DOCSLIB.ORG

UBE2C Is Upregulated by Estrogen and Promotes Epithelial–Mesenchymal Transition Via P53 in Endometrial Cancer

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
UBE2C Is Upregulated by Estrogen and Promotes Epithelial–Mesenchymal Transition Via P53 in Endometrial Cancer Published OnlineFirst October 29, 2019; DOI: 10.1158/1541-7786.MCR-19-0561 MOLECULAR CANCER RESEARCH | CANCER GENES AND NETWORKS UBE2C Is Upregulated by Estrogen and Promotes Epithelial–Mesenchymal Transition via p53 in Endometrial Cancer Yan Liu1, Rong Zhao1, Shuqi Chi1, Wei Zhang1, Chengyu Xiao1, Xing Zhou1, Yingchao Zhao2, and Hongbo Wang1 ABSTRACT ◥ Ubiquitin-conjugating enzyme E2C (UBE2C) plays important inhibited endometrial cancer cell proliferation, migration, invasion, roles in tumor progression; nevertheless, its function in endometrial and epithelial–mesenchymal transition (EMT), whereas UBE2C cancer remains unclear. This study elucidated the impact of UBE2C overexpression exerted the opposite effects. UBE2C downregulation on endometrial cancer and its underlying mechanism. Human increased p53 and its downstream p21 expression, with p53 over- endometrial cancer and normal endometrial tissues were acquired expression reversing the EMT-promoting effects of UBE2C. UBE2C from patients at Wuhan Union Hospital and UBE2C expression was enhanced p53 ubiquitination to facilitate its degradation in endo- detected by Western blotting and qRT-PCR. Endometrial cancer metrial cancer cells. Estradiol (E2) induced UBE2C expression via cells were transfected with a UBE2C overexpression plasmid or estrogen receptor a, which binds directly to the UBE2C promoter UBE2C-specific short hairpin RNA (shRNA) to up- or downregu- element. Silencing of UBE2C inhibited E2-promoted migration, late UBE2C expression, respectively. CCK8 and transwell assays invasion, and EMT in vitro and in vivo. were applied to assess the effects of UBE2C on cell proliferation, migration, and invasion. We found a significant elevation of UBE2C Implications: UBE2C-mediated tumor EMT promotion by estro- expression in patients with endometrial cancer, and that UBE2C gen is a novel mechanism for the progression of estrogen-induced upregulation was associated with advanced histologic grade, FIGO endometrial cancer, which could offer new biomarkers for diagnosis stage, recurrence, and shorter overall survival. UBE2C knockdown and therapy of endometrial cancer in the future. Introduction upregulation or downregulation (7, 8). Studies of multiple cellular models have shown that estrogen receptor (ER) a may be involved Endometrial cancer is one of the most universal gynecologic in regulating endometrial cancer cell proliferation, invasion, and malignant tumors worldwide, and its incidence is increasing rapidly, apoptosis (9–11). Classically, ERa has been identified as a tran- with approximately 382,000 new cases in 2018 (1). In China, the scription factor that regulates estrogen-related molecular expres- number of deaths from endometrial cancer is rising, with endometrial sion and biological functions, through binding with estrogen cancer now the second most common gynecologic malignancy after response elements in the promoter of target genes. Numerous cervical carcinoma (2). The 5-year survival rate for patients with early- studies have concentrated on the mechanisms of estrogen-driven stage endometrial cancer is around 80% after standard surgery, endometrial tumorigenesis, revealing that estrogen enhances the chemotherapy, and radiotherapy (3, 4); however, the prognosis for ability of cell proliferation, invasion, and epithelial–mesenchymal those with advanced endometrial cancer remains poor (5, 6). Thus, it is transition (EMT) in endometrial cancer (12, 13). Moreover, estro- essential to find new diagnostic and prognostic markers for endome- gen can downregulate the expression of important cancer suppres- trial cancer and to further understand its molecular mechanisms sor gene, such as PTEN (8). underlying its progression. p53 is thought to be an important tumor suppressor that The important role of estrogen in endometrial cancer develop- influences multiple crucial biological processes, including apopto- ment and progression is supported by studies showing that nuclear sis, cell-cycle arrest, and DNA repair (14). More than 60% of transcription factors activation leads to related gene expression patients with endometrial cancer develop TP53 mutations (15, 16); mutant p53 proteins may not only abolish their tumor-suppressive functions, but also acquire oncogenic functions (17, 18). Endome- 1 Department of Obstetrics and Gynecology, Union Hospital, Tongji Medical trial tissues from the majority of patients with endometrial cancer College, Huazhong University of Science and Technology, Wuhan 430022, stain positive for p53 protein, which is largely attributed to mutant China. 2Cancer Center, Union Hospital, Tongji Medical College, Huazhong University of Science and Technology, Wuhan 430022, China. p53, whereas wild-type (WT) p53 expression becomes undetect- able (19). Thus, reactivation of p53 signaling is a striking strategy Note: Supplementary data for this article are available at Molecular Cancer for pharmaceutically interfering with tumor initiation and progres- Research Online (http://mcr.aacrjournals.org/). sion; yet, the mechanisms underlying p53 downregulation in endo- Corresponding Authors: Hongbo Wang, Union Hospital, Tongji Medical College, metrial cancer remain elusive. Huazhong University of Science and Technology, Wuhan 430022, China. Phone: 8615-0710-53765; E-mail: [email protected]; and Yingchao Zhao, Members of the ubiquitin-conjugating enzyme E2 (UBE2) protein [email protected] family are ubiquitin-related enzymes that determine ubiquitin chain topologyandcatalyzethe degradation ofseveraltarget proteins(20,21). Mol Cancer Res 2019;XX:XX–XX Their importance in tumorigenesis has been revealed by a series doi: 10.1158/1541-7786.MCR-19-0561 of studies. UBE2S was found to be involved in lung adenocarcinoma Ó2019 American Association for Cancer Research. and hepatocellular carcinoma by regulating the p53 signaling AACRJournals.org | OF1 Downloaded from mcr.aacrjournals.org on October 2, 2021. © 2019 American Association for Cancer Research. Published OnlineFirst October 29, 2019; DOI: 10.1158/1541-7786.MCR-19-0561 Liu et al. pathway (22, 23), while UBE2D1, UBE2B, UBE2V1, and UBE2Q1 were gcGFP-IRES-puromycin vectors were used separately as control plas- shown to be involved in hepatocellular carcinoma, nasopharyngeal mids. The effective UBE2C-shRNA sequences were: shUBE2C-1, 50- carcinoma, and colorectal cancer (24–27) by regulating oncogenes or TGC AAG AAA CCT ACT CAA A-30; and shUBE2C-4, 50-TCT GGC tumor suppressors. This demonstrates the key roles of the UBE2 family GAT AAA GGG ATT T-30. Cells were transfected with the UBE2C in tumorigenesis. One UBE2 family member, UBE2C, has been overexpression plasmids or shRNA with Lipofectamine 2000 (Invi- implicated as a candidate oncogene in cancer progression, autophagy, trogen) and stable cell lines were obtained after 2 weeks of G418 or and drug resistance (28–31); however, its role in endometrial cancer puromycin screening. The p53, ESR1 overexpression plasmids, and and its underlying mechanisms are not fully elucidated. p53 shRNA were transiently transfected using Lipofectamine 2000. This study aimed to elucidate the role of UBE2C in endometrial Forty-eight hours after transfection, the cells were harvested for cancer by investigating its expression levels in endometrial cancer, Western blot analyses. association with patient prognosis, and effects on endometrial cancer cell migration, invasion, and EMT. In addition, we identified UBE2C as Western blot analysis an estrogen-induced mRNA that affects endometrial cancer in an Endometrial cancer samples or cells with indicated treatments were ERa-dependent manner. Our findings shed light on the relationship