DOCSLIB.ORG

Slinging Mud Without Facts Page 1 of 2

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Slinging Mud Without Facts Page 1 of 2 Slinging mud without facts Page 1 of 2 Slinging mud without facts By Ben Lawrence False alarms have been Nigeria's daily fare for the past 16 years when small men started to wear big boots. In the Babangida and Abacha years, six months hardly passed without the nation being told of one subversive plot or another. Even though these elements with siege mentality would have made President Olusegun Obasanjo to declare, for example, the South-West a terrorist zone, has been careful to avoid careless talks. But not so some of the governors in the new democratic dispensation. One such governor is 'Chief' (Dr.) Orji Kalu of Abia State, the young man who shot into prominence in the Babangida's years of undisciplined rule, when every and anything was fit for Nigeria. And he got a national award for his contributions to Nigeria at a time many people did not know what exactly whether he was an industrialist or an inventor. Governor Kalu's recent complaint about the East-Central area of Nigeria being neglected by the Federal Government has been disproved by the Federal Ministry of Works and Housing. The ministry tabulated the financial value of its work in the zone which runs into billions of naira. This would appear to be a very fair share of the national budget. Who neglected those roads for 15 years when in some parts of the country dual carriageways of international standards criss-cross sandy and arid lands? One could assume that although the voice of criticism against the ministry was Kalu's, it was the idea emanated from interests in the Arewa Consultative Forum which appears to want to attack the Minister of Works and Housing, Chief Anthony Anenih, in the struggle to pull down President Olusegun Obasanjo. Several people from the northern states have held the portfolio of the Minister of Works and Housing. What did they do to contain the menace of erosion that has been ravaging many states in the eastern parts. From whom did Obasanjo administration inherit the derelict roads and the decayed system he is battling to make whole? Co-incidentally, soon after Kalu's angry charges, some nebulous and faceless elements under the name of "Democracy Watch" took an advertisement to discredit Chief Anenih and President Obasanjo. I must confess that I used to sing a different tune from Obasanjo's on the economy. Now that the discredited International Monetary Fund (IMF) is up in arms against our President for thinking about the masses of Nigeria, Obasanjo could now count that he has recovered a lost friend. IMF policies introduced in the 1980s destroyed education, industries, morals and basic infrastructure in Nigeria with the devaluation of the naira and the free-for-all importation of disused goods to Nigeria. Anywhere the IMF has visited, it has left poverty and disorganisation. If they are only good primary education and steady supply of energy Nigerians will get from Obasanjo this year, we will count these as wise steps. IMF could go to hell. These disgruntled conservatives in parts of the North are too lazy to see defects in their approach. http://www.nigerdeltacongress.com/sarticles/slinging_mud_without_facts.htm 7/18/2008 Slinging mud without facts Page 2 of 2 First, they descended on Lt-General Theophilus Danjuma for trying to retrieve the military from debauchery. They still want to revel in a military led by "pepper soup" generals and admirals. And Danjuma has always believed in a trim, fit and effective fighting force and for this one stood behind him when Professor Bolaji Akinyemi, tried to challenge that principle in 1977. Some of us have seen wars in many theatres even outside Nigeria. Number hardly counts. The service chiefs appointed by this administration are from the Middle Belt states. That was Danjuma's sin. So, the Middle Belt is no more in the North? After they unsuccessfully tried to destroy Danjuma, they changed to Bola Ige whom they accused of everything evil under the sun for radically trying to alter the fortunes of NEPA for the better. The managing director whom they used to challenge Ige ought to submit himself to a public probe. Obasanjo should know that his reconciliation policy should not be at the expense of the public. Now these ciphers are gunning for Anenih because they can no longer brow beat people to get fat contracts that are never executed. They are perpetual middlemen and consumers. Let them show what Nigeria gained in the 20 unbroken years of their rule at the federal level. The South-South states will control its resources even if it means shedding blood. That area has sustained Nigeria with palm produce, rubber, timber and oil for a century. The "Arewa" zone as at 1963 had run into financial straits and was asking for a review of the revenue formula, disbanding its crusade for derivation policy. We should allow sleeping dogs to lie. Must it always be at their bidding? When next Governor Kalu goes to Sokoto, even without clearance from other Igbo governors, to brief his eminence on the South-East and confederation, he should also inform him that the Benin Empire had consular representation in Portugal, the Netherlands and Brazil in the 16th Century, that Oba Esigie schooled in Portugal and was baptised a Christian in the 1520s. Nigeria spent no kobo to prospect for oil in the South-South. Billions of dollars had been spent in looking for oil in Bauchi and the Chad Basin. "Bakodaya". Let them face their zone and transform it through their effort. The writer is a veteran journalist and wrote in from Lagos. http://www.nigerdeltacongress.com/sarticles/slinging_mud_without_facts.htm 7/18/2008.
