Supplementary Table S4

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Supplementary Table S4 - Genes downregulated by anti-MYCN PNA ProbeID Symbol Description RH30ctrl_SignalRH30mut__SignalRH30pna_Signalpna vs mut pna vs ctrl 210842_at NRP2 neuropilin 2 109.8 83.2 3.4 -4.613 -5.013 219239_s_at ZNF654 zinc finger protein 654 155.9 140.8 6.8 -4.372 -4.519 220786_s_at SLC38A4 solute carrier family 38, member 4 91.8 135.1 17.7 -2.932 -2.375 206205_at MPHOSPH9 M-phase phosphoprotein 9 208.2 235.7 39.2 -2.588 -2.409 201171_at ATP6V0E ATPase, H+ transporting, lysosomal 9kDa, V0 subunit e 93.5 105 19.1 -2.459 -2.291 204732_s_at TRIM23 tripartite motif-containing 23 132.9 126.3 31 -2.027 -2.100 221079_s_at METTL2B methyltransferase like 2B 141.8 236.9 58.8 -2.010 -1.270 216971_s_at PLEC1 plectin 1, intermediate filament binding protein 500kDa 170 176.3 44.7 -1.980 -1.927 221703_at BRIP1 BRCA1 interacting protein C-terminal helicase 1 137 200.4 52.6 -1.930 -1.381 213647_at DNA2L DNA2 DNA replication helicase 2-like (yeast) 180.5 226.1 61.4 -1.881 -1.556 217547_x_at ZNF675 zinc finger protein 675 89.6 93.3 26 -1.843 -1.785 209865_at SLC35A3 solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3 191.6 171.3 50.4 -1.765 -1.927 AFFX-M27830_5_atSOX18 SRY (sex determining region Y)-box 18 755.4 982.7 295.8 -1.732 -1.353 212177_at C6orf111 chromosome 6 open reading frame 111 453.6 484.7 147.8 -1.713 -1.618 211088_s_at PLK4 polo-like kinase 4 (Drosophila) 174.6 122.1 37.4 -1.707 -2.223 213880_at LGR5 leucine-rich repeat-containing G protein-coupled receptor 5 172 178 56.2 -1.663 -1.614 201534_s_at UBL3 ubiquitin-like 3 948 900.4 287.1 -1.649 -1.723 219787_s_at ECT2 epithelial cell transforming sequence 2 oncogene 590.7 640.6 205.5 -1.640 -1.523 206852_at EPHA7 EPH receptor A7 287.7 292.6 97 -1.593 -1.569 201083_s_at BCLAF1 BCL2-associated transcription factor 1 338.7 405.8 135.5 -1.582 -1.322 204873_at PEX1 peroxisome biogenesis factor 1 349.9 487.7 164.2 -1.571 -1.091 214429_at MTMR6 myotubularin related protein 6 1213.5 830.9 291.5 -1.511 -2.058 200733_s_at PTP4A1 protein tyrosine phosphatase type IVA, member 1 1139.7 1289.3 457.9 -1.493 -1.316 201437_s_at EIF4E eukaryotic translation initiation factor 4E 1195.8 1312 466.3 -1.492 -1.359 40612_at DOPEY1 dopey family member 1 77.1 107.5 38.6 -1.478 -0.998 218772_x_at TMEM38B transmembrane protein 38B 489.4 505.1 181.4 -1.477 -1.432 221568_s_at LIN7C lin-7 homolog C (C. elegans) 1105.3 1300.6 468.9 -1.472 -1.237 204525_at PHF14 PHD finger protein 14 189.1 241 86.9 -1.472 -1.122 212930_at ATP2B1 ATPase, Ca++ transporting, plasma membrane 1 777.7 868.4 313.3 -1.471 -1.312 203078_at CUL2 cullin 2 166.1 155.6 56.2 -1.469 -1.563 213118_at KIAA0701 271 231.6 83.7 -1.468 -1.695 222250_s_at C1orf73 chromosome 1 open reading frame 73 355.3 397.8 144.4 -1.462 -1.299 215385_at FTO 175.8 214.3 78 -1.458 -1.172 205964_at ZNF426 zinc finger protein 426 267.5 242.9 88.7 -1.453 -1.593 214155_s_at LARP4 La ribonucleoprotein domain family, member 4 404 494 182.5 -1.437 -1.146 218649_x_at SDCCAG1 serologically defined colon