DOCSLIB.ORG

Dual O G to T*A and A*T to G*C Base Editor

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Dual O G to T*A and A*T to G*C Base Editor ( (51) International Patent Classification: (74) Agent: UJWAL, Rachna; Wilson Sonsini Goodrich & C12N 15/10 (2006.0 1) C12N 9/78 (2006.0 1) Rosati, 650 Page Mill Road, Palo Alto, California 94304 C12N 9/22 (2006.01) (US). (21) International Application Number: (81) Designated States (unless otherwise indicated, for every PCT/US20 19/04493 5 kind of national protection av ailable) . AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, BZ, (22) International Filing Date: CA, CH, CL, CN, CO, CR, CU, CZ, DE, DJ, DK, DM, DO, 02 August 2019 (02.08.2019) DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, (25) Filing Language: English HR, HU, ID, IL, IN, IR, IS, JO, JP, KE, KG, KH, KN, KP, KR, KW, KZ, LA, LC, LK, LR, LS, LU, LY, MA, MD, ME, (26) Publication Language: English MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, (30) Priority Data: OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, 62/714,550 03 August 2018 (03.08.2018) US SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW. (71) Applicant: BEAM THERAPEUTICS INC. [US/US]; 2nd Floor, 26 Landsdowne Street, Cambridge, Massachu¬ (84) Designated States (unless otherwise indicated, for every setts 02139 (US). kind of regional protection available) . ARIPO (BW, GH, GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, ST, SZ, TZ, (72) Inventors: GAUDELLI, Nicole; 2nd Floor, 26 Lands¬ UG, ZM, ZW), Eurasian (AM, AZ, BY, KG, KZ, RU, TJ, downe Street, Cambridge, Massachusetts 02139 (US). TM), European (AL, AT, BE, BG, CH, CY, CZ, DE, DK, EVANS, John; 2nd Floor, 26 Landsdowne Street, Cam¬ EE, ES, FI, FR, GB, GR, HR, HU, IE, IS, IT, LT, LU, LV, bridge, Massachusetts 02139 (US). MC, MK, MT, NL, NO, PL, PT, RO, RS, SE, SI, SK, SM, TR), OAPI (BF, BJ, CF, CG, Cl, CM, GA, GN, GQ, GW, KM, ML, MR, NE, SN, TD, TG). (54) Title: MULTI-EFFECTOR NUCLEOBASE EDITORS AND METHODS OF USING SAME TO MODIFY A NUCLEIC ACID TARGET SEQUENCE FIG. 1 Dual O G to T*A and A*T to G*C base editor (57) Abstract: The invention features a multi-effector nucleobase editor capable of inducing changes at multiple different bases within a target nucleic acid and methods of using such editors. [Continued on next page] ||| ||||| ||||| ||||| |||| 11| ||| ||||| ||||| ||||| ||||| ||||| |||| limn nil nil nil Declarations under Rule 4.17: as to applicant's entitlement to apply for and be granted a patent (Rule 4.17(H)) as to the applicant's entitlement to claim the priority of the earlier application (Rule 4.17(iii)) Published: with international search report (Art. 21(3)) before the expiration of the time limit for amending the claims and to be republished in the event of receipt of amendments (Rule 48.2(h)) MULTI-EFFECTOR NUCLEOBASE EDITORS AND METHODS OF USING SAME TO MODIFY A NUCLEIC ACID TARGET SEQUENCE CROSS-REFERENCE TO RELATED APPLICATION This application claims the benefit of U.S. Provisional Patent Application Number 62/714,550, filed on August 3, 2018, the entire contents of which are hereby incorporated by reference herein. BACKGROUND Targeted editing of nucleic acid sequences, for example, the targeted cleavage or the targeted introduction of a specific modification into genomic DNA is a highly promising approach for the study of gene function and also has the potential to provide new therapies for human genetic diseases. Currently available base editors include cytidine base editors (e.g., BE4) that convert target C G to Τ·Α and adenine base editors (e.g., ABE7. 10) that Α Τ convert target · to G*C . There is a need in the art for base editors capable of inducing novel types of modifications within a target sequence. SUMMARY OF THE DISCLOSURE As described below, the present invention features multi-effector nucleobase editors capable of inducing changes at multiple different bases within a target nucleic acid and methods of using such editors. In one aspect, the invention features a multi-effector nucleobase editor polypeptide comprising an adenosine deaminase, a cytidine deaminase, and/or a DNA glycosylase domain, where the aforementioned domains are fused to a polynucleotide binding domain, thereby forming a nucleobase editor capable of inducing changes at multiple