Load more

Recommended publications
  • Political Parties and Threats of Democratic Reversal in Nigeria
    VOLUME 6 NO 2 95 BUILDING DEMOCRACY WITHOUT DEMOCRATS? Political Parties and Threats of Democratic Reversal in Nigeria Said Adejumobi & Michael Kehinde Dr Said Adejumobi is Chief, Public Administration Section, and Coordinator, Africa Governance Report, United Nations Economic Commission for Africa Governance and Public Administration Division, UNECA, PO Box 3005, Addis Ababa, Ethiopia Tel: +251 912200066 e-mail: [email protected] Michael Kehinde is a lecturer in the Department of Political Science, Lagos State University PM B 1087, Apapa, Lagos, Nigeria Tel: +234 802 5408439 ABSTRACT Political parties are not only a major agency for the recruitment and enthronement of political leaders in an electoral democracy they are the foundation and a building block of the process of democratic evolution and consolidation. However, the nature and character of the dominant political parties in Nigeria threaten the country’s nascent democratic project. They lack clear ideological orientation, do not articulate alternative worldviews, rarely mobilise the citizenry, and basically adopt anti-democratic methods to confront and resolve democratic issues. Intra- and inter-party electoral competition is fraught with intense violence, acrimony and warfare. Put differently, these parties display all the tendencies and conduct of authoritarianism. The result is that what exists in Nigeria is ‘democratism’, the form and not the substance of an evolving democracy. INTRODUCTION The mass conversion of politicians and political thinkers to the cause of democracy has been one of the most dramatic, and significant, events in 95 96 JOURNAL OF AFRICAN ELECTIONS political history. Even in Ancient Greece, often thought of as the democratic ideal, democracy tended to be viewed in negative terms.
    [Show full text]
  • Social Development
    Social Development NG-Journal of Social Development, VOL. 5, No. 5, October 2016 Journal homepage: www.arabianjbmr.com/NGJSD_index.php POLITICAL PARTIES AND CHIEF EXECUTIVES AS THREATS TO DEMOCRACY IN NIGERIA: A STUDY OF PEOPLES DEMOCRATIC PARTY (1999 TO 2007) Dr. Mohammed-Hashimu Yunusa Faculty of Arts and Social Sciences, Department of Political Science Federal University, Lokoja, Kogi State Abstract Although Political Parties are undoubtedly a key ingredient of building a robust democracy, the character of the parties and their modus operandi have a significant impact on democracy, with Political Parties often having glaring gaps that block the exercise of participatory democracy. Many Political Parties, especially in transitional and semi-authoritarian States, lack internal democracy. They also frequently fall under the control of powerful economic and political elites. It is from this view that the paper discuses political parties and Chief Executives in Nigeria’s Fourth Republic with a focus of PDP (1999 to 2007). The paper argues that, in Nigeria, Chief Executives, particularly at the National level have been having influence over the activities of political parties at the detriment of “descent democracy”. To get out of the malaise, the paper recommends that, the Chief Executives should learn to put aside their personal ego in the interest of the state and that they should aim at good governance. There should be freedom of thought and expression. Keywords: Democracy, Political Parties, Chief Executives, Impeachment, Democratization. Introduction The development of Political Parties in Nigeria dates back to 1923 when the Nigerian National Democratic Party was launched. This followed the establishment of the Nigerian Legislative Council in order to provide some Political space for the participation of Nigerians.
