirst are boththeoreticalandclinical componentstothisdegree,the participate in and encourage research into the profession. There you toanalyse,evaluateandmakedecisionsinitiate, which todeveloptheclinicalskillsofradiotherapy. Itqualifies This four-yeardegreegivesyouabroadacademicbaseon emotionally demanding. in patientcareaswell. Your jobwillalsobebothphysicallyand development ofyourclinicalskillsrequiresyoutobeinterested have akeeninterestinbiology, physicsandchemistry. The degree willcovermanysciencesubjectssoyouhaveto The radiationtherapistrequiresveryspecialistskills. Your time tobeenteringtheprofession. is theopportunityforroledevelopment,makingthisanexciting aspects oftheircare. As radiotherapyisexpandinginIrelandso patient duringthecourseoftheirtreatmentandinvolvedinmany radiation therapistyouwillbethemainpointofcontactfor deliver thebestcourseoftreatmentforpatients. As agraduate comprising clinicaloncologistsandphysiciststoplan When youqualify, youwillworkwithamultidisciplinaryteam course ofradiotherapy. members, isresponsibleforthepreparationanddeliveryofa therapist –thepractitionerwho,togetherwithotherteam with cancer. This coursequalifiesyoutoworkasaradiation Radiotherapy isoneofthemainmethodsusedtotreatpatients Is thistherightcourseforyou? What isRadiationtherapy? Radiation therapy Course content See p.27forfurtherdetails. Students willberequiredtoundergoGardavetting. GARDA VETTING: Advanced GCE(A-Level) Leaving Certificate SPECIAL ENTRY REQUIREMENTS: DEGREE AWARDED: POINTS 2010: PLACES 2011: COURSE CODE:

Grade C HC3 B.Sc. (Ther. Rad.) 515* 30 TR055 In oneofphysics, In oneofphysics, biology chemistry or physics/chemistry chemistry, biology, The subjectsyouwillcoverinclassare: placement. 20-30 hoursperweekinclassor35clinical In theJuniorFreshman(first)year, thereareapproximately The JuniorFreshmanyear patient pathway. develop yourunderstandingofthecomplexitiescancer A clinicalcomponentwillintroduceyoutoradiotherapyand attitudes andskills. cancer medicine,clinicalphysicsandbasicprofessional pathology, researchmethodologyandstatistics,introductory biochemistry andgenetics,willbeintroducedtopsychology, and functionofthehumanbodythroughanatomy, physiology, physics, chemistryandbiology. You willalsostudythestructure The firsttwoyearsofthecoursecoverbasicsciences– The Freshmanyears n n n n Third-year coursesinclude: The JuniorSophisteryear patient care,andcompleteaprojectinthisarea. specialist subjectsthatarespecificallyrelatedtocancerand In theSophister(thirdandfourth)years,youwillstudymore The Sophisteryears n n n n n n n n Second yearcoursesinclude: The SeniorFreshmanyear n n n n n n n acquired anVirtual Linear Accelerator simulator. both clinicallyandacademically, andtheDivisionhasrecently links bothnationallyandinternationally. This systemisused hub ofasophisticatedteleconferencingsystemthatfacilitates simulation andplanninglaboratoryinEurope The Divisionhasthelargestradiotherapytreatment Radiotherapy treatmentplanning Radiotherapy Radiobiology Physics forradiationtherapy3 practicesofcancercare3 Principles and Research methodologyandstatistics Communication anatomy Radiolographic practicesofcancercare2 Principles and Physics forradiationtherapy2 Anatomy 2 Physiology Biochemistry andhumangenetics practice ofradiationtherapy Clinical Psychology practicesofcancercare1 Principles and Physics forradiationtherapy Anatomy 1 andproperties Chemical principles andpractices principles Biological and isthe Health Sciences 199