different bases in a nucleic acid molecule. In one embodiment, the polypeptide further comprises one or more Nuclear Localization Signals (NLS). In another embodiment, the NLS is a bipartite NLS. In another embodiment, the polypeptide comprises an N-terminal NLS and a C- terminal NLS. In another embodiment, the polypeptide further comprises one or more Uracil DNA glycosylase inhibitors (UGI). In another embodiment, the adenosine deaminase is a TadA deaminase. In another embodiment, the TadA deaminase is a modified adenosine deaminase that does not occur in nature. In another embodiment, the polypeptide comprises two adenosine deaminases that are the same or different. In another embodiment, the two adenosine deaminases are capable of forming hetero or homodimers. In another embodiment, the adenosine deaminase domains are wild-type TadA and TadA7.lO. In another embodiment, the domain having nucleic acid sequence specific binding activity is a nucleic acid programmable DNA binding protein (napDNAbp). In another embodiment, the napDNAbp domain comprises a nuclease dead Cas9 (dCas9), a Cas9 nickase (nCas9), or a nuclease active Cas9. In another embodiment, the napDNAbp is selected from the group consisting of Cas9, Casl2a/Cpfl, Casl2b/C2cl, Casl2c/C2c3, Casl2d/CasY, Casl2e/CasX, Casl2g, Casl2h, and Casl2i or active fragments thereof. In certain embodiments, the napDNAbp domain contains a Cas9 domain, a Casl2a domain, a Casl2b domain, a Casl2c domain, a Casl2d domain, a Casl2e domain, a Casl2f domain, a Casl2g domain, Casl2h domain, Casl2i domain, or an argonaute domain. In another embodiment, the napDNAbp domain comprises a catalytic domain capable of cleaving the reverse complement strand of the nucleic acid sequence. In another embodiment, the napDNAbp domain does not comprise a catalytic domain capable of cleaving the nucleic acid sequence. In another embodiment, the Cas9 is dCas9 or nCas9. In another embodiment, the cytidine deaminase is Petromyzon marinus cytosine deaminase 1 (pCDM), or Activation-induced cytidine deaminase (AICDA). In another embodiment, the polypeptide further comprises an abasic nucleobase editor. In another embodiment, UGI is derived from Bacillus subtilis bacteriophage PBS1 and inhibits human UDG activity. In another aspect, the invention features a multi-effector nucleobase editor polypeptide comprising one or more Nuclear Localization Signal (NLS), a napDNAbp, a Uracil DNA glycosylase inhibitor, an adenosine deaminase, and a cytidine deaminase. In one embodiment, the polypeptide comprises two NLS. In one embodiment, one NLS is a bipartite NLS. In another embodiment, the polypeptide comprises two Uracil DNA glycosylase inhibitors. In another embodiment, the polypeptide comprises two adenosine deaminases and a cytidine deaminase, or an abasic nucleobase editor and a cytidine deaminase, or an abasic nucleobase editor and an adenosine deaminase. In one aspect, the invention features a Multi-Effector Nucleobase Editor polypeptide comprising the following domains A-C, A-D, or A-E: NH2-[A-B-C]-C00H, NH2-[A-B-C-D]-COOH, or NH2-[A-B-C-D-E]-COOH wherein A and C or A, C, and E, each comprises one or more of the following: an adenosine deaminase domain or an active fragment thereof, a cytidine deaminase domain or an active fragment thereof, a DNA glycosylase domain or an active fragment thereof; and wherein B or B and D, each comprises one or more domains having nucleic acid sequence specific binding activity. In one embodiment, the Multi-Effector Nucleobase Editor polypeptide of the previous aspect contains: H 2-[A n-Bo-Cn]-COOH, H 2-[A n-Bo-Cn-D 0]-COOH, or H 2-[A n-Bo-Cp-Do-Eq]-COOH; wherein A and C or A, C, and E, each comprises one or more of the following: an adenosine deaminase domain or an active fragment thereof, a cytidine deaminase domain or an active fragment thereof, a DNA glycosylase domain or an active fragment thereof; and wherein n is an integer: 1, 2, 3, 4, or 5, wherein p is an integer: 0, 1, 2, 3, 4, or 5; wherein q is an integer 0, 1, 2, 3, 4, or 5; and wherein B or B and D each comprises a domain having nucleic acid sequence specific binding activity; and wherein o is an integer: 1, 2, 3, 4, or 5. In one embodiment, the polypeptide contains one or more nuclear localization sequences. In one embodiment, the polypeptide