    [Show full text]
  • Petro-Violence and the Geography of Conflict in Nigeria's
    Spaces of Insurgency: Petro-Violence and the Geography of Conflict in Nigeria’s Niger Delta By Elias Edise Courson A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Geography in the Graduate Division of the University of California, Berkeley Committee in charge: Professor Michael J. Watts, Chair Professor Ugo G. Nwokeji Professor Jake G. Kosek Spring 2016 Spaces of Insurgency: Petro-Violence and the Geography of Conflict in Nigeria’s Niger Delta © 2016 Elias Edise Courson Abstract Spaces of Insurgency: Petro-Violence and the Geography of Conflict in Nigeria’s Niger Delta by Elias Edise Courson Doctor of Philosophy in Geography University of California, Berkeley Professor Michael J. Watts, Chair This work challenges the widely held controversial “greed and grievance” (resource curse) narrative by drawing critical insights about conflicts in the Niger Delta. The Niger Delta region of Nigeria has attracted substantial scholarly attention in view of the paradox of poverty and violence amidst abundant natural resources. This discourse suggests that persistent resource- induced conflicts in the region derive from either greed or grievance. Instead, the present work draws inspiration from the political geography of the Niger Delta, and puts the physical area at the center of its analysis. The understanding that the past and present history of a people is etched in their socio-political geography inspires this focus. Whereas existing literatures engages with the Niger Delta as a monolithic domain, my study takes a more nuanced approach, which recognizes a multiplicity of layers mostly defined by socio-geographical peculiarities of different parts of the region and specificity of conflicts its people experience.
    [Show full text]
  • Federal Character Principle and National Integration (1999-2011)
    IOSR Journal Of Humanities And Social Science (IOSR-JHSS) Volume 21, Issue 6, Ver. 6 (June. 2016) PP 01-10 e-ISSN: 2279-0837, p-ISSN: 2279-0845. www.iosrjournals.org Federal Character Principle And National Integration (1999-2011) UGWUJA DANIEL I. Department Of Political Science, Enugu State University Of Science And Technology, Nigeria. ABSTRACT:-This research determined whether the application of the federal character principle in solving ethnic tension, national question and inequitable distribution of political power possesses the potentials for achieving national integration which is the prerequisite for economic development. Most of the information in this research was based on the secondary source of data collection. Since independence in 1960, Nigeria has been plagued by ethnic tension and political conflicts which have taken the toll of unity and stability in Nigeria. Various solutions, ranging from the adoption of unitary system, federalism to the creation of states, have been proffered and implemented to the creation of states, proffered and implemented, but the problem has persisted. The adoption of federal character principle in Nigeria is to hold the federating units firm. This research also traced the history of amalgamation and evolution of Nigeria as one political unit. It also analyzed and examined the adoption of the Federal Character Principle as a solution to the problem of ethnic tensions arising from inequitable distribution of political power and posts, its relevance to the solution on ethnic tensions and marginalization. Keywords:- National integration, amalgamation, economic development, political power and ethnic tension. I. INTRODUCTION The concept of federal character is a device through which every section of a nation would take part in the decision making process.
    [Show full text]
  • CJN Moves to Save Judiciary, Summons Justices Over Conflicting
    Digital Currency Gains Traction as CBN Appoints Technical Partner IMF urges caution on adoption of cryptocurrency as national currency Ndubuisi Francis and currency, also known as e-Naira. Emefiele said the Central Bank targeted social interventions, as well been a long and thorough process cent of central banks were consider- James Emejo in Abuja CBN Governor, Mr. Godwin Digital Currency (CBDC) would as improvement in monetary policy for the apex bank following its ing adopting digital currencies in Emefiele, disclosed this in Abuja. bring about increased cross-border effectiveness, payment systems resolve in 2017 to digitise the local their countries. The Central Bank of Nigeria But the International Monetary trade, accelerate financial inclusion, efficiency, and tax collection. currency after extensive research The CBN pointed out that the (CBN) yesterday announced the Fund (IMF) cautioned that coun- and lead to cheaper and faster CBN’s Director, Corporate Com- and exploration. selection of Bitt Inc. from among formal engagement of global fintech tries seeking to adopt the digital remittance inflow. He said the munications Department, Mr. Osita Nwanisobi said CBN’s decision highly competitive bidders was company, Bitt Inc., as technical currency should be wary of its digital money, also known as Nwanisobi, explained, in a state- was in line with an unmistakable partner for its proposed digital disadvantages. cryptocurrency, would lead to easier ment, that the e-Naira project had global trend in which over 85 per Continued on page 40 N1.5 Trillion Spent on COVID-19 Management, Says FG... Page 5 Tuesday 31 August, 2021 Vol 26. No 9640.