B.M.S

the profession develop students’ knowledge of the nature of midwifery develop students’ enable students analyse the midwife’s to full extent of the role and to consider a range of issues relevant to contemporary midwifery practice thinking and assumptions about challenge students’ of suitable applicants. DEGREE AWARDED: DEGREE Application Procedure: Students are required to apply This is not a CAO course. of Please consult the School directly to the University. website for details on closing date Nursing and Midwifery Autumn year commencing in for entry to the academic 2012. available from: Application forms are Trinity College, Dublin 2. House, Admissions Office, Regent +353 1 896 4444 Tel: E-mail: [email protected] Registered nurses and midwives in the employment to their health of public health care agencies may apply of Health service employer for inclusion in the Department Where fees are not part-time fees initiative. and Children’s students registered paid by the health service employer, fees. for the B.M.S. will be required to pay tuition numbers This course will only run if there are sufficient Course overview Who is eligible to apply? Bachelor in midwifery studies Contemporary trends and developments in the delivery of health Contemporary trends and developments in profession in terms of care present a challenge to the midwifery role and responsibilities. reclaiming and expanding the midwife’s midwives This degree programme aims to provide practicing and attitudes about with an increased level of knowledge, skills The programme will: the principles and processes of practice. n n n An Bord Midwives who hold registration as a midwife with Altranais, the Irish nursing board, and who qualified with the Diploma in Midwifery (or equivalent), may apply for admission into this one-year programme leading to a Bachelor in midwifery studies honors degree. An Bord Midwives already holding registration as a midwife with Altranais but without the Diploma in Midwifery (or equivalent) Access to may apply for admission to a one-year part-time degree programme which, on successful completion, will allow access to the beginning of the degree year.

for students interested in finding out more about radiation radiation about more out finding in interested for students therapy. Claire Poole on: + 353 1 896 2973. There are information days held throughout the year please contact For details of the next information day,

Health care management Clinical therapy practice of radiation 4 Research project Principles and of cancer care 4 practices Radiotherapy simulation Radiotherapy treatment Radiotherapy simulation methodology and statisticsResearch Clinical of radiation therapy practice 3 n n Further information Did you know? Career opportunities Assessment A significant clinical component is also part and parcel of significant clinical component A The clinical sites are the radiotherapy the final two years. Hospital, Dublin; St. James’ departments attached to St. Luke’s Cork University Hospital, Dublin; Beaumont Hospital, Dublin; the Mater PrivateHospital; University College Hospital Galway; Private Hospital, Dublin; the Hospital, Dublin; St. Vincent’s and Whitfield Galway Clinic; the Limerick Clinic; the Beacon The duration of the clinical placement is 1 month in Clinics. Freshman 2 months in Senior Junior Freshman (first) year, year and 3 months in Junior Sophister (third) (second) year, 5 months in Senior Sophister (fourth) year. E-mail: [email protected] or [email protected] www.medicine.tcd.ie/radiation_therapy + 353 1 896 3248/3234 Tel: There is a worldwide need for radiation therapists. The broad There is a worldwide need for radiation therapists. scientific content of the degree also means that you will be well qualified to start a career in research and development, medical or the marketing of products associated with cancer technology, and in the health sector generally. medicine in particular, Throughout the course you will be examined in both theoretical Throughout the course you will be examined complete your and clinical subjects, and must satisfactorily will take clinical component. Part of the clinical programme This course will be assessed by written end-of-year examinations,This course will be assessed by written end-of-year assessment. individual and group project work and continuous clinical portfolio and research project are a substantial A in your final year. component of the assessment processes place during the vacation periods. n n n n Fourth year courses include: Fourth year courses n n n Sophister year The Senior n n 200 Health Sciences E-mail: [email protected] Tel: +35318962692 post-registration/undergrad-bms-hons.php http://nursing-midwifery.tcd.ie/undergraduate/ research proposalformspartofthemethodsmodule. A combination ofessays,projectsandgroupworkisuseda approach toreadingandreferencethestudent’s ownpractice. Assessment methodsaredesignedtorequirebothananalytical n n n n n The coursecomprisesfivemodules: an assignmentwhichhasaparticularpractice-basedfocus. midwifery whilstundertakingthecourseandwillundertake clinical component,studentsareexpectedtobepractising throughout theteachingterms. Although thereisnospecific study weekatthebeginningofcourseandonedaya time basis. You willberequiredtoattendtheUniversityforone This coursetakesplaceoveroneacademicyearonapart- Further information Assessment Course content Course structure Research methods practice oflearninginmidwifery andthefacilitation Communication Health carequalityandinformatics Expectant approachtomidwiferypractice midwiferypractice Governance in