lysed using RIPA (Beyotime) with 1 mmol/L PMSF (MedChem between UBE2C and endometrial cancer, and contribute toward the Express) and a protease Cocktail Inhibitor (Pierce) at 4C for 30 development of new biomarkers for the diagnosis and treatment of minutes. The cells were subsequently collected by scraping, followed endometrial cancer. by centrifugation at 12,000 rpm for 15 minutes. The supernatant was harvested and the protein concentration was measured using a BCA Assay Kit (Beyotime). Protein samples were fractionated by SDS- Materials and Methods PAGE, transferred onto a polyvinylidene difluoride membrane (Milli- Human tissue samples and database pore) followed by incubation overnight at 4C with primary antibodies Human endometrial cancer and benign endometrial tissues specific to UBE2C (1:1,000, ABclonal), p53 (1:200, Santa Cruz Bio- were harvested from patients at Wuhan Union Hospital, Tongji technology), p21 (1:1,000, ABclonal), ERa (1:1,000, ABclonal), E- Medical College, Huazhong University of Science and Technology cadherin (1:200, Santa Cruz Biotechnology), Vimentin (1:200, Santa (Wuhan, China). Tissue samples were collected surgically, imme- Cruz Biotechnology), or GAPDH (1:10,000, Proteintech). After incu- diately deposited in liquid nitrogen until total RNA and protein bation with horseradish peroxidase (HRP)-conjugated secondary extraction. Two pathologists assessed all specimens in-line with the antibodies (1:8,000, Affinity), immune complexes were detected using World Health Organization guidelines. All experiments were enhanced chemiluminescence detection reagents (Thermo Fisher approved by the Institutional Review Board of the Tongji Medical Scientific) on Image Lab Software in Molecular Imager ChemiDoc College, Huazhong University of Science and Technology. All XRSþ (Bio-Rad). subjects have read written informed consent. Uterine corpus endo-
Load more

Recommended publications
  • The Effect of Temperature Adaptation on the Ubiquitin–Proteasome Pathway in Notothenioid Fishes Anne E
    © 2017. Published by The Company of Biologists Ltd | Journal of Experimental Biology (2017) 220, 369-378 doi:10.1242/jeb.145946 RESEARCH ARTICLE The effect of temperature adaptation on the ubiquitin–proteasome pathway in notothenioid fishes Anne E. Todgham1,*, Timothy A. Crombie2 and Gretchen E. Hofmann3 ABSTRACT proliferation to compensate for the effects of low temperature on ’ There is an accumulating body of evidence suggesting that the sub- aerobic metabolism (Johnston, 1989; O Brien et al., 2003; zero Antarctic marine environment places physiological constraints Guderley, 2004). Recently, there has been an accumulating body – on protein homeostasis. Levels of ubiquitin (Ub)-conjugated proteins, of literature to suggest that protein homeostasis the maintenance of – 20S proteasome activity and mRNA expression of many proteins a functional protein pool has been highly impacted by evolution involved in both the Ub tagging of damaged proteins as well as the under these cold and stable conditions. different complexes of the 26S proteasome were measured to Maintaining protein homeostasis is a fundamental physiological examine whether there is thermal compensation of the Ub– process, reflecting a dynamic balance in synthetic and degradation proteasome pathway in Antarctic fishes to better understand the processes. There are numerous lines of evidence to suggest efficiency of the protein degradation machinery in polar species. Both temperature compensation of protein synthesis in Antarctic Antarctic (Trematomus bernacchii, Pagothenia borchgrevinki)and invertebrates (Whiteley et al., 1996; Marsh et al., 2001; Robertson non-Antarctic (Notothenia angustata, Bovichtus variegatus) et al., 2001; Fraser et al., 2002) and fish (Storch et al., 2005). In notothenioids were included in this study to investigate the zoarcid fishes, it has been demonstrated that Antarctic eelpouts mechanisms of cold adaptation of this pathway in polar species.