    [Show full text]
  • Africa Confidential
    www.africa-confidential.com 5 March 2004 Vol 45 No 5 AFRICA CONFIDENTIAL SOUTH AFRICA 2 UGANDA A ten-year test The ANC’s review of its first ten Double war years in power claims great strides Rebel massacres and party activists are shaking the National in providing housing, water and Resistance Movement’s political dominance electricity but has much less to say As pressure mounts on President Yoweri Kaguta Museveni to leave power by 2006 at the end of his about progress in cutting unemployment and HIV/AIDS. second elected term, both the military war in the north and the political war in the south are going badly for the government (AC Vol 44 No 24). Museveni’s political standing is based on the National Resistance Movement’s restoration of order in much of Uganda after the horrendous conflicts of the 1980s and its SA/CONGO-KINSHASA 4 willingness to reform the economy and establish an accountable form of government. All three are threatened by the current turn of events. Peace dividend With just two years to go, there seems little prospect of an orderly succession within the ruling NRM, Dreams of harnessing Congo’s let alone the possibility of free elections, which an opposition party or coalition might win. The volume massive hydroelectric resources to is literally being turned up in the war of words between opposition parties and the NRM. To counter the power Southern Africa and beyond popular, independent FM stations which regularly excoriate the government, two NRM loyalists, Local are moving towards reality. So too are the plans for the mining giants to Government Minister Tasisi Kabwegere and member of parliament William Sienda Sebalu are setting start new projects after Mbeki’s long up City FM to cover most of Uganda, including key rural areas, with a pro-government message.
    [Show full text]
  • LIB, Deutsch (Juli
    Eidgenössisches Justiz- und Polizeidepartement Département fédéral de justice et police Dipartimento federale di giustizia e polizia Departement federal da giustia e polizia Bundesamt für Flüchtlinge Office fédéral des réfugiés Ufficio federale dei rifugiati Uffizi federal da fugitivs Öffentlich Länderinformationsblatt Nigeria Stand vom: August 1999 Länderinformationsblatt Das vorliegende Länderinformationsblatt wurde von der Sektion "Länderinformation und Lageanaly- sen" des Bundesamtes für Flüchtlinge (BFF) in Bern (Schweiz) auf Deutsch und Französisch aufbe- reitet. Die Auswahl des beschriebenen Landes basiert auf der tatsächlichen oder zu erwartenden Zahl von Asylgesuchen aus dem betreffenden Herkunftsland in der Schweiz. Das Länderinformationsblatt enthält Grundlagenwissen, es kann und will aber weder ein erschöpfendes Bild dieses Landes vermit- teln noch lassen sich die Asylrelevanz eines individuellen Vorbringens oder ein allfälliger Flücht- lingsstatus daraus ableiten. Das Länderinformationsblatt wird bei Bedarf überarbeitet und basiert auf einer Zusammenstellung öffentlicher Informationen. Das Dokument enthält weder eine politische Stellungnahme noch eine Bewertung der Aussagen seitens der Schweizer Behörden. Das vorliegende Länderinformationsblatt wurde mit der grössten Sorgfalt recherchiert, redigiert und - soweit notwendig - übersetzt. Dennoch lassen sich überholte, unpräzise oder unkorrekte Angaben nicht in allen Fällen völlig ausschliessen. Zudem ist der Erstellungszeitpunkt des Länderinformati- onsblattes zu beachten. Country
    [Show full text]
  • Nigeria Project Obasanjo in Full Swing
    Nigeria special President Olusegun Obasanjo: has said nothing about a third term but everything points to his wanting one Nigeria Project Obasanjo in full swing Lindsay Barrett on the political situation in Nigeria today. “The sense of ‘imperial right’ being exhibited by President Obasanjo,” Barrett writes, “is what has annoyed and alienated a substantial proportion of the founding elite of the ruling PDP, but at the same time it appears to have captured the imagination of a new breed of political operatives who work closely with the president and are ready to defend his decisions.” 2007 promises to be a very interesting year. igeria’s ruling party, the Peoples Democratic Party (PDP), Abacha’s attempts to install what would have been a “democratic was founded only after the sudden death in 1998 of the dictatorship”. It is not, therefore, surprising that many of the military ruler, General Sani Abacha, but it emerged from founding fathers of the ruling party are now openly expressing Na process of resistance against Abacha’s attempt to install anxiety over fears that President Olusegun Obasanjo, himself a a so-called democracy through a carefully-plotted self-succession bid. former military ruler, appears to be reviving a similar agenda. This was the main purpose for which the group of elder When Abacha’s sudden demise threw his entire plan into the statesmen and activists who formed the core of the party’s base wastebasket, the founding fathers decided to form a fully-fledged came together and risked their lives and freedom to challenge party to contest the 1999 elections.