contains at least one of said nuclear localization sequences is at the N-terminus or C-terminus. In one embodiment, the polypeptide contains the nuclear localization signal is a bipartite nuclear localization signal. In one embodiment, the polypeptide contains one or more domains linked by a linker. In one embodiment, the adenosine deaminase is a TadA deaminase. In one embodiment, the TadA is a modified adenosine deaminase that does not occur in nature. In another embodiment, the polypeptide comprises two adenosine deaminase domains that are the same or different. In one embodiment, the two adenosine deaminase domains are capable of forming hetero or homodimers. In one embodiment, the adenosine deaminase domains are wild-type TadA and TadA7. 10. In one embodiment, the polypeptide contains a domain having nucleic acid sequence specific binding activity is a nucleic acid programmable DNA binding protein (napDNAbp). In one embodiment, the napDNAbp domain comprises a nuclease dead Cas9 (dCas9), a Cas9 nickase (nCas9), or a nuclease active Cas9.
Load more

Recommended publications
  • Anti-CST2 / Cystatin SA Antibody (ARG59583)
    Product datasheet [email protected] ARG59583 Package: 100 μl anti-CST2 / Cystatin SA antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes CST2 / Cystatin SA Tested Reactivity Ms Tested Application WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name CST2 / Cystatin SA Antigen Species Human Immunogen Recombinant fusion protein corresponding to aa. 20-141 of Human CST2 (NP_001313.1). Conjugation Un-conjugated Alternate Names Cystatin-2; Cystatin-SA; Cystatin-S5 Application Instructions Application table Application Dilution WB 1:500 - 1:2000 Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Positive Control Mouse heart Calculated Mw 16 kDa Observed Size 16 kDa Properties Form Liquid Purification Affinity purified. Buffer PBS (pH 7.3), 0.02% Sodium azide and 50% Glycerol. Preservative 0.02% Sodium azide Stabilizer 50% Glycerol Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. The antibody solution should be gently mixed before use. Note For laboratory research only, not for drug, diagnostic or other use. www.arigobio.com 1/2 Bioinformation Gene Symbol CST2 Gene Full Name cystatin SA Background The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens.
    [Show full text]
  • Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva
    UCSF UC San Francisco Previously Published Works Title Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva. Permalink https://escholarship.org/uc/item/95h5g8mq Journal Cell reports, 33(7) ISSN 2211-1247 Authors Saitou, Marie Gaylord, Eliza A Xu, Erica et al. Publication Date 2020-11-01 DOI 10.1016/j.celrep.2020.108402 Peer reviewed eScholarship.org Powered by the California Digital Library University of California HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Cell Rep Manuscript Author . Author manuscript; Manuscript Author available in PMC 2020 November 30. Published in final edited form as: Cell Rep. 2020 November 17; 33(7): 108402. doi:10.1016/j.celrep.2020.108402. Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva Marie Saitou1,2,3, Eliza A. Gaylord4, Erica Xu1,7, Alison J. May4, Lubov Neznanova5, Sara Nathan4, Anissa Grawe4, Jolie Chang6, William Ryan6, Stefan Ruhl5,*, Sarah M. Knox4,*, Omer Gokcumen1,8,* 1Department of Biological Sciences, University at Buffalo, The State University of New York, Buffalo, NY, U.S.A 2Section of Genetic Medicine, Department of Medicine, University of Chicago, Chicago, IL, U.S.A 3Faculty of Biosciences, Norwegian University of Life Sciences, Ås, Viken, Norway 4Program in Craniofacial Biology, Department of Cell and Tissue Biology, School of Dentistry, University of California, San Francisco, CA, U.S.A 5Department of Oral Biology, School of Dental Medicine, University at Buffalo, The State University of New York, Buffalo, NY, U.S.A 6Department of Otolaryngology, School of Medicine, University of California, San Francisco, CA, U.S.A 7Present address: Weill-Cornell Medical College, Physiology and Biophysics Department 8Lead Contact SUMMARY Salivary proteins are essential for maintaining health in the oral cavity and proximal digestive tract, and they serve as potential diagnostic markers for monitoring human health and disease.