cancer antigen 1 605.4 575.4 213 -1.434 -1.507 203791_at DMXL1 Dmx-like 1 188.6 145.4 53.9 -1.432 -1.807 32723_at CSTF1 cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa 657.5 805.5 298.7 -1.431 -1.138 206770_s_at SLC35A3 solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member A3 280.9 282.6 104.9 -1.430 -1.421 215143_at FLJ36166 119.9 104.1 38.7 -1.428 -1.631 212927_at SMC5L1 SMC5 structural maintenance of chromosomes 5-like 1 (yeast) 475.4 534.7 199.8 -1.420 -1.251 203049_s_at KIAA0372 KIAA0372 711.6 769.9 288 -1.419 -1.305 215936_s_at KIAA1033 KIAA1033 433.1 333.5 125 -1.416 -1.793 212388_at USP24 ubiquitin specific peptidase 24 733.9 770.1 292.4 -1.397 -1.328 213049_at GARNL1 GTPase activating Rap/RanGAP domain-like 1 372.5 377 143.5 -1.394 -1.376 214306_at OPA1 optic atrophy 1 (autosomal dominant) 433.2 419.2 159.7 -1.392 -1.440 213225_at PPM1B protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform 663.3 940.4 359.8 -1.386 -0.882 209314_s_at HBS1L HBS1-like (S. cerevisiae) 328.2 298.4 114.5 -1.382 -1.519 213372_at PAQR3 progestin and adipoQ receptor family member III 842.2 1211.4 466.3 -1.377 -0.853 212984_at ATF2 activating transcription factor 2 302.8 266.2 102.9 -1.371 -1.557 209551_at YIPF4 Yip1 domain family, member 4 383.1 367.1 142.7 -1.363 -1.425 218196_at OSTM1 osteopetrosis associated transmembrane protein 1 618 612.2 238.9 -1.358 -1.371 212060_at SR140 731.8 696.7 272.7 -1.353 -1.424 206555_s_at THUMPD1 THUMP domain containing 1 981.4 967.3 379.2 -1.351 -1.372 216609_at TXN thioredoxin 466.4 521.4 204.5 -1.350 -1.189 219439_at C1GALT1 core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1 389.1 501.4 197.4 -1.345 -0.979 205430_at BMP5 bone morphogenetic protein 5 567.9 552.6 217.7 -1.344 -1.383 209657_s_at HSF2 heat shock transcription factor 2 684.2 780.2 309.2 -1.335 -1.146 208653_s_at CD164 CD164 antigen, sialomucin 725.1 737.2 292.5 -1.334 -1.310 201151_s_at MBNL1 muscleblind-like (Drosophila) 343.1 385.9 153.3 -1.332 -1.162 210281_s_at ZNF198 zinc finger protein 198 220.9 200.5 80.2 -1.322 -1.462 215629_s_at KIAA1799 1369.5 1290.3 522 -1.306 -1.392 208883_at EDD1 E3 ubiquitin protein ligase, HECT domain containing, 1 316.1 338.6 137.2 -1.303 -1.204 218352_at RCBTB1 regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 1 528.6 586.9 239.1 -1.296 -1.145 212569_at SMCHD1 structural maintenance of chromosomes flexible hinge domain containing 1 468.8 430.9 176.6 -1.287 -1.408 219625_s_at COL4A3BP collagen, type IV, alpha 3 (Goodpasture antigen) binding protein 391.7 334.4 137.4 -1.283 -1.511 210293_s_at SEC23B Sec23 homolog B (S. cerevisiae) 1138.4 878.3 362.2 -1.278 -1.652 220295_x_at DEPDC1 DEP domain containing 1 360.3 464.3 191.8 -1.275 -0.910 218578_at CDC73 cell division cycle 73, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae) 322.9 307.7 127.2 -1.274 -1.344 204342_at SLC25A24 solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 24 1658.1 2225.4 924.6 -1.267 -0.843 212917_x_at FLJ22028 648.7 714.3 297.2 -1.265 -1.126 200841_s_at EPRS glutamyl-prolyl-tRNA synthetase 343.6 347.5 144.6 -1.265 -1.249 202259_s_at PFAAP5 778.2 821.2 343.3 -1.258 -1.181 203510_at MET met proto-oncogene (hepatocyte growth factor receptor) 2448.9 2994.1 1253.9 -1.256 -0.966 202034_x_at RB1CC1 RB1-inducible coiled-coil 1 357.2 391.2 164.1 -1.253 -1.122 59644_at BMP2K BMP2 inducible kinase 307.2 302.3 127.1 -1.250 -1.273 221749_at YTHDF3 YTH domain family, member 3 1406.8 1386 588.4 -1.236 -1.258 205122_at TMEFF1 transmembrane protein with EGF-like and two follistatin-like domains 1 739.3 1184.6 503.2 -1.235 -0.555 200685_at SFRS11 splicing factor, arginine/serine-rich 11 359.1 386.4 164.2 -1.235 -1.129 205091_x_at RECQL RecQ protein-like (DNA helicase Q1-like) 367.4 430.5 184.2 -1.225 -0.996 212417_at SCAMP1 secretory carrier membrane protein 1 311.2 292.9 125.8 -1.219 -1.307 203525_s_at APC adenomatosis polyposis coli 263.6 286.1 122.9 -1.219 -1.101 218311_at MAP4K3 mitogen-activated protein kinase kinase kinase kinase 3 700.3 892 383.9 -1.216 -0.867 214658_at TMED7 transmembrane emp24 protein transport domain containing 7 601 566.3 244.6 -1.211 -1.297 218875_s_at FBXO5 F-box protein 5 849.8 1005.6 435.9 -1.206 -0.963 202933_s_at YES1 v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1 3271.6 3247.5 1412 -1.202 -1.212 208296_x_at TNFAIP8 tumor necrosis factor, alpha-induced protein 8 509.4 559.1 243.4 -1.200 -1.065 215245_x_at FMR1 fragile X mental retardation 1 3125.6 4346.9 1901.8 -1.193 -0.717 203651_at ZFYVE16 zinc finger, FYVE domain containing 16 575.9 824.4 361.1 -1.191 -0.673 212179_at C6orf111 chromosome 6 open reading frame 111 1048.5 874.6 383.9 -1.188 -1.450 203970_s_at PEX3 peroxisomal biogenesis factor 3 335.8 347.5 152.6 -1.187 -1.138 214804_at FSHPRH1 FSH primary response (LRPR1 homolog, rat) 1 393.7 439.7 193.6 -1.183 -1.024 203276_at LMNB1 lamin B1 1675.9 2259.4 998.1 -1.179 -0.748 204832_s_at BMPR1A bone morphogenetic protein receptor, type IA 368.2 378.5 167.4 -1.177 -1.137 209681_at SLC19A2 solute carrier family 19 (thiamine transporter), member 2 763.5 901.4 398.9 -1.176 -0.937 221596_s_at DKFZP564O0523 257.2 249.7 110.6 -1.175 -1.218 209004_s_at FBXL5 F-box and leucine-rich repeat protein 5 1104.2 1251.6 557.3 -1.167 -0.986 212636_at QKI quaking homolog, KH domain RNA binding (mouse) 909.1 1235.2 550.1 -1.167 -0.725 213817_at 520.5 534 238.6 -1.162 -1.125 219631_at LRP12 low density lipoprotein-related protein 12 353.5 399.8 179.1 -1.159 -0.981 207719_x_at CEP170 centrosomal protein 170kDa 849.6 1085.7 487 -1.157 -0.803 203830_at C17orf75 chromosome 17 open reading frame 75 410.4 500.4 226.2 -1.145 -0.859 212138_at SCC-112 1312.7 1107.1 500.9 -1.144 -1.390 212526_at SPG20 spastic paraplegia 20, spartin (Troyer syndrome) 1076.8 1338.9 606.5 -1.142 -0.828 218490_s_at ZNF302 zinc finger protein 302 576.3 582.8 264.9 -1.138 -1.121 220327_at VGLL3 vestigial like 3 (Drosophila) 345.4 343 156.1 -1.136 -1.146 212420_at ELF1 E74-like factor 1 (ets domain transcription factor) 271.8 272.5 124.2 -1.134 -1.130 221931_s_at SEH1L SEH1-like (S.
Recommended publications
  • Integrative Analysis of Phenomic, Genomic, and Transcriptomic To