beginning ofthedegreeyear. which, onsuccessfulcompletion,willallowaccesstothe admission to a one-year part-time Access to degree programme but without the Diploma in Nursing (or equivalent) may apply for Nurses alreadyholdingregistrationwith An Bord Altranais, degree. year programme leading to a Bachelor in Nursing studies honors studies (orequivalent),mayapplyforadmissionintothisone- nursing boardandwhoqualifiedwiththeDiplomainNursing Candidates who hold registration with An Bord Altranais, the Irish profession. and challengetheirthinkingassumptionsabout develop students’ knowledge concerning the nature of nursing principles andprocessesofpractice. The programmewill increased levelofknowledge,skillsandattitudesaboutthe This degreeprogrammeaimstoprovidenurseswithan graduate level. to providethenursewithadepthandbreadthofknowledgeat responsibilities. These developmentshaveresultedintheneed care havebroughtaboutanexpansionofthenurse’s roleand Contemporary trendsanddevelopmentsinthedeliveryofhealth Course overview Bachelor in nursing studies Who iseligibletoapply? of suitableapplicants. This coursewillonlyruniftherearesufficientnumbers for theB.N.S.willberequiredtopaytuitionfees. paid bythehealthserviceemployer, studentsregistered and Children’s part-timefeesinitiative.Wherearenot service employerforinclusionintheDepartmentofHealth of publichealthcareagenciesmayapplytotheir Registered nursesandmidwivesintheemployment E-mail: [email protected] Tel: +35318964444 Admissions Office,RegentHouse, Trinity College,Dublin2 Application formsareavailablefrom: 2012. for entrytotheacademicyearcommencingin Autumn Nursing andMidwiferywebsitefordetailsonclosingdate directly totheUniversity. PleaseconsulttheSchoolof This isnotaCAOcourse.Studentsarerequiredtoapply Application Procedure: DEGREE AWARDED:

B.N.S

Health Sciences 201

Assessment Further information Tel: +353 1 896 2692 Tel: E-mail: [email protected] of 50% must be achieved in each module. be achieved in each of 50% must All modules are assessed by continuous assessment assessment are assessed by continuous All modules a minimum an overall pass achieve To (assignments). http://nursing-midwifery.tcd.ie/undergraduate/ ‑post-registration/undergrad-bns-hons.php