    [Show full text]
  • Ubiquitin-Conjugating Enzyme UBE2J1 Negatively Modulates
    Feng et al. Virology Journal (2018) 15:132 https://doi.org/10.1186/s12985-018-1040-5 RESEARCH Open Access Ubiquitin-conjugating enzyme UBE2J1 negatively modulates interferon pathway and promotes RNA virus infection Tingting Feng1, Lei Deng1, Xiaochuan Lu1, Wen Pan1, Qihan Wu2* and Jianfeng Dai1,2* Abstract Background: Viral infection activates innate immune pathways and interferons (IFNs) play a pivotal role in the outcome of a viral infection. Ubiquitin modifications of host and viral proteins significantly influence the progress of virus infection. Ubiquitin-conjugating enzyme E2s (UBE2) have the capacity to determine ubiquitin chain topology and emerge as key mediators of chain assembly. Methods: In this study, we screened the functions of 34 E2 genes using an RNAi library during Dengue virus (DENV) infection. RNAi and gene overexpression approaches were used to study the gene function in viral infection and interferon signaling. Results: We found that silencing UBE2J1 significantly impaired DENV infection, while overexpression of UBE2J1 enhanced DENV infection. Further studies suggested that type I IFN expression was significantly increased in UBE2J1 silenced cells and decreased in UBE2J1 overexpressed cells. Reporter assay suggested that overexpression of UBE2J1 dramatically suppressed RIG-I directed IFNβ promoter activation. Finally, we have confirmed that UBE2J1 can facilitate the ubiquitination and degradation of transcription factor IFN regulatory factor 3 (IRF3). Conclusion: These results suggest that UBE2 family member UBE2J1 can negatively regulate type I IFN expression, thereby promote RNA virus infection. Keywords: UBE2J1, Dengue virus, Interferons, IRF3, K48 ubiquitination Background antiviral responses [3]. IFN-α/β regulates the synthesis Dengue virus (DENV), transmitted by Aedes aegypti and of antiviral proteins and immunoregulatory factors Aedes albopicuts, causes an emerging tropical disease through the JAK/STAT signaling pathway [4, 5].
    [Show full text]
  • A Drosophila Ortholog of the Human Cylindromatosis Tumor Suppressor
    RESEARCH ARTICLE 2605 Development 134, 2605-2614 (2007) doi:10.1242/dev.02859 A Drosophila ortholog of the human cylindromatosis tumor suppressor gene regulates triglyceride content and antibacterial defense Theodore Tsichritzis1, Peer C. Gaentzsch3, Stylianos Kosmidis2, Anthony E. Brown3, Efthimios M. Skoulakis2, Petros Ligoxygakis3,* and George Mosialos1,4,* The cylindromatosis (CYLD) gene is mutated in human tumors of skin appendages. It encodes a deubiquitylating enzyme (CYLD) that is a negative regulator of the NF-␬B and JNK signaling pathways, in vitro. However, the tissue-specific function and regulation of CYLD in vivo are poorly understood. We established a genetically tractable animal model to initiate a systematic investigation of these issues by characterizing an ortholog of CYLD in Drosophila. Drosophila CYLD is broadly expressed during development and, in adult animals, is localized in the fat body, ovaries, testes, digestive tract and specific areas of the nervous system. We demonstrate that the protein product of Drosophila CYLD (CYLD), like its mammalian counterpart, is a deubiquitylating enzyme. Impairment of CYLD expression is associated with altered fat body morphology in adult flies, increased triglyceride levels and increased survival under starvation conditions. Furthermore, flies with compromised CYLD expression exhibited reduced resistance to bacterial infections. All mutant phenotypes described were reversible upon conditional expression of CYLD transgenes. Our results implicate CYLD in a broad range of functions associated with fat homeostasis and host defence in Drosophila. KEY WORDS: Cylindromatosis, Drosophila, Fat body, Host defense, NF-kappaB INTRODUCTION disease and it is required for the proper development of T Familial cylindromatosis is an autosomal-dominant predisposition lymphocytes in mice (Costello et al., 2005; Reiley et al., 2006).