    Integrative Analysis of Phenomic, Genomic, and Transcriptomic To

    bioRxiv preprint doi: https://doi.org/10.1101/2020.11.29.392167; this version posted November 30, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Integrative Analysis of Phenomic, Genomic, and Transcriptomic to Identify Potential Functional Genes of Yaks in Plain and Plateau Jiabo Wang1,2, §, Jiuqiang Guan3, §, Kangzhu Yixi1,2,Tao Shu1, Zhixin Chai1,2, Jikun Wang1,2, Hui Wang1,2, Zhijuan Wu1,2, Xin Cai1,2, Jincheng Zhong1,2*,Xiaolin Luo3* 1. Key Laboratory of Qinghai-Tibetan Plateau Animal Genetic Resource Reservation and Utilization (Southwest Minzu University), Ministry of Education,Chengdu, Sichuan, China; 2. Qinghai-Tibetan Plateau Animal Genetic Resource Reservation and Utilization Key Laboratory of Sichuan Province, Chengdu, Sichuan, China; 3. Sichuan Academy of Grassland Sciences, Chengdu, Sichuan, China; §These authors contributed equally to this work. *Correspondences should be addressed to JZ ([email protected]) and XL ([email protected]) bioRxiv preprint doi: https://doi.org/10.1101/2020.11.29.392167; this version posted November 30, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Background: The yak is an important source of livelihood for the people living in the Qinghai-Tibet Plateau. Most genetics detection studies have focused on the comparison between different tissues of different breeds, both living in the Plateau and in the plains. The genetic background and complex regulatory relationship have frequently puzzled researchers. In this study, we divided a population of 10 yaks into two subgroups, namely Plateau (living in the Plateau) and Plain (living in the plains).
  • Structure and Function of the Fgd Family of Divergent FYVE Domain Proteins

    Structure and Function of the Fgd Family of Divergent FYVE Domain Proteins

    Biochemistry and Cell Biology Structure and Function of the Fgd Family of Divergent FYVE Domain Proteins Journal: Biochemistry and Cell Biology Manuscript ID bcb-2018-0185.R1 Manuscript Type: Mini Review Date Submitted by the 03-Aug-2018 Author: Complete List of Authors: Eitzen, Gary; University of Alberta Faculty of Medicine and Dentistry Smithers, Cameron C.; University of Alberta, Biochemistry Murray, Allan; University of Alberta Faculty of Medicine and Dentistry Overduin, Michael; University of Alberta Faculty of Medicine and Dentistry Draft Fgd, Pleckstrin Homology domain, FYVE domain, Dbl Homology Domain, Keyword: Rho GEF Is the invited manuscript for consideration in a Special CSMB Special Issue Issue? : https://mc06.manuscriptcentral.com/bcb-pubs Page 1 of 37 Biochemistry and Cell Biology Title: Structure and Function of the Fgd Family of Divergent FYVE Domain Proteins Authors: Gary Eitzen1, Cameron C. Smithers2, Allan G Murray3 and Michael Overduin2* Draft 1Department of Cell Biology, 2Department of Biochemistry, 3Department of Medicine, University of Alberta, Edmonton, Alberta, Canada *Corresponding author. Michael Overduin Telephone: +1 780 492 3518 Fax: +1 780 492-0886 E-mail: [email protected] https://mc06.manuscriptcentral.com/bcb-pubs Biochemistry and Cell Biology Page 2 of 37 Abstract FYVE domains are highly conserved protein modules that typically bind phosphatidylinositol 3-phosphate (PI3P) on the surface of early endosomes. Along with pleckstrin homology (PH) and phox homology (PX) domains, FYVE domains are the principal readers of the phosphoinositide (PI) code that mediate specific recognition of eukaryotic organelles. Of all the human FYVE domain-containing proteins, those within the Faciogenital dysplasia (Fgd) subfamily are particularly divergent, and couple with GTPases to exert unique cellular functions.
  • Table 2. Functional Classification of Genes Differentially Regulated After HOXB4 Inactivation in HSC/Hpcs

    Table 2. Functional Classification of Genes Differentially Regulated After HOXB4 Inactivation in HSC/Hpcs