    [Show full text]
  • CST2 Monoclonal Antibody (M04), Clone 4E10
    CST2 monoclonal antibody (M04), inhibitors, while others have lost or perhaps never clone 4E10 acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins Catalog Number: H00001470-M04 (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase Regulation Status: For research use only (RUO) inhibitors found in a variety of human fluids and secretions, where they appear to provide protective Product Description: Mouse monoclonal antibody functions. The cystatin locus on chromosome 20 raised against a full-length recombinant CST2. contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus Clone Name: 4E10 and encodes a secreted thiol protease inhibitor found at high levels in saliva, tears and seminal plasma. Immunogen: CST2 (NP_001313.1, 1 a.a. ~ 141 a.a) [provided by RefSeq] full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDAD LNDERVQRALHFVISEYNKATEDEYYRRLLRVLRAREQ IVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQK KQLCSFQIYEVPWEDRMSLVNSRCQEA Host: Mouse Reactivity: Human Applications: ELISA, S-ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Isotype: IgG2a Kappa Storage Buffer: In 1x PBS, pH 7.2 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 1470 Gene Symbol: CST2 Gene Alias: MGC71924 Gene Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease Page 1/1 Powered by TCPDF (www.tcpdf.org).
    [Show full text]
  • Consistent Biomarkers and Related Pathogenesis Underlying Asthma Revealed by Systems Biology Approach
    International Journal of Molecular Sciences Article Consistent Biomarkers and Related Pathogenesis Underlying Asthma Revealed by Systems Biology Approach 1, 1, 1 1 2 3 Xiner Nie y, Jinyi Wei y, Youjin Hao , Jingxin Tao , Yinghong Li , Mingwei Liu , Boying Xu 1 and Bo Li 1,* 1 College of Life Sciences, Chongqing Normal University, Chongqing 401331, China 2 School of Biological Information, Chongqing University of Posts and Telecommunications, Chongqing 400065, China 3 College of Laboratory Medicine, Chongqing Medical University, Chongqing 400046, China * Correspondence: [email protected] These authors contributed equally to this work. y Received: 21 July 2019; Accepted: 17 August 2019; Published: 19 August 2019 Abstract: Asthma is a common chronic airway disease worldwide. Due to its clinical and genetic heterogeneity, the cellular and molecular processes in asthma are highly complex and relatively unknown. To discover novel biomarkers and the molecular mechanisms underlying asthma, several studies have been conducted by focusing on gene expression patterns in epithelium through microarray analysis. However, few robust specific biomarkers were identified and some inconsistent results were observed. Therefore, it is imperative to conduct a robust analysis to solve these problems. Herein, an integrated gene expression analysis of ten independent, publicly available microarray data of bronchial epithelial cells from 348 asthmatic patients and 208 healthy controls was performed. As a result, 78 up- and 75 down-regulated genes were identified
    [Show full text]
  • The DNA Sequence and Comparative Analysis of Human Chromosome 20
    articles The DNA sequence and comparative analysis of human chromosome 20 P. Deloukas, L. H. Matthews, J. Ashurst, J. Burton, J. G. R. Gilbert, M. Jones, G. Stavrides, J. P. Almeida, A. K. Babbage, C. L. Bagguley, J. Bailey, K. F. Barlow, K. N. Bates, L. M. Beard, D. M. Beare, O. P. Beasley, C. P. Bird, S. E. Blakey, A. M. Bridgeman, A. J. Brown, D. Buck, W. Burrill, A. P. Butler, C. Carder, N. P. Carter, J. C. Chapman, M. Clamp, G. Clark, L. N. Clark, S. Y. Clark, C. M. Clee, S. Clegg, V. E. Cobley, R. E. Collier, R. Connor, N. R. Corby, A. Coulson, G. J. Coville, R. Deadman, P. Dhami, M. Dunn, A. G. Ellington, J. A. Frankland, A. Fraser, L. French, P. Garner, D. V. Grafham, C. Grif®ths, M. N. D. Grif®ths, R. Gwilliam, R. E. Hall, S. Hammond, J. L. Harley, P. D. Heath, S. Ho, J. L. Holden, P. J. Howden, E. Huckle, A. R. Hunt, S. E. Hunt, K. Jekosch, C. M. Johnson, D. Johnson, M. P. Kay, A. M. Kimberley, A. King, A. Knights, G. K. Laird, S. Lawlor, M. H. Lehvaslaiho, M. Leversha, C. Lloyd, D. M. Lloyd, J. D. Lovell, V. L. Marsh, S. L. Martin, L. J. McConnachie, K. McLay, A. A. McMurray, S. Milne, D. Mistry, M. J. F. Moore, J. C. Mullikin, T. Nickerson, K. Oliver, A. Parker, R. Patel, T. A. V. Pearce, A. I. Peck, B. J. C. T. Phillimore, S. R. Prathalingam, R. W. Plumb, H. Ramsay, C. M.