    [Show full text]
  • Defining Functional Interactions During Biogenesis of Epithelial Junctions
    ARTICLE Received 11 Dec 2015 | Accepted 13 Oct 2016 | Published 6 Dec 2016 | Updated 5 Jan 2017 DOI: 10.1038/ncomms13542 OPEN Defining functional interactions during biogenesis of epithelial junctions J.C. Erasmus1,*, S. Bruche1,*,w, L. Pizarro1,2,*, N. Maimari1,3,*, T. Poggioli1,w, C. Tomlinson4,J.Lees5, I. Zalivina1,w, A. Wheeler1,w, A. Alberts6, A. Russo2 & V.M.M. Braga1 In spite of extensive recent progress, a comprehensive understanding of how actin cytoskeleton remodelling supports stable junctions remains to be established. Here we design a platform that integrates actin functions with optimized phenotypic clustering and identify new cytoskeletal proteins, their functional hierarchy and pathways that modulate E-cadherin adhesion. Depletion of EEF1A, an actin bundling protein, increases E-cadherin levels at junctions without a corresponding reinforcement of cell–cell contacts. This unexpected result reflects a more dynamic and mobile junctional actin in EEF1A-depleted cells. A partner for EEF1A in cadherin contact maintenance is the formin DIAPH2, which interacts with EEF1A. In contrast, depletion of either the endocytic regulator TRIP10 or the Rho GTPase activator VAV2 reduces E-cadherin levels at junctions. TRIP10 binds to and requires VAV2 function for its junctional localization. Overall, we present new conceptual insights on junction stabilization, which integrate known and novel pathways with impact for epithelial morphogenesis, homeostasis and diseases. 1 National Heart and Lung Institute, Faculty of Medicine, Imperial College London, London SW7 2AZ, UK. 2 Computing Department, Imperial College London, London SW7 2AZ, UK. 3 Bioengineering Department, Faculty of Engineering, Imperial College London, London SW7 2AZ, UK. 4 Department of Surgery & Cancer, Faculty of Medicine, Imperial College London, London SW7 2AZ, UK.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • UBE2E1 (Ubch6) [Untagged] E2 – Ubiquitin Conjugating Enzyme
    UBE2E1 (UbcH6) [untagged] E2 – Ubiquitin Conjugating Enzyme Alternate Names: UbcH6, UbcH6, Ubiquitin conjugating enzyme UbcH6 Cat. No. 62-0019-100 Quantity: 100 µg Lot. No. 1462 Storage: -70˚C FOR RESEARCH USE ONLY NOT FOR USE IN HUMANS CERTIFICATE OF ANALYSIS Page 1 of 2 Background Physical Characteristics The enzymes of the ubiquitylation Species: human Protein Sequence: pathway play a pivotal role in a num- GPLGSPGIPGSTRAAAM SDDDSRAST ber of cellular processes including Source: E. coli expression SSSSSSSSNQQTEKETNTPKKKESKVSMSKN regulated and targeted proteasomal SKLLSTSAKRIQKELADITLDPPPNCSAGP degradation of substrate proteins. Quantity: 100 μg KGDNIYEWRSTILGPPGSVYEGGVFFLDIT FTPEYPFKPPKVTFRTRIYHCNINSQGVI Three classes of enzymes are in- Concentration: 1 mg/ml CLDILKDNWSPALTISKVLLSICSLLTDCNPAD volved in the process of ubiquitylation; PLVGSIATQYMTNRAEHDRMARQWTKRYAT activating enzymes (E1s), conjugating Formulation: 50 mM HEPES pH 7.5, enzymes (E2s) and protein ligases 150 mM sodium chloride, 2 mM The residues underlined remain after cleavage and removal (E3s). UBE2E1 is a member of the E2 dithiothreitol, 10% glycerol of the purification tag. ubiquitin-conjugating enzyme family UBE2E1 (regular text): Start bold italics (amino acid and cloning of the human gene was Molecular Weight: ~23 kDa residues 1-193) Accession number: AAH09139 first described by Nuber et al. (1996). UBE2E1 shares 74% sequence ho- Purity: >98% by InstantBlue™ SDS-PAGE mology with UBE2D1 and contains an Stability/Storage: 12 months at -70˚C; N-terminal extension of approximately aliquot as required 40 amino acids. A tumour suppressor candidate, tumour-suppressing sub- chromosomal transferable fragment Quality Assurance cDNA (TSSC5) is located in the re- gion of human chromosome 11p15.5 Purity: Protein Identification: linked with Beckwith-Wiedemann syn- 4-12% gradient SDS-PAGE Confirmed by mass spectrometry.