    Table 2. Functional classification of genes differentially regulated after HOXB4 inactivation in HSC/HPCs Symbol Gene description Fold-change (mean ± SD) Signal transduction Adam8 A disintegrin and metalloprotease domain 8 1.91 ± 0.51 Arl4 ADP-ribosylation factor-like 4 - 1.80 ± 0.40 Dusp6 Dual specificity phosphatase 6 (Mkp3) - 2.30 ± 0.46 Ksr1 Kinase suppressor of ras 1 1.92 ± 0.42 Lyst Lysosomal trafficking regulator 1.89 ± 0.34 Mapk1ip1 Mitogen activated protein kinase 1 interacting protein 1 1.84 ± 0.22 Narf* Nuclear prelamin A recognition factor 2.12 ± 0.04 Plekha2 Pleckstrin homology domain-containing. family A. (phosphoinosite 2.15 ± 0.22 binding specific) member 2 Ptp4a2 Protein tyrosine phosphatase 4a2 - 2.04 ± 0.94 Rasa2* RAS p21 activator protein 2 - 2.80 ± 0.13 Rassf4 RAS association (RalGDS/AF-6) domain family 4 3.44 ± 2.56 Rgs18 Regulator of G-protein signaling - 1.93 ± 0.57 Rrad Ras-related associated with diabetes 1.81 ± 0.73 Sh3kbp1 SH3 domain kinase bindings protein 1 - 2.19 ± 0.53 Senp2 SUMO/sentrin specific protease 2 - 1.97 ± 0.49 Socs2 Suppressor of cytokine signaling 2 - 2.82 ± 0.85 Socs5 Suppressor of cytokine signaling 5 2.13 ± 0.08 Socs6 Suppressor of cytokine signaling 6 - 2.18 ± 0.38 Spry1 Sprouty 1 - 2.69 ± 0.19 Sos1 Son of sevenless homolog 1 (Drosophila) 2.16 ± 0.71 Ywhag 3-monooxygenase/tryptophan 5- monooxygenase activation protein. - 2.37 ± 1.42 gamma polypeptide Zfyve21 Zinc finger. FYVE domain containing 21 1.93 ± 0.57 Ligands and receptors Bambi BMP and activin membrane-bound inhibitor - 2.94 ± 0.62
  • Functional Roles of Bromodomain Proteins in Cancer

    Functional Roles of Bromodomain Proteins in Cancer

    cancers Review Functional Roles of Bromodomain Proteins in Cancer Samuel P. Boyson 1,2, Cong Gao 3, Kathleen Quinn 2,3, Joseph Boyd 3, Hana Paculova 3 , Seth Frietze 3,4,* and Karen C. Glass 1,2,4,* 1 Department of Pharmaceutical Sciences, Albany College of Pharmacy and Health Sciences, Colchester, VT 05446, USA; [email protected] 2 Department of Pharmacology, Larner College of Medicine, University of Vermont, Burlington, VT 05405, USA; [email protected] 3 Department of Biomedical and Health Sciences, University of Vermont, Burlington, VT 05405, USA; [email protected] (C.G.); [email protected] (J.B.); [email protected] (H.P.) 4 University of Vermont Cancer Center, Burlington, VT 05405, USA * Correspondence: [email protected] (S.F.); [email protected] (K.C.G.) Simple Summary: This review provides an in depth analysis of the role of bromodomain-containing proteins in cancer development. As readers of acetylated lysine on nucleosomal histones, bromod- omain proteins are poised to activate gene expression, and often promote cancer progression. We examined changes in gene expression patterns that are observed in bromodomain-containing proteins and associated with specific cancer types. We also mapped the protein–protein interaction network for the human bromodomain-containing proteins, discuss the cellular roles of these epigenetic regu- lators as part of nine different functional groups, and identify bromodomain-specific mechanisms in cancer development. Lastly, we summarize emerging strategies to target bromodomain proteins in cancer therapy, including those that may be essential for overcoming resistance. Overall, this review provides a timely discussion of the different mechanisms of bromodomain-containing pro- Citation: Boyson, S.P.; Gao, C.; teins in cancer, and an updated assessment of their utility as a therapeutic target for a variety of Quinn, K.; Boyd, J.; Paculova, H.; cancer subtypes.
  • Role of DCP1-DCP2 Complex Regulated by Viral and Host Micrornas in DNA Virus Infection T

    Role of DCP1-DCP2 Complex Regulated by Viral and Host Micrornas in DNA Virus Infection T