    [Show full text]
  • CST2 Rabbit Pab
    Leader in Biomolecular Solutions for Life Science CST2 Rabbit pAb Catalog No.: A6571 Basic Information Background Catalog No. The cystatin superfamily encompasses proteins that contain multiple cystatin-like A6571 sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory Observed MW families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and 14kDa the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide Calculated MW protective functions. The cystatin locus on chromosome 20 contains the majority of the 16kDa type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted thiol protease inhibitor found at high levels in saliva, tears and Category seminal plasma. Primary antibody Applications WB, IF Cross-Reactivity Human, Mouse Recommended Dilutions Immunogen Information WB 1:500 - 1:2000 Gene ID Swiss Prot 1470 P09228 IF 1:50 - 1:100 Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-141 of human CST2 (NP_001313.1). Synonyms CST2 Contact Product Information www.abclonal.com Source Isotype Purification Rabbit IgG Affinity purification Storage Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide,50% glycerol,pH7.3. Validation Data Western blot analysis of extracts of mouse heart, using CST2 antibody (A6571) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
    [Show full text]
  • The Construction and Analysis of Gene Co-Expression Network of Differentially Expressed Genes Identifies Potential Biomarkers in Thyroid Cancer
    1243 Original Article The construction and analysis of gene co-expression network of differentially expressed genes identifies potential biomarkers in thyroid cancer Li Chai1,2#, Dongyan Han3#, Jin Li4, Zhongwei Lv1,2 1Department of Nuclear Medicine, The Affiliated Shanghai Tenth People’s Hospital of Nanjing Medical University, Shanghai 200072, China; 2Department of Nuclear Medicine, 3Department of Pathology, 4Department of Geriatrics, Shanghai Tenth People’s Hospital, Tongji University School of Medicine, Shanghai 200072, China Contributions: (I) Conception and design: Z Lv; (II) Administrative support: J Li; (III) Provision of study materials or patients: L Chai; (IV) Collection and assembly of data: D Han; (V) Data analysis and interpretation: L Chai, D Han; (VI) Manuscript writing: All authors; (VII) Final approval of manuscript: All authors. #These authors contributed equally to this study. Correspondence to: Dr. Zhongwei Lv. Department of Nuclear Medicine, The Affiliated Shanghai Tenth People’s Hospital of Nanjing Medical University, Shanghai 200072, China; Department of Nuclear Medicine, Shanghai Tenth People’s Hospital, Tongji University School of Medicine, 301 Yanchang Road, Shanghai 200072, China. Email: [email protected]. Background: The incidence and mortality of thyroid cancer has been increasing steadily in the United States. However, the molecular pathogenesis of thyroid cancer is not fully characterized. Methods: The R package of DESeq2 was applied to detect differentially expressed genes (DEGs) between 57 paired thyroid cancer and noncancerous tissues using RNA sequencing data from The Cancer Genome Atlas database. Weighted gene co-expression network analysis was used to construct co-expression modules and study the relationship between co-expression modules and clinical traits.