Research methods Leadership and in management nursing practice informaticsHealth care quality and Communication facilitation and the of learning in nursing practice Contemporary issues in nursing practice Course structure and content structure and Course n n n n n The Bachelor in Nursing studies is a part-time modular is a part-time modular in Nursing studies The Bachelor and there one day per week Lectures are provided programme. Trinity in the academic year week at the start of is one study of the programme will result College. Successful completion The programme is composed of five compulsory modules, which which modules, compulsory five of composed is programme The in nursing practice and health care. address current issues in the award of a Bachelor in Nursing studies degree (B.N.S.). in the award of a Bachelor 202 Health Sciences new entrantsmust attendtheirregularmedical practitioner diseases frompatientstostudents, orstudenttopatient,all the interests of reducing the risk of the transmission of infectious All healthcareprofessionalshave adutyofcaretothepublic.In School office. (BBV) policyformedicalstudents areavailableattheMedical Details ofvaccinationprogrammesandtheBloodBorneViruses colleagues, butalsothepatientsandmembersofpublic. measures aretakennotonlytosafeguardthestudentsandtheir the Schoolisobligedtoensurethatreasonableandappropriate with whommedicalstudentsareinclosecontact.Inthiscontext, applying forentryandouroverridingdutyofcaretothepublic between ourpastoralresponsibilitytoindividualstudents diseases, theSchoolofMedicineat TCD strikesabalance Medicine: Withregardtothetransmissionofinfectious have completedthecourseofvaccination. permitted tocommencepracticalclinicalexperienceuntilthey Students inDentalnursingandtechnologywillnotbe until theyhavecompletedacourseofvaccination. 2. Studentswillnotbepermittedtocommenceclinicalpractice on requestfromtheDentalSchoolOffice, Trinity College,Dublin vaccination. Detailsofvaccinationprogrammesmaybeobtained to beimmunehepatitisBwillrequiredundergoacourseof Students admittedtothesecourseswhoarenotalreadydeemed to admission. possible thereafter. The Collegereservestherighttoretestprior and toforwardtheresultDentalSchoolOfficeassoon students areadvisedtoundergotestingintheirhomecountry before beingpermittedtoregisterwiththeCollege.International C RNA)carriedoutnotmorethansixmonthspriortoentry, C antibodytest(andifpositiveanegativePCRforHepatitis negative HBV-DNA whereapplicable)andanegativeHepatitis or inthepresenceofapositiveHBsAg,negativeHBeAgand negative hepatitisBvirusinfectionresult(i.e.HBsAg Students inDentalscienceandhygienemustproducea tuberculosis, chickenpox,measles,mumpsandrubella. could includebutarenotlimitedto;HIV, hepatitisB,C, transmitted toapatientorfellowhealthworker. Suchconditions free ofanylife-threateninginfectiousconditionthatcouldbe hygiene, Dentalnursing,andtechnologymustremain technology: Dental science, Dental hygiene, Dental nursing, and Dental The Collegereservestherighttoretestprioradmission. the resulttorelevantofficeassoonpossiblethereafter. to undergotheHBsAgtestintheirhomecountryandforward required beforeregistration.Internationalapplicantsareadvised Hepatitis Be-antigen(HBeAG)testwithanegativeresultwillbe for thiscourse.Inthecaseofapositiveresultfromabove, Antigen (Anti-HBc)testresultbeforebeingpermittedtoregister a negativeHepatitisBs-Antigen(HBsAG)and Anti HBCore Clinical speechandlanguagestudies: IMPORTANT: PLEASEREADTHISSECTIONCAREFULLY. Precautions againstinfectiousdiseases Registered studentsinDentalscience, Students must produce (see below). requirements isavailablefromthe DisciplineofPhysiotherapy of Physiotherapy. Furtherinformationrelatingtovaccination in theirhomecountryandtoforward theresulttoDiscipline vaccination. Overseasapplicants areadvisedtoundergotesting immune toHepatitisBwillberequiredundergoacourseof this coursewhoarenegativebutnotalreadydeemedtobe not morethansixmonthspriortoentry. Studentsadmittedto if positiveanegativePCRtestforhepatitisCRNA)carriedout where applicable)andanegativeHepatitisCantibodytest(and of apositiveHBsAg,negativeHBeAgandHBV-DNA B virusinfectionresult(i.e.negativeHBsAgorinthepresence Students inPhysiotherapymustproduceanegativeHepatitis tuberculosis, measles,rubellaandchickenpox. to certifytheirHepatitisstatus,vaccinationstatusorimmunity to, Service ortheirmedicalpractitionerinthefirstsemesterofstudy disease, allnewentrantsmustattend Trinity CollegeHealth interests ofreducingtherisktransmissioninfectious infection orpreviousvaccinationhasbeendocumented.Inthe tuberculosis andvaricellaunlessimmunityasaresultofnatural immunised againstHepatitisB,C,measles,rubella, Physiotherapy programme,priortoadmission,mustbe Physiotherapy: Studentsacceptedontotheundergraduate has beendocumented. immunity asaresultofnaturalinfectionorpreviousvaccination Hepatitis B,measles,rubella,tuberculosisandvaricellaunless prior tothefirstpracticeplacement,mustbeimmunisedagainst registration undergraduateOccupationaltherapyprogramme, Occupational therapy: MRSA. students tobescreenedforadditionalconditions,example student willpractice.Somehealthserviceprovidersmayrequire will beorganisedbythehealthserviceproviderwhere documented. Screening(includingmedicals)andvaccination as aresultofnaturalinfectionorpreviousvaccinationhasbeen B, measles,rubella,tuberculosisandvaricellaunlessimmunity Midwifery programmesmustbeimmunisedagainstHepatitis students onthepre-registrationundergraduateNursingand Nursing andMidwifery: the MedicalSchooloffice. Diseases Informationbooklet)andareavailableatalltimesin applicants aspartoftheadmissionsprocess(inInfectious the vaccinationprogrammesavailablearecommunicatedto of vaccination.Detailsspecificinvestigationsrequiredand to beimmuneHepatitisBwillrequiredundergoacourse Students whoareHepatitisBnegativebutnotalreadydeemed appropriate confirmationthattheydonothaveactivedisease. produce evidenceoftheirhepatitisBandCstatuswhere mumps, rubellaandchickenpox.Inaddition,studentsmust their vaccinationstatusorimmunitytotuberculosis,measles, or theStudentHealthServicepriortoregistrationcertify Students acceptedontothepre- Prior tothefirstpracticeplacement, Health Sciences 203