    Fish and Shellfish Immunology 92 (2019) 21–30 Contents lists available at ScienceDirect Fish and Shellfish Immunology journal homepage: www.elsevier.com/locate/fsi Full length article Role of DCP1-DCP2 complex regulated by viral and host microRNAs in DNA virus infection T ∗ Yuechao Sun, Xiaobo Zhang College of Life Sciences and Laboratory for Marine Biology and Biotechnology of Qingdao National Laboratory for Marine Science and Technology, Zhejiang University, Hangzhou, 310058, People's Republic of China ARTICLE INFO ABSTRACT Keywords: The DCP1-DCP2 complex can regulate the antiviral immunity of animals by the decapping of retrovirus RNAs DCP1-DCP2 complex and the suppression of RNAi during RNA virus infection. However, the influence of DCP1-DCP2 complex on DNA miRNA virus infection and the regulation of DCP1-DCP2 complex by microRNAs (miRNAs) remain unclear. In this study, DNA virus infection the role of miRNA-regulated DCP1-DCP2 complex in DNA virus infection was characterized. Our results showed that the DCP1-DCP2 complex played a positive role in the infection of white spot syndrome virus (WSSV), a DNA virus of shrimp. In the DCP1-DCP2 complex, the N-terminal regulatory domain of DCP2 was interacted with the EVH1 domain of DCP1. Furthermore, shrimp miRNA miR-87 inhibited WSSV infection by targeting the host DCP2 gene and viral miRNA WSSV-miR-N46 took a negative effect on WSSV replication by targeting the host DCP1 gene. Therefore, our study provided novel insights into the underlying mechanism of DCP1-DCP2 complex and its regulation by miRNAs in virus-host interactions. Importance: During RNA virus infection, the DCP1-DCP2 complex can play important roles in the animal anti- viral immunity by decapping retrovirus RNAs and suppressing RNAi.
  • Splicing Regulatory Factors in Breast Cancer Hallmarks and Disease Progression

    Splicing Regulatory Factors in Breast Cancer Hallmarks and Disease Progression

    www.oncotarget.com Oncotarget, 2019, Vol. 10, (No. 57), pp: 6021-6037 Review Splicing regulatory factors in breast cancer hallmarks and disease progression Esmee Koedoot1, Liesanne Wolters1, Bob van de Water1 and Sylvia E. Le Dévédec1 1Division of Drug Discovery and Safety, LACDR, Leiden University, Leiden, The Netherlands Correspondence to: Sylvia E. Le Dévédec, email: [email protected] Keywords: hallmarks of cancer; breast cancer; alternative splicing; splice factors; RNA sequencing Received: April 23, 2019 Accepted: August 29, 2019 Published: October 15, 2019 Copyright: Koedoot et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License 3.0 (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT By regulating transcript isoform expression levels, alternative splicing provides an additional layer of protein control. Recent studies show evidence that cancer cells use different splicing events to fulfill their requirements in order to develop, progress and metastasize. However, there has been less attention for the role of the complex catalyzing the complicated multistep splicing reaction: the spliceosome. The spliceosome consists of multiple sub-complexes in total comprising 244 proteins or splice factors and 5 associated RNA molecules. Here we discuss the role of splice factors in the oncogenic processes tumors cells need to fulfill their oncogenic properties (the so-called the hallmarks of cancer). Despite the fact that splice factors have been investigated only recently, they seem to play a prominent role in already five hallmarks of cancer: angiogenesis, resisting cell death, sustaining proliferation, deregulating cellular energetics and invasion and metastasis formation by affecting major signaling pathways such as epithelial-to-mesenchymal transition, the Warburg effect, DNA damage response and hormone receptor dependent proliferation.
  • FUSIP1 Polyclonal Antibody Catalog Number PA5-41929 Product Data Sheet

    FUSIP1 Polyclonal Antibody Catalog Number PA5-41929 Product Data Sheet

    Lot Number: A9C701N Website: thermofisher.com Customer Service (US): 1 800 955 6288 ext. 1 Technical Support (US): 1 800 955 6288 ext. 441 thermofisher.com/contactus FUSIP1 Polyclonal Antibody Catalog Number PA5-41929 Product Data Sheet Details Species Reactivity Size 100 µl Tested species reactivity Equine, Guinea Pig, Human, Mouse, Host / Isotype Rabbit IgG Rabbit, Rat Class Polyclonal Tested Applications Dilution * Type Antibody Immunohistochemistry (Paraffin) 4-8 µg/mL (IHC (P)) Immunogen Synthetic peptide directed towards the C-terminal of human FUSIP1 Western Blot (WB) 0.2-1 µg/mL Conjugate Unconjugated * Suggested working dilutions are given as a guide only. It is recommended that the user titrate the product for use in their own experiment using appropriate negative and positive controls. Form Liquid Concentration 0.5mg/mL Purification Affinity Chromatography Storage Buffer PBS with 2% sucrose Contains 0.09% sodium azide Storage Conditions -20° C, Avoid Freeze/Thaw Cycles Product Specific Information Peptide sequence: TDSKTHYKSG SRYEKESRKK EPPRSKSQSR SQSRSRSKSR SRSWTSPKSS Sequence homology: Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% Background/Target Information FUSIP1 is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein can influence splice site selection of adenovirus E1A pre-mRNA. It interacts with the oncoprotein TLS, and abrogates the influence of TLS on E1A pre-mRNA splicing.This gene product is a member of the serine-arginine (SR) family of proteins, which is involved in constitutive and regulated RNA splicing.
  • Enzymatic Encoding Methods for Efficient Synthesis Of