    [Show full text]
  • Mechanisms of Sodium–Glucose Cotransporter 2 Inhibition
    Diabetes Care Volume 43, September 2020 2183 – Ele Ferrannini,1 Ashwin C. Murthy,2 Mechanisms of Sodium Glucose Yong-hoLee,3 ElzaMuscelli,1 SophieWeiss,4 Rachel M. Ostroff,4 Naveed Sattar,5 Cotransporter 2 Inhibition: Stephen A. Williams,4 and Peter Ganz6 Insights From Large-Scale Proteomics Diabetes Care 2020;43:2183–2189 | https://doi.org/10.2337/dc20-0456 OBJECTIVE To assess the effects of empagliflozin, a selective sodium–glucose cotransporter 2 (SGLT2) inhibitor, on broad biological systems through proteomics. RESEARCH DESIGN AND METHODS Aptamer-based proteomics was used to quantify 3,713 proteins in 144 paired plasma samples obtained from 72 participants across the spectrum of glucose tolerance before and after 4 weeks of empagliflozin 25 mg/day. The biology of the plasma proteins significantly changed by empagliflozin (at false discovery rate– corrected P < 0.05) was discerned through Ingenuity Pathway Analysis. RESULTS Empagliflozin significantly affected levels of 43 proteins, 6 related to cardiomyocyte function(fattyacid–bindingprotein3and4[FABPA],neurotrophic receptortyrosine kinase, renin, thrombospondin 4, and leptin receptor), 5 to iron handling (ferritin heavy chain 1, transferrin receptor protein 1, neogenin, growth differentiation CARDIOVASCULAR AND METABOLIC RISK factor 2 [GDF2], and b2-microglobulin), and 1 to sphingosine/ceramide metabolism 1CNR Institute of Clinical Physiology, Pisa, Italy (neutral ceramidase), a known pathway of cardiovascular disease. Among the 2 fi Cardiovascular Division, Department of Medi- protein changes achieving the strongest statistical signi cance, insulin-like binding cine, Hospital of the University of Pennsylvania, factor protein-1 (IGFBP-1), transgelin-2, FABPA, GDF15, and sulphydryl oxidase Philadelphia, PA 2 precursor were increased, while ferritin, thrombospondin 3, and Rearranged 3Department of Medicine, Severance Hospital, during Transfection (RET) were decreased by empagliflozin administration.
    [Show full text]
  • 1 Distinct Epithelial Gene Expression Phenotypes in Childhood Respiratory
    ERJ Express. Published on October 17, 2011 as doi: 10.1183/09031936.00070511 Distinct epithelial gene expression phenotypes in childhood respiratory allergy Lisa Giovannini-Chami 1, 2, Brice Marcet 1, Chimène Moreilhon 1, 3, Benoît Chevalier 1, Marius I. Illie 4, Kévin Lebrigand 1, Karine Robbe-Sermesant 1, Thierry Bourrier 2, Jean- François Michiels 5, Bernard Mari 1, Dominique Crénesse 6, Paul Hofman 4, Jacques de Blic 7, Laurent Castillo 8, Marc Albertini 2, Pascal Barbry 1* 1CNRS & University of Nice Sophia Antipolis, Institut de Pharmacologie Moléculaire et Cellulaire, UMR 6097, F-06560 Sophia Antipolis, France 2CHU Nice, Service de Pédiatrie, Hôpitaux Pédiatriques de Nice CHU-LENVAL, Nice, France 3CHU Nice, Service d’Hématologie Biologique, Hôpital Pasteur, Nice, France 4CHU Nice & INSERM & University of Nice Sophia Antipolis, Clinical and Experimental Pathology Laboratory, EA 4319, Hôpital Pasteur, Nice, France 5CHU Nice, Service d’Anatomopathologie, Hôpital l’Archet 2, Nice, France 6CHU Nice, Service d’Explorations Fonctionnelles pédiatriques, Hôpitaux Pédiatriques de Nice CHU-LENVAL, Nice, France 7APHP, Service de Pneumologie et Allergologie pédiatriques, Hôpital Necker Enfants Malades, Paris, France 8CHU de Nice, Service d’ORL, Hôpital Pasteur, Nice, France (*) Correspondence (and requests for reprints) to: Pascal Barbry, Ph.D, IPMC, CNRS/UNSA UMR 6097, 660 route des Lucioles, 06560 Sophia Antipolis, France. Tel: (33) 493-957-793. Fax: (33) 493-957-794. Email: [email protected] 1 Copyright 2011 by the European Respiratory Society. Funding: Research support was provided by CNRS, CHU de Nice, the association “Vaincre la Mucoviscidose”, ADPHUN, ANR-09-GENO-039, FRM and SP2A (by a grant from Astra Zeneca to SP2A) Word count: 3040 words Online Data Supplement: This article has an online data supplement.