Some health service providers may require students may require students service providers Some health General: Trinity Centre for Health Sciences Centre Trinity Physiotherapy: Department of Physiotherapy The Allocations Office The The School of Nursing and Midwifery 24 D’Olier Street Occupational therapy: Discipline of Occupational therapy for Health Sciences Centre Trinity Hospital St. James’s Street James’s Dublin 8 +353 1 896 3210 Tel: Street James’s Dublin 8 +353 1 896 2110 Tel: Medicine: School of Medicine Nursing and Midwifery: Dublin 2 +353 1 896 2031 Tel: Clinical speech and language studies: Lincoln Place College Trinity Dublin 2 +353 1 896 1789 / 1690 Tel: Biomedical Sciences Institute College Trinity Dublin 2 +353 1 896 1075 Tel If Irish law or regulatory practice changes between the date If Irish law or regulatory requirements will be provided to all Details of vaccination regarding requirements all of details full and students, incoming diseases may be obtained on precautions against infectious offices: request from the following Dental science: The Dental School Office by the student. document and the date of registration for of publication of this right the reserves College Trinity courses, these to entrants new adopted by law and/or regulation in to require that the criteria to practice clinically in Ireland be satisfied relation to the ability permitted. before registration is Studies Department of Clinical Speech and Language College Trinity Dublin 2 +353 1 896 1588 Tel: to be screened for additional conditions, for example MRSA, for example for additional conditions, to be screened All costs associated site. completed at the clinical which will be be met and vaccination must infectious diseases with tests for 204 General Information Chemistry Chaplaincy Careers Advisory Service Business studiesandalanguage Business, economicandsocialstudies(BESS) Business Broad curriculum Biochemistry Arts coursesat Trinity College Application procedures Ancient historyandarchaeology Ancient andmedievalhistoryculture An Ghaeilge Alert list Age requirement Admission requirements Acting Accommodation Access services Dental hygiene Deferred entry Deaf studies Course requirements Computer scienceandlanguage Computer scienceandbusiness Computer science Computer engineering Clinical speechandlanguagestudies Classics Classical civilisation Civil engineering Children’s andgeneralintegratednursing Chemistry withmolecularmodelling C B A D Index With Law With alanguage With Computerscience Within BESS 144 143 207 173 122 120 131 129 188 160 120 116 119 72 42 37 10 42 37 13 35 19 93 36 27 24 22 48 24 46 44 95 11 9 6 8 Economics Earth sciences Early Irish Early andmodernIrish Drama andtheatrestudies Drama studies Disability Service Dental technology Dental science Dental nursing Functional biology French Film studies Fees information European studies Environmental sciences Environmental engineering English studies English literature English languagerequirement Engineering withmanagement Engineering Electronic andcomputerengineering Electronic engineering Education E F Within TSM Within PPES Within BESS a disability/specificlearningdifficulties Making anapplicationasastudentwith Within TSM With Law Within Europeanstudies Within Computerscienceandlanguage With Businessstudies Mechanical andmanufacturing Electronic andcomputer Electronic Computer Civil, structuralandenvironmental

161 178 176 174 147 146 129 136 126 133 132 100 122 135 133 132 131 129 96 80 37 19 71 58 42 53 53 51 51 98 23 58 56 56 26 55 11 General Information 205 11 10 68 72 74 12 27 53 76 78 20 13 92 71 71 110 199 200 188 109 124 135 164 135 166 181 152 186 153 167 154

Bachelor in nursing studies Making an application Mature students officer Bachelor in midwifery studies Optional courses TSM Within With French With German N J L M Nursery Nursing Manufacturing engineering Mathematics Matriculation examination Mature students Mechanical engineering Medicinal chemistry Medicine Microbiology Midwifery Modern Irish Molecular medicine Music Music education Nanoscience, physics and chemistry of advanced materials Neuroscience Islamic civilisations Jewish and Latin Languages Law Law and business Law and political science Library Management science and information systems studies (MSISS) 7 63 19 23 65 12 10 61 27 53 58 83 42 58 71 122 107 148 163 149 101 122 103 104 106 163 179 180 151 208 171 188 188 150 Within European studies TSM Within Early and modern Irish Within Computer science and language Within TSM Within With Business studies Within Computer science and language Within European studies With Law With Political science Within Science TSM Within Within Science Human genetics I H G IT services for students IT Italian Irish studies International Office Irish Information systems (Diploma and Degree) Intellectual disability nursing Immunology Important dates Human nutrition and dietetics Human genetics Human health and disease History and political science History of art and architecture How to apply Health Service History Greek Geology German General nursing Geography Genetics Gallery, Douglas Hyde Douglas Gallery, Garda vetting 206 General Information Political science Polish Plant sciences Physiotherapy Physiology Physics and sociology(PPES) Philosophy, politicalscience,economics Philosophy Pharmacy Optional courses Open Days One-year/one-term students Offers toapplicants Occupational therapy Russian Restaurants andcoffee shops Radiation therapy Psychology Psychiatric nursing P O R Within TSM Within Europeanstudies With Businessstudies and History and Geography Within PPES Within BESS With Law Within Russian Within Europeanstudies With Businessstudies Physics andastrophysics Within Science Within PPES Non-EU EU