    Enzymatic Encoding Methods for Efficient Synthesis Of

    (19) TZZ__T (11) EP 1 957 644 B1 (12) EUROPEAN PATENT SPECIFICATION (45) Date of publication and mention (51) Int Cl.: of the grant of the patent: C12N 15/10 (2006.01) C12Q 1/68 (2006.01) 01.12.2010 Bulletin 2010/48 C40B 40/06 (2006.01) C40B 50/06 (2006.01) (21) Application number: 06818144.5 (86) International application number: PCT/DK2006/000685 (22) Date of filing: 01.12.2006 (87) International publication number: WO 2007/062664 (07.06.2007 Gazette 2007/23) (54) ENZYMATIC ENCODING METHODS FOR EFFICIENT SYNTHESIS OF LARGE LIBRARIES ENZYMVERMITTELNDE KODIERUNGSMETHODEN FÜR EINE EFFIZIENTE SYNTHESE VON GROSSEN BIBLIOTHEKEN PROCEDES DE CODAGE ENZYMATIQUE DESTINES A LA SYNTHESE EFFICACE DE BIBLIOTHEQUES IMPORTANTES (84) Designated Contracting States: • GOLDBECH, Anne AT BE BG CH CY CZ DE DK EE ES FI FR GB GR DK-2200 Copenhagen N (DK) HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI • DE LEON, Daen SK TR DK-2300 Copenhagen S (DK) Designated Extension States: • KALDOR, Ditte Kievsmose AL BA HR MK RS DK-2880 Bagsvaerd (DK) • SLØK, Frank Abilgaard (30) Priority: 01.12.2005 DK 200501704 DK-3450 Allerød (DK) 02.12.2005 US 741490 P • HUSEMOEN, Birgitte Nystrup DK-2500 Valby (DK) (43) Date of publication of application: • DOLBERG, Johannes 20.08.2008 Bulletin 2008/34 DK-1674 Copenhagen V (DK) • JENSEN, Kim Birkebæk (73) Proprietor: Nuevolution A/S DK-2610 Rødovre (DK) 2100 Copenhagen 0 (DK) • PETERSEN, Lene DK-2100 Copenhagen Ø (DK) (72) Inventors: • NØRREGAARD-MADSEN, Mads • FRANCH, Thomas DK-3460 Birkerød (DK) DK-3070 Snekkersten (DK) • GODSKESEN,
  • A Systematic Review on the Implications of O-Linked Glycan Branching and Truncating Enzymes on Cancer Progression and Metastasis

    A Systematic Review on the Implications of O-Linked Glycan Branching and Truncating Enzymes on Cancer Progression and Metastasis

    cells Review A Systematic Review on the Implications of O-linked Glycan Branching and Truncating Enzymes on Cancer Progression and Metastasis 1, 1, 1 1,2,3, Rohitesh Gupta y, Frank Leon y, Sanchita Rauth , Surinder K. Batra * and Moorthy P. Ponnusamy 1,2,* 1 Department of Biochemistry and Molecular Biology, University of Nebraska Medical Center, Omaha, NE 68105, USA; [email protected] (R.G.); [email protected] (F.L.); [email protected] (S.R.) 2 Fred and Pamela Buffett Cancer Center, Eppley Institute for Research in Cancer and Allied Diseases, University of Nebraska Medical Center, Omaha, NE 681980-5900, USA 3 Department of Pathology and Microbiology, UNMC, Omaha, NE 68198-5900, USA * Correspondence: [email protected] (S.K.B.); [email protected] (M.P.P.); Tel.: +402-559-5455 (S.K.B.); +402-559-1170 (M.P.P.); Fax: +402-559-6650 (S.K.B. & M.P.P.) Equal contribution. y Received: 21 January 2020; Accepted: 12 February 2020; Published: 14 February 2020 Abstract: Glycosylation is the most commonly occurring post-translational modifications, and is believed to modify over 50% of all proteins. The process of glycan modification is directed by different glycosyltransferases, depending on the cell in which it is expressed. These small carbohydrate molecules consist of multiple glycan families that facilitate cell–cell interactions, protein interactions, and downstream signaling. An alteration of several types of O-glycan core structures have been implicated in multiple cancers, largely due to differential glycosyltransferase expression or activity. Consequently, aberrant O-linked glycosylation has been extensively demonstrated to affect biological function and protein integrity that directly result in cancer growth and progression of several diseases.
  • FUSIP1 (SRSF10) (NM 006625) Human Tagged ORF Clone Product Data