    [Show full text]
  • Gain of UBE2D1 Facilitates Hepatocellular Carcinoma
    Zhou et al. Journal of Experimental & Clinical Cancer Research (2018) 37:290 https://doi.org/10.1186/s13046-018-0951-8 RESEARCH Open Access Gain of UBE2D1 facilitates hepatocellular carcinoma progression and is associated with DNA damage caused by continuous IL-6 Chuanchuan Zhou1,2, Fengrui Bi1, Jihang Yuan1, Fu Yang1 and Shuhan Sun1* Abstract Background: Hepatocellular carcinoma (HCC) is the most common type of liver cancer with increasing incidence and poor prognosis. Ubiquitination regulators are reported to play crucial roles in HCC carcinogenesis. UBE2D1, one of family member of E2 ubiquitin conjugating enzyme, mediates the ubiquitination and degradation of tumor suppressor protein p53. However, the expression and functional roles of UBE2D1 in HCC was unknown. Methods: Immunohistochemistry (IHC), western blotting, and real-time PCR were used to detect the protein, transcription and genomic levels of UBE2D1 in HCC tissues with paired nontumor tissues, precancerous lesions and hepatitis liver tissues. Four HCC cell lines and two immortalized hepatic cell lines were used to evaluate the functional roles and underlying mechanisms of UBE2D1 in HCC initiation and progression in vitro and in vivo. The contributors to UBE2D1 genomic amplification were first evaluated by performing a correlation analysis between UBE2D1 genomic levels with clinical data of HCC patients, and then evaluated in HCC and hepatic cell lines. Results: Expression of UBE2D1 was significantly increased in HCC tissues and precancerous lesions and was associated with reduced survival of HCC patients. Upregulation of UBE2D1 promoted HCC growth in vitro and in vivo by decreasing the p53 in ubiquitination-dependent pathway. High expression of UBE2D1 was attributed to the recurrent genomic copy number gain, which was associated with high serum IL-6 level of HCC patients.
    [Show full text]
  • The Ubiquitination Enzymes of Leishmania Mexicana
    The ubiquitination enzymes of Leishmania mexicana Rebecca Jayne Burge Doctor of Philosophy University of York Biology October 2020 Abstract Post-translational modifications such as ubiquitination are important for orchestrating the cellular transformations that occur as the Leishmania parasite differentiates between its main morphological forms, the promastigote and amastigote. Although 20 deubiquitinating enzymes (DUBs) have been partially characterised in Leishmania mexicana, little is known about the role of E1 ubiquitin-activating (E1), E2 ubiquitin- conjugating (E2) and E3 ubiquitin ligase (E3) enzymes in this parasite. Using bioinformatic methods, 2 E1, 13 E2 and 79 E3 genes were identified in the L. mexicana genome. Subsequently, bar-seq analysis of 23 E1, E2 and HECT/RBR E3 null mutants generated in promastigotes using CRISPR-Cas9 revealed that the E2s UBC1/CDC34, UBC2 and UEV1 and the HECT E3 ligase HECT2 are required for successful promastigote to amastigote differentiation and UBA1b, UBC9, UBC14, HECT7 and HECT11 are required for normal proliferation during mouse infection. Null mutants could not be generated for the E1 UBA1a or the E2s UBC3, UBC7, UBC12 and UBC13, suggesting these genes are essential in promastigotes. X-ray crystal structure analysis of UBC2 and UEV1, orthologues of human UBE2N and UBE2V1/UBE2V2 respectively, revealed a heterodimer with a highly conserved structure and interface. Furthermore, recombinant L. mexicana UBA1a was found to load ubiquitin onto UBC2, allowing UBC2- UEV1 to form K63-linked di-ubiquitin chains in vitro. UBC2 was also shown to cooperate with human E3s RNF8 and BIRC2 in vitro to form non-K63-linked polyubiquitin chains, but association of UBC2 with UEV1 inhibits this ability.