158 196 157 194 192 198 188 155 155 112 112 58 42 63 83 80 37 74 58 42 80 23 22 82 80 79 13 15 23 85 7 Subject requirements Students’ Union Student societies Student counsellingservice Structural engineering Sports scholarships Sport at Trinity College Spanish Sociology andsocialpolicy Sociology Social studies(socialwork) Science Scholarships andawards Zoology World religionsandtheology Vaccinations Two-subject moderatorship Tutors Trinity Collegetheatres Trinity Publications Theoretical physics TAP (Trinity Access Programmes) S Z W V T Within TSM Within Europeanstudies With businessstudies Within TSM Within PPES Within BESS Minimum entrypoints Subject requirements Permitted combinations Ordinary degreeanddiplomacourses Degree courses TSM 129 139 159 202 169 115 113 58 42 80 37 28 28 92 33 30 28 10 17 89 87 17 90 11 6 5 5 9 7 7 General Information 207

with cell biology’, and ‘Biochemistry with structural with cell biology’, and with ‘Biochemistry’. biology’, have been replaced replaced has been ‘Biochemistry with immunology’ with ‘Immunology’. linguistics and German’, ‘TR011 Computer science, Computer science, ‘TR011 linguistics and German’, and ‘TR013 Computer linguistics and French’, science, linguistics and Irish’. present French, German and Irish. Students must a higher a higher level grade C in mathematics; and or level grade C1 if presenting French or German, a higher level grade B if presenting Irish. ‘Science’ – Biochemistry options – Biochemistry ‘Science’ options: ‘Biochemistry The following two course and language’ ‘Computer science ‘TR010 Computer science, This course replaces TR039 choose one language from Students of Restructured courses Restructured TR071 TR039

. has been has been ‘Botany’ ‘Botany’ . ‘Computer science and business’. ‘Plant sciences’. renamed The degree option renamed ‘Business and computing’ ‘Business and computing’ ‘Science’ ‘Philosophy & political science’ Alert list – 2012 Alert Course withdrawn TR014 TR082 TR071 New titles From 2012 there will be an entry route to a number of degree degree of number a to route entry an be will there 2012 From College for applicants presenting Trinity programmes in presenting Applicants qualifications. 5) (level FETAC appropriate for admission distinctions in five modules can be considered TR093); & to Science (TR071); General Nursing (TR091 Nursing Psychiatric Nursing (TR095); Intellectual Disability may be found (TR097) and Midwifery (TR913). Further details at www.tcd.ie/Admissions/undergraduate/requirements/ matriculation/fetac. Entry Route for students presenting qualifications FETAC Students presenting Leaving Certificate Mathematics at honors Leaving Certificate Mathematics at honors Students presenting with an additional 25 points for achieving level will be credited Bonus points for Mathematics Bonus Students presenting A-Level Mathematics, Further Mathematics A-Level Students presenting will be credited with an additional 25 points or Pure Mathematics E or above. for achieving a grade a grade HD3 or above. 208 General Information See www.tcd.ie/calendar/term-dates 1 March2012 25 February2012 1 May2012 24 March2012 1 July2012 31 May2012 2 &3December2011 1 February2012 20 January2012 20 January2012 Important datesforapplicants for Term Dates2012-2013 Date ofHPAT-Ireland testforentrytoMedicine. Provisional dateforMusicandeducationentranceexamination. Closing dateforsubmissionofa‘ChangeMind’ toCAO. Closing dateforreceiptofapplicationstheReidEntranceExhibition. n n n n n n n n n n TCD OpenDays. Final dateforCAOonlinediscountedapplicationfee. Closing dateforregistrationtheHPAT-Ireland testforentrytoMedicine.