    [Show full text]
  • CST2 Antibody Cat
    CST2 Antibody Cat. No.: 22-322 CST2 Antibody Immunofluorescence analysis of HeLa cells using CST2 antibody (22-322). Blue: DAPI for nuclear staining. Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Human, Mouse Recombinant fusion protein containing a sequence corresponding to amino acids 20-141 IMMUNOGEN: of human CST2 (NP_001313.1). TESTED APPLICATIONS: IF, WB WB: ,1:500 - 1:2000 APPLICATIONS: IF: ,1:50 - 1:100 POSITIVE CONTROL: 1) Mouse heart October 2, 2021 1 https://www.prosci-inc.com/cst2-antibody-22-322.html PREDICTED MOLECULAR Observed: 14kDa WEIGHT: Properties PURIFICATION: Affinity purification CLONALITY: Polyclonal ISOTYPE: IgG CONJUGATE: Unconjugated PHYSICAL STATE: Liquid BUFFER: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. STORAGE CONDITIONS: Store at -20˚C. Avoid freeze / thaw cycles. Additional Info OFFICIAL SYMBOL: CST2 cystatin-SA, cystatin 2, cystatin S5, cysteine-proteinase inhibitor, salivary cysteine (thiol) ALTERNATE NAMES: protease inhibitor GENE ID: 1470 USER NOTE: Optimal dilutions for each application to be determined by the researcher. Background and References The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the BACKGROUND: kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a secreted thiol protease inhibitor found at high levels in saliva, tears and seminal plasma.
    [Show full text]
  • Cystatin SA (CST2) (NM 001322) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC209350 Cystatin SA (CST2) (NM_001322) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Cystatin SA (CST2) (NM_001322) Human Tagged ORF Clone Tag: Myc-DDK Symbol: CST2 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC209350 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCTGGCCCCTGTGCACCCTGCTGCTCCTGCTGGCCACCCAGGCTGTGGCCCTGGCCTGGAGCCCCC AGGAGGAGGACAGGATAATCGAGGGTGGCATCTATGATGCAGACCTCAATGATGAGCGGGTACAGCGTGC CCTTCACTTTGTCATCAGCGAGTATAACAAGGCCACTGAAGATGAGTACTACAGACGCCTGCTGCGGGTG CTACGAGCCAGGGAGCAGATCGTGGGCGGGGTGAATTACTTCTTCGACATAGAGGTGGGCCGAACCATAT GTACCAAGTCCCAGCCCAACTTGGACACCTGTGCCTTCCATGAACAGCCAGAACTGCAGAAGAAACAGTT GTGCTCTTTCCAGATCTACGAAGTTCCCTGGGAGGACAGAATGTCCCTGGTGAATTCCAGGTGTCAAGAA GCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC209350 protein sequence Red=Cloning site Green=Tags(s) MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDADLNDERVQRALHFVISEYNKATEDEYYRRLLRV LRAREQIVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFQIYEVPWEDRMSLVNSRCQE A myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6242_g05.zip Restriction Sites: SgfI-MluI This
    [Show full text]
  • CST2 (Human) Recombinant Protein (P01)
    CST2 (Human) Recombinant Protein acquired this inhibitory activity. There are three inhibitory (P01) families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 Catalog Number: H00001470-P01 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and Regulation Status: For research use only (RUO) secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 Product Description: Human CST2 full-length ORF ( contains the majority of the type 2 cystatin genes and NP_001313.1, 1 a.a. - 141 a.a.) recombinant protein with pseudogenes. This gene is located in the cystatin locus GST-tag at N-terminal. and encodes a secreted thiol protease inhibitor found at high levels in saliva, tears and seminal plasma. Sequence: [provided by RefSeq] MAWPLCTLLLLLATQAVALAWSPQEEDRIIEGGIYDAD LNDERVQRALHFVISEYNKATEDEYYRRLLRVLRAREQ IVGGVNYFFDIEVGRTICTKSQPNLDTCAFHEQPELQK KQLCSFQIYEVPWEDRMSLVNSRCQEA Host: Wheat Germ (in vitro) Theoretical MW (kDa): 42.8 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 1470 Gene Symbol: CST2 Gene Alias: MGC71924 Gene Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never Page 1/1 Powered by TCPDF (www.tcpdf.org).
    [Show full text]