    [Show full text]
  • Download Journal [PDF]
    JOURNAL OF AFRICAN ELECTIONS JOURNAL OF JOURNAL OF AFRICAN ELECTIONS Special Issue: Nigeria’s 2007 General Elections Vol 6 No 2 Oct 2007 Vol Volume 6 Number 2 October 2007 VOLUME 6 NO 1 1 Journal of African Elections Special Issue: Nigeria’s 2007 General Elections GUEST EDITOR Emmanuel O Ojo ARTICLES BY Emmanuel O Ojo E Remi Aiyede Isaac Olawale Albert Uno Ijim-Agbor Said Adejumo and Michael Kehinde N Olufemi Mimiko J Shola Omotola Osisioma B C Nwolise N D Danjibo and Abubakar Oladeji P F Adebayo and J Shola Omotola Peter Vale Volume 6 Number 2 October 2007 1 2 JOURNAL OF AFRICAN ELECTIONS Published by EISA 14 Park Road, Richmond Johannesburg South Africa P O Box 740 Auckland Park 2006 South Africa Tel: +27 011 482 5495 Fax: +27 011 482 6163 e-mail: [email protected] ©EISA 2007 ISSN: 1609-4700 All rights reserved. No part of this publication may be reproduced, stored in a retrieval system or transmitted in any form or by any means, electronic, mechanical, photocopying, recording or otherwise, without the written permission of the publisher Copy editor: Pat Tucker Printed by: Global Print, Johannesburg Cover photograph: Reproduced with the permission of the HAMILL GALLERY OF AFRICAN ART, BOSTON, MA, USA www.eisa.org.za VOLUME 6 NO 1 3 EDITORS Denis Kadima, Electoral Institute of Southern Africa, Johannesburg Khabele Matlosa, Electoral Institute of Southern Africa, Johannesburg EDITORIAL BOARD Tessy Bakary, Office of the Prime Minister, Abidjan, Côte d’Ivoire David Caroll, Democracy Program, The Carter Center, Atlanta Jørgen Elklit,
    [Show full text]
  • Ajpsquarterly.Org Volume 1 No.1 October 2015 Call for Papers AJPS
    ajpsquarterly.org Volume 1 No.1 October 2015 Call for Papers AJPS is a quarterly online publication of the African Democracy Network (ADN). It is intended for African and Africanist scholars. It is widely accessible via a specialized website (ajpsquarterly.org) and linked with Open Access e-platforms, including Academia.edu, Academix.ng, and Googlescholar, making it globally visible and impactful. Its primary objective is to provide a forum for the exchange of ideas across disciplines and academic orientations in the social sciences and humanities, especially studies with focus on African conditions. 1 Guide for Contributors African Journal of Politics & Society (AJPS) is a peer-reviewed journal with a touch for original and research-oriented articles and reviews. It is published in January, April, July and October each year. Submitted manuscripts should contain: (1) A short, informative title (2)Author (s) name (s) and affiliations (3)An abstract of about 100 words (4)The main of about 5000 words should include all elements, abstracts, references (5) Charts and figures should be created electronically, if not each chart or figure should be submitted on clean sheets, data used to create the figure should be submitted with each figure; tables should be typed and placed at the end of the paper (6) A list of references in alphabetical order (7) Short biographical sketch about each author. AJPS REFEFERNCE STYLE References are listed in the text (author, date: page); the list of references is alphabetized. The AJPS prefers the APA style. However, research papers with Oxford or Chicago styles are equally encouraged. Authors of accepted paper shall pay a processing fee of N10, 000 (ten thousand naira only).