be submittedtothe Admissions Office,RegentHouse, Trinity College,Dublin2,Ireland. up tooneacademicyearshouldbesubmittedtheInternationalOffice. Late applications frommaturestudentswillnotbeconsidered. Late applications torestrictedentrycourseswillnotbeconsidered. Late applications forCAO. Late closingdate visitingstudentfor studentswishingtostudyasa EUandnon-EU Applications from sittheUniversitymatriculationexamination. Closing dateforapplicationsto orDentalscienceshould non-EUstudentswishingtoapplyforMedicine Applications from otherthanMedicine non-EUstudentswishingtopursueafulldegree Applications from formstothe mature-studentssupplementaryapplication Closing dateforsubmissionof studentsmust restrictedentrycoursesandapplicationsfrommature Applications to dateforCAO. Normal closing College, Dublin2,Ireland. or DentalscienceshouldbesubmittedtotheInternationalOffice,East Nursing orMidwifery). Admissions Office,RegentHouse, Trinity College,Dublin2(forallfull-timecoursesexcept be madetotheCAObythisdate. Theatre, Trinity

Welcome from the Provost

programme. You will learn to think for yourself, to learn from your mistakes, and refine your mind to be able to manage whatever the changing world may throw at you. These skills are for life.

Located in the heart of Ireland’s busy capital city, TCD students can avail of the many attractions and facilities Dublin has to offer. The campus’s state-of-the-art facilities include a modern Sports Centre, the Science Gallery – which is the first of its kind in the world, and the Trinity College Library, the largest research library in Ireland. In addition to collections gathered over four centuries, the College has had 200 years of legal deposit, allowing Trinity College to claim a copy of every book published in Ireland and the UK. It is also home to an extensive collection of manuscripts, the most famous being the Book of Kells.

I hope that you will consider joining us as a student at Trinity The ‘Trinity Experience’ is a chance in a lifetime for personal College Dublin. development in the broadest sense. Trinity College has many diverse and colourful societies and clubs which contribute much Trinity College Dublin is recognised internationally as Ireland’s to the life and fabric of the University and community. There premier university and as one of the top universities in the are some 50 sports clubs and almost 100 student societies world*. Founded in 1592, it is the oldest university in Ireland. to participate in, with something to suit all interests. Today the College has a vibrant community of 16,837 students representing every county in Ireland, 122 nationalities, and a Committed to excellence in teaching, research and innovation, wide range of social backgrounds and age-groups. Some of Trinity College Dublin guarantees a distinctive all-round the most famous people in Irish history have been educated undergraduate experience that will change your life forever. at Trinity College; writers like Oscar Wilde and Samuel Beckett; As a student you feel a great sense of history, of walking in scientists like William Rowan Hamilton and E.T.S. Walton, who the footsteps of famous graduates, many of whom have and won the Nobel Prize for his work on the atom, as well as two are helping shape the history of Ireland and the wider world. Irish presidents and many industry leaders. I hope you will consider joining us to study here and look forward to welcoming you on campus for an exciting new journey that Trinity College has a number of important priorities for its will open your mind to new experiences, ways of thinking and students. Each incoming student is assigned a Tutor, a member friendships, many of which will last for a lifetime. of the academic staff, who is there to advise you and help if any personal problem arises. This tutorial system is unique in Ireland. In addition, a student-to-student mentoring programme for first year students has been initiated. Other high quality student services include the Careers Advisory Service. There are also Patrick Prendergast possibilities of studying abroad in other leading universities Provost through Trinity College’s partnership agreements. July 2011 Students benefit from a scholar-teacher model where you have the opportunity of being taught by world-leading experts in their * Trinity College Dublin is ranked in 52nd position in the top 100 world field. Offering a unique educational experience across a range universities and 15th position in the top European universities by the QS of disciplines in the Arts, Humanities, Engineering, Science, World University Rankings 2010. In the Times Higher Education World Human, Social and Health Sciences, TCD’s curriculum is aimed University Rankings, TCD is ranked 76th in the top 200 world universities and 14th in the top European universities. not just at acquiring knowledge but at developing critical thinking and facilitating research at every stage of the undergraduate Copies of this publication are available free of charge from The Admissions Office Regent House Trinity College Dublin 2, Ireland Telephone: +353 1 896 4444 Fax: +353 1 872 2853 Email: [email protected] Website: www.tcd.ie/admissions/undergraduate

The Board of Trinity College is not bound by errors in or omissions from this publication UNDERGRADUATE COURSES 2012

UNDERGRADUATE COURSES 2012 www.tcd.ie