    FUSIP1 (SRSF10) (NM 006625) Human Tagged ORF Clone Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC221759 FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: FUSIP1 (SRSF10) (NM_006625) Human Tagged ORF Clone Tag: Myc-DDK Symbol: SRSF10 Synonyms: FUSIP1; FUSIP2; NSSR; PPP1R149; SFRS13; SFRS13A; SRp38; SRrp40; TASR; TASR1; TASR2 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC221759 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCCCGCTACCTGCGTCCCCCCAACACGTCTCTGTTCGTCAGGAACGTGGCCGACGACACCAGGTCTG AAGACTTGCGGCGTGAATTTGGTCGTTATGGTCCTATAGTTGATGTGTATGTTCCACTTGATTTCTACAC TCGCCGTCCAAGAGGATTTGCTTATGTTCAATTTGAGGATGTTCGTGATGCTGAAGACGCTTTACATAAT TTGGACAGAAAGTGGATTTGTGGACGGCAGATTGAAATACAGTTTGCCCAGGGGGATCGAAAGACACCAA ATCAGATGAAAGCCAAGGAAGGGAGGAATGTGTACAGTTCTTCACGCTATGATGATTATGACAGATACAG ACGTTCTAGAAGCCGAAGTTATGAAAGGAGGAGATCAAGAAGTCGGTCTTTTGATTACAACTATAGAAGA TCGTATAGTCCTAGAAACAGTAGACCGACTGGAAGACCACGGCGTAGCAGAAGCCATTCCGACAATGATA GACCAAACTGCAGCTGGAATACCCAGTACAGTTCTGCTTACTACACTTCAAGAAAGATC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC221759 protein sequence Red=Cloning site Green=Tags(s) MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • Ubiquitylome Profiling of Parkin-Null Brain Reveals Dysregulation Of

    Ubiquitylome Profiling of Parkin-Null Brain Reveals Dysregulation Of

    Neurobiology of Disease 127 (2019) 114–130 Contents lists available at ScienceDirect Neurobiology of Disease journal homepage: www.elsevier.com/locate/ynbdi Ubiquitylome profiling of Parkin-null brain reveals dysregulation of calcium T homeostasis factors ATP1A2, Hippocalcin and GNA11, reflected by altered firing of noradrenergic neurons Key J.a,1, Mueller A.K.b,1, Gispert S.a, Matschke L.b, Wittig I.c, Corti O.d,e,f,g, Münch C.h, ⁎ ⁎ Decher N.b, , Auburger G.a, a Exp. Neurology, Goethe University Medical School, 60590 Frankfurt am Main, Germany b Institute for Physiology and Pathophysiology, Vegetative Physiology and Marburg Center for Mind, Brain and Behavior - MCMBB; Clinic for Neurology, Philipps-University Marburg, 35037 Marburg, Germany c Functional Proteomics, SFB 815 Core Unit, Goethe University Medical School, 60590 Frankfurt am Main, Germany d Institut du Cerveau et de la Moelle épinière, ICM, Paris, F-75013, France e Inserm, U1127, Paris, F-75013, France f CNRS, UMR 7225, Paris, F-75013, France g Sorbonne Universités, Paris, F-75013, France h Institute of Biochemistry II, Goethe University Medical School, 60590 Frankfurt am Main, Germany ARTICLE INFO ABSTRACT Keywords: Parkinson's disease (PD) is the second most frequent neurodegenerative disorder in the old population. Among Parkinson's disease its monogenic variants, a frequent cause is a mutation in the Parkin gene (Prkn). Deficient function of Parkin Mitochondria triggers ubiquitous mitochondrial dysfunction and inflammation in the brain, but it remains unclear howse- Parkin lective neural circuits become vulnerable and finally undergo atrophy. Ubiquitin We attempted to go beyond previous work, mostly done in peripheral tumor cells, which identified protein Calcium targets of Parkin activity, an ubiquitin E3 ligase.