MYLK (Human) Recombinant Protein
Total Page:16
File Type:pdf, Size:1020Kb
MYLK (Human) Recombinant Purity: 97% by SDS-PAGE/CBB staining Protein Activity: The activity was determined by IMAP™ assay. The enzyme was incubated with fluorescein labeled Catalog Number: P5641 peptide and Ca/Calmodulin. The phosphorylation was detected by IMAP™ technology (fluorescence Regulation Status: For research use only (RUO) polarization). Product Description: Human MYLK (NP_444253.2, Substrate: GS peptide. 1428 a.a. - 1771 a.a.) partial recombinant protein with ATP: 100 uM. GST tag at N-terminal expressed in baculovirus infected Storage Buffer: In 50 mM Tris-HCl, 150 mM NaCl, pH Sf21 cells. 7.5 (0.05% CHAPS, 1 mM DTT, 10% glycerol). Sequence: Storage Instruction: Store at -80°C. MAPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEG Aliquot to avoid repeated freezing and thawing. DKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIAD KHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDF Entrez GeneID: 4638 ETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPD FMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDK Gene Symbol: MYLK YLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQG PLGAMGSPEEPKDEVEVSDDDEKEPEVDYRTVTINTE Gene Alias: DKFZp686I10125, FLJ12216, KRP, MLCK, QKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKF MLCK1, MLCK108, MLCK210, MSTP083, MYLK1, FKAYSAKEKENIRQEISIMNCLHHPKLVQCVDAFEEKA smMLCK NIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEG VEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRL Gene Summary: This gene, a muscle member of the ENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVIC immunoglobulin gene superfamily, encodes myosin light YILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEIS chain kinase which is a calcium/calmodulin dependent DDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKN enzyme. This kinase phosphorylates myosin regulatory MEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM light chains to facilitate myosin interaction with actin AMISGLSGRK filaments to produce contractile activity. This gene encodes both smooth muscle and nonmuscle isoforms. Host: Insect In addition, using a separate promoter in an intron in the 3' region, it encodes telokin, a small protein identical in Theoretical MW (kDa): 67 sequence to the C-terminus of myosin light chain kinase, that is independently expressed in smooth muscle and Applications: Func, SDS-PAGE functions to stabilize unphosphorylated myosin (See our web site product page for detailed applications filaments. A pseudogene is located on the p arm of information) chromosome 3. Four transcript variants that produce four isoforms of the calcium/calmodulin dependent Protocols: See our web site at enzyme have been identified as well as two transcripts http://www.abnova.com/support/protocols.asp or product that produce two isoforms of telokin. Additional variants page for detailed protocols have been identified but lack full length transcripts. Form: Liquid [provided by RefSeq] Preparation Method: Baculovirus infected insect cell (Sf21) expression system Purification: Glutathione sepharose chromatography Page 1/1 Powered by TCPDF (www.tcpdf.org).