    [Show full text]
  • Supplementary Tables
    Supplementary Tables Supplementary Table S1: Preselected miRNAs used in feature selection Univariate Cox proportional hazards regression analysis of the endpoint freedom from recurrence in the training set (DKTK-ROG sample) allowed the pre-selection of 524 miRNAs (P< 0.5), which were used in the feature selection. P-value was derived from log-rank test. miRNA p-value miRNA p-value miRNA p-value miRNA p-value hsa-let-7g-3p 0.0001520 hsa-miR-1304-3p 0.0490161 hsa-miR-7108-5p 0.1263245 hsa-miR-6865-5p 0.2073121 hsa-miR-6825-3p 0.0004257 hsa-miR-4298 0.0506194 hsa-miR-4453 0.1270967 hsa-miR-6893-5p 0.2120664 hsa-miR-668-3p 0.0005188 hsa-miR-484 0.0518625 hsa-miR-200a-5p 0.1276345 hsa-miR-25-3p 0.2123829 hsa-miR-3622b-3p 0.0005885 hsa-miR-6851-3p 0.0531446 hsa-miR-6090 0.1278692 hsa-miR-3189-5p 0.2136060 hsa-miR-6885-3p 0.0006452 hsa-miR-1276 0.0557418 hsa-miR-148b-3p 0.1279811 hsa-miR-6073 0.2139702 hsa-miR-6875-3p 0.0008188 hsa-miR-3173-3p 0.0559962 hsa-miR-4425 0.1288330 hsa-miR-765 0.2141536 hsa-miR-487b-5p 0.0011381 hsa-miR-650 0.0564616 hsa-miR-6798-3p 0.1293342 hsa-miR-338-5p 0.2153079 hsa-miR-210-5p 0.0012316 hsa-miR-6133 0.0571407 hsa-miR-4472 0.1300006 hsa-miR-6806-5p 0.2173515 hsa-miR-1470 0.0012822 hsa-miR-4701-5p 0.0571720 hsa-miR-4465 0.1304841 hsa-miR-98-5p 0.2184947 hsa-miR-6890-3p 0.0016539 hsa-miR-202-3p 0.0575741 hsa-miR-514b-5p 0.1308790 hsa-miR-500a-3p 0.2185577 hsa-miR-6511b-3p 0.0017165 hsa-miR-4733-5p 0.0616138 hsa-miR-378c 0.1317442 hsa-miR-4515 0.2187539 hsa-miR-7109-3p 0.0021381 hsa-miR-595 0.0629350 hsa-miR-3121-3p
    [Show full text]
  • RNF11 at the Crossroads of Protein Ubiquitination
    biomolecules Review RNF11 at the Crossroads of Protein Ubiquitination Anna Mattioni, Luisa Castagnoli and Elena Santonico * Department of Biology, University of Rome Tor Vergata, Via della ricerca scientifica, 00133 Rome, Italy; [email protected] (A.M.); [email protected] (L.C.) * Correspondence: [email protected] Received: 29 September 2020; Accepted: 8 November 2020; Published: 11 November 2020 Abstract: RNF11 (Ring Finger Protein 11) is a 154 amino-acid long protein that contains a RING-H2 domain, whose sequence has remained substantially unchanged throughout vertebrate evolution. RNF11 has drawn attention as a modulator of protein degradation by HECT E3 ligases. Indeed, the large number of substrates that are regulated by HECT ligases, such as ITCH, SMURF1/2, WWP1/2, and NEDD4, and their role in turning off the signaling by ubiquitin-mediated degradation, candidates RNF11 as the master regulator of a plethora of signaling pathways. Starting from the analysis of the primary sequence motifs and from the list of RNF11 protein partners, we summarize the evidence implicating RNF11 as an important player in modulating ubiquitin-regulated processes that are involved in transforming growth factor beta (TGF-β), nuclear factor-κB (NF-κB), and Epidermal Growth Factor (EGF) signaling pathways. This connection appears to be particularly significant, since RNF11 is overexpressed in several tumors, even though its role as tumor growth inhibitor or promoter is still controversial. The review highlights the different facets and peculiarities of this unconventional small RING-E3 ligase and its implication in tumorigenesis, invasion, neuroinflammation, and cancer metastasis. Keywords: Ring Finger Protein 11; HECT ligases; ubiquitination 1.