    [Show full text]
  • Governance, Corruption and Economic Development: Reflections on Corruption and Anti-Corruption Initiatives in Nigeria
    Governance, Corruption and Economic Development: Reflections on Corruption and Anti-Corruption Initiatives in Nigeria By Iremiren Benjamin Akhigbe A Doctoral Thesis Submitted in partial fulfilment of the requirements for the award of Doctor of Philosophy of Loughborough University 17/11/2011 © by Iremiren Benjamin Akhigbe (2011) Abstract This thesis is about the complex relationship between governance, corruption and economic development. It seeks to extend the literature via exploring the complex web of connections between corruption, development and the quality of political institutions in the specific case of Nigeria. In so doing the thesis explores some of the limitations of mainstream approaches to corruption and postulates that, rather than being a simple issue of rent-seeking that requires a prescription of orthodox economic policy reforms, corruption is an issue that requires contextualizing within the evolution of particular political cultures in specific places and a sensitivity to the impacts of culture on the definitions, causes and impacts of corruption. The thesis also reflects upon the impacts of market reforms on the opportunities for corrupt activity and the potential role of civil society in rendering anti-corruption interventions more effective. Accordingly, the thesis places the current high-profile debates over corruption and poor governance in Nigeria within an historical analysis of the patterns of governance in Nigeria over the years since independence in order to understand the intricate issues surrounding the historical, cultural and socio-political context of the problems of governance and corruption and their influence on anti-corruption reforms in the Nigerian context. Data were collected and analyzed using both qualitative and quantitative methods; the methods used in data collection included questionnaires and in particular a series of in-depth semi-structured interviews with key political stakeholders.
    [Show full text]
  • Global Journal of Human Social Science
    Online ISSN : 2249-460X Print ISSN : 0975-587X DOI : 10.17406/GJHSS PoliticalPartiesandElection CritqueoftheCommunitarians CriticalAnalysisoftheDebate EstablishingMaritimeDiplomacy VOLUME16ISSUE4VERSION1.0 Global Journal of Human-Social Science: F Political Science Global Journal of Human-Social Science: F Political Science Volume 16 Issue 4 (Ver. 1.0) Open Association of Research Society Global Journals Inc. *OREDO-RXUQDORI+XPDQ (A Delaware USA Incorporation with “Good Standing”; Reg. Number: 0423089) Sponsors:Open Association of Research Society Social Sciences. 2016. Open Scientific Standards $OOULJKWVUHVHUYHG 7KLVLVDVSHFLDOLVVXHSXEOLVKHGLQYHUVLRQ Publisher’s Headquarters office RI³*OREDO-RXUQDORI+XPDQ6RFLDO ® 6FLHQFHV´%\*OREDO-RXUQDOV,QF Global Journals Headquarters $OODUWLFOHVDUHRSHQDFFHVVDUWLFOHVGLVWULEXWHG 945th Concord Streets, XQGHU³*OREDO-RXUQDORI+XPDQ6RFLDO Framingham Massachusetts Pin: 01701, 6FLHQFHV´ 5HDGLQJ/LFHQVHZKLFKSHUPLWVUHVWULFWHGXVH United States of America (QWLUHFRQWHQWVDUHFRS\ULJKWE\RI³*OREDO USA Toll Free: +001-888-839-7392 -RXUQDORI+XPDQ6RFLDO6FLHQFHV´XQOHVV USA Toll Free Fax: +001-888-839-7392 RWKHUZLVHQRWHGRQVSHFLILFDUWLFOHV 1RSDUWRIWKLVSXEOLFDWLRQPD\EHUHSURGXFHG Offset Typesetting RUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQV HOHFWURQLFRUPHFKDQLFDOLQFOXGLQJ G lobal Journals Incorporated SKRWRFRS\UHFRUGLQJRUDQ\LQIRUPDWLRQ 2nd, Lansdowne, Lansdowne Rd., Croydon-Surrey, VWRUDJHDQGUHWULHYDOV\VWHPZLWKRXWZULWWHQ SHUPLVVLRQ Pin: CR9 2ER, United Kingdom 7KHRSLQLRQVDQGVWDWHPHQWVPDGHLQWKLV ERRNDUHWKRVHRIWKHDXWKRUVFRQFHUQHG Packaging
    [Show full text]