    [Show full text]
  • UBE2B Sirna Set I Sirna Duplexes Targeted Against Three Exon Regions
    Catalog # Aliquot Size U211-911-05 3 x 5 nmol U211-911-20 3 x 20 nmol U211-911-50 3 x 50 nmol UBE2B siRNA Set I siRNA duplexes targeted against three exon regions Catalog # U211-911 Lot # Z2109-16 Specificity Formulation UBE2B siRNAs are designed to specifically knock-down The siRNAs are supplied as a lyophilized powder and human UBE2B expression. shipped at room temperature. Product Description Reconstitution Protocol UBE2B siRNA is a pool of three individual synthetic siRNA Briefly centrifuge the tubes (maximum RCF 4,000g) to duplexes designed to knock-down human UBE2B mRNA collect lyophilized siRNA at the bottom of the tube. expression. Each siRNA is 19-25 bases in length. The gene Resuspend the siRNA in 50 µl of DEPC-treated water accession number is NM_003337. (supplied by researcher), which results in a 1x stock solution (10 µM). Gently pipet the solution 3-5 times to mix Gene Aliases and avoid the introduction of bubbles. Optional: aliquot E2-17kDa; HHR6B; HR6B; RAD6B; UBC2 1x stock solutions for storage. Storage and Stability Related Products The lyophilized powder is stable for at least 4 weeks at room temperature. It is recommended that the Product Name Catalog Number lyophilized and resuspended siRNAs are stored at or UBE2A Protein U210-30H below -20oC. After resuspension, siRNA stock solutions ≥2 UBE2B Protein U211-30H µM can undergo up to 50 freeze-thaw cycles without UBE2C Protein U212-30H significant degradation. For long-term storage, it is UBE2D1 (UBCH5A) U213-30H recommended that the siRNA is stored at -70oC. For most Protein favorable performance, avoid repeated handling and UBE2D2 (UBC4) Protein U214-30H multiple freeze/thaw cycles.
    [Show full text]
  • The X-Linked Intellectual Disability Gene Product and E3 Ubiquitin Ligase KLHL15 Degrades Doublecortin Proteins to Constrain Neuronal Dendritogenesis
    bioRxiv preprint doi: https://doi.org/10.1101/2020.10.02.324285; this version posted October 2, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. KLHL15 degrades doublecortin proteins The X-linked intellectual disability gene product and E3 ubiquitin ligase KLHL15 degrades doublecortin proteins to constrain neuronal dendritogenesis Jianing Song1,2, Ronald A. Merrill1,2, Andrew Y. Usachev1, and Stefan Strack1* From the 1Department of Neuroscience and Pharmacology and the Iowa Neuroscience Institute, University of Iowa, Iowa City, Iowa 52242 2 These authors contributed equally to the work. *To whom correspondence should be addressed: Stefan Strack: Dept. of Neuroscience and Pharmacology, The University of Iowa, Iowa City, IA 52242; [email protected]; Tel. (319) 384-4439; Fax. (319) 335-8930 Running Title: KLHL15 degrades doublecortin proteins Keywords: Kelch-like 15, KLHL15, E3 ubiquitin ligase, protein phosphatase 2A, signal transduction, doublecortin, doublecortin-like kinases, microtubule-associated protein, ubiquitination, proteasomal degradation, protein turnover, neurite outgrowth, dendritic complexity, pulse-chase, HaloTag ______________________________________________________________________________ ABSTRACT doublecortin (DCX), also an X-linked disease gene, and doublecortin-like kinases 1 and 2 Proper brain development and function (DCLK1/2) as bona fide KLHL15 interactors requires finely controlled mechanisms
    [Show full text]