DOCSLIB.ORG

M6a Modification in RNA: Biogenesis, Functions and Roles in Gliomas

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
M6a Modification in RNA: Biogenesis, Functions and Roles in Gliomas Zhang et al. Journal of Experimental & Clinical Cancer Research (2020) 39:192 https://doi.org/10.1186/s13046-020-01706-8 REVIEW Open Access m6A modification in RNA: biogenesis, functions and roles in gliomas Yuhao Zhang1†, Xiuchao Geng2†, Qiang Li3, Jianglong Xu1, Yanli Tan4, Menglin Xiao1, Jia Song5, Fulin Liu6*, Chuan Fang1* and Hong Wang1,2,7* Abstract The chemical modification of RNA is a newly discovered epigenetic regulation mechanism in cells and plays a crucial role in a variety of biological processes. N6-methyladenine (m6A) mRNA modification is the most abundant form of posttranscriptional RNA modification in eukaryotes. Through the development of m6A RNA sequencing, the relevant molecular mechanism of m6A modification has gradually been revealed. It has been found that the effect of m6A modification on RNA metabolism involves processing, nuclear export, translation and even decay. As the most common malignant tumour of the central nervous system, gliomas (especially glioblastoma) have a very poor prognosis, and treatment efficacy is not ideal even with the application of high-intensity treatment measures of surgery combined with chemoradiotherapy. Exploring the origin and development mechanisms of tumour cells from the perspective of tumour biogenesis has always been a hotspot in the field of glioma research. Emerging evidence suggests that m6A modification can play a key role in gliomas through a variety of mechanisms, providing more possibilities for early diagnosis and targeted therapy of gliomas. The aim of the present review is to focus on the research progress regarding the association between m6A modification and gliomas. And to provide a theoretical basis according to the currently available literature for further exploring this association. This review may provide new insights for the molecular mechanism, early diagnosis, histologic grading, targeted therapy and prognostic evaluation of gliomas. Keywords: m6A modification, RNA, Central nervous system, Glioma, Glioblastoma, GBM, Tumourigenesis Background degree of mitotic activity. Given the aggressiveness of Gliomas are the most common malignancy in the cen- GBM, surgical resection to resolve all intracranial lesions tral nervous system. Glioblastoma (GBM) has the high- in clinical practice is challenging. Therefore, most est malignancy rate and account for 50% of all brain patients receive radiotherapy and temozolomide (TMZ) tumours. The average survival time of patients with combined with chemotherapy after surgery. Although GBM is only 14.6 months [1]. GBM originate from the treatment intensity is very high, the outcomes are poorly differentiated glial cells and have the characteris- still not satisfactory [2–5]. Therefore, there is an urgent tics of nuclear atypia, cellular polymorphism, and a high need for new treatment strategies or regimens. To improve the efficacy of GBM treatment, it is neces- * Correspondence: [email protected]; [email protected]; sary to understand the occurrence and development of [email protected] GBM and determine the molecular biological character- † Yuhao Zhang and Xiuchao Geng contributed equally to this work. istics of GBM. In recent years, with the in-depth study 6Office of Academic Research, Affiliated Hospital of Hebei University, 071000 Baoding, China of the epigenetics, metabolism, and immunology of 1Department of Neurosurgery, Affiliated Hospital of Hebei University, 071000 GBM, our knowledge of GBM has greatly expanded, Baoding, China which provides new clues for the treatment of GBM. Full list of author information is available at the end of the article © The Author(s). 2020 Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article's Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article's Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creativecommons.org/licenses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. Zhang et al. Journal of Experimental & Clinical Cancer Research (2020) 39:192 Page 2 of 16 Recent studies have found that non-coding RNAs and Approaches of detecting of m6A modification post transcriptional modification of RNAs have become The total amount of m6A in RNA can be probed by sev- the active fields of cancer research. Among them, N6- eral approaches, including two-dimensional thin layer methyladenine (m6A) RNA modification is the import- chromatography, m6A dot-blot and high-performance li- ant research hotspot [6, 7]. More than 60% of all RNA quid chromatography-tandem mass spectrometry (HPLC- modifications are methylated modifications, and m6A is MS/MS) [15, 16]. the most abundant chemical modification in eukaryotic The transcriptome-wide distribution of m6A was un- messenger RNA (mRNA). As a representative of relevant clear before 2012, until methylated RNA immunoprecip- studies, epigenetics found that m6A RNA modification itation followed by high-throughput sequencing (MeRIP- plays important roles in the regulation of cell fate, prolif- seq or m6A-seq) was developed [17, 18]. In this method, eration, and metabolism and the biogenesis of tumours mRNA was fragmented into 100-nt-long oligonucleo- [6–9]. It also opens a new way of thinking for biomedical tides and immunoprecipitated with a specific antibody scientists, whether RNA modification will be another against m6A. Then immunoprecipitated RNAs were sub- important factor to regulate the biological development jected to high-throughput sequencing. Other approaches of neoplastic diseases. for higher resolution, such as photo-crosslinking-assisted In this review, we provide a comprehensive intro- m6A-sequencing (PA-m6A-Seq) and site-specific cleavage duction of the latest research progress on m6A modi- and radioactive-labelling followed by ligation-assisted fication and elucidate the origin of m6A modification, extraction and thin-layer chromatography (SCARLET) its regulation, biological functions and its correlation [19, 20]. Currently, a novel method called m6A indi- with the central nervous system and gliomas. And to vidual nucleotide resolution crosslinking immunopre- discuss the prospect of the possible research direc- cipitation (miCLIP) has marked a major step forward tions. Aiming at providing a theoretical basis accord- in the field, which could detect m6A at precise position ing to the currently available literature for further [21]. Furthermore, with the development of CRISPR-based exploring the association between m6A modification genome engineering, it is currently possible to directly de- and gliomas. tect the effect of altering any m6A modification site in many organisms. As a supplementary approach, it would The molecular mechanisms of m6A modification be valuable for discovering the functions of m6A methyla- Origin of m6A modification tion [22, 23]. With the advent of high-throughput sequencing technol- Current studies have shown that in addition to mRNA, ogy, scientists have identified nearly 170 types of RNA microRNA (miRNA), long noncoding RNAs (lncRNA), modification, also known as “epitranscriptomics” [10]. circular RNA (circRNA), ribosomal RNA (rRNA), trans- Inserting information beyond the information carried by fer RNA (tRNA) and small nucleolar RNAs (snoRNA) their base sequences to gene transcripts, altering the all have m6A modifications and that their regulation in- charge of RNA bases and their matching properties, volves almost all categories of protein-coding genes and differential folding of RNAs, and the formation of a noncoding genes [24, 25]. regulatory protein-RNA interaction recognition element are classical transcriptome modification processes. There- Regulation of m6A modification fore, these modifications are involved in the whole process m6A modification mainly occurs in adenines in the of RNA metabolism, regulating the fine expression pat- RRACH sequence, and its functions are implemented by terns of genes and, ultimately, affecting the biological be- RNA methyltransferases (writers), RNA demethylase haviour of cells [11, 12]. (erasers) and m6A binding protein (readers). We sum- When the m6A modification was first discovered in marized the types of proteins involved in m6A modifica- mRNA, only a few modified sites were mapped in viral tion (Fig. 1). In addition, we offered some explanations and cellular RNAs, but not in the human coding region for some of these important biological functions. or noncoding region [13]. In 2012, Dominissini and col- leagues developed m6A sequencing (m6A-seq) technol- m6A “writer” ogy. They presented the first modification landscape in Methyltransferase like 3 (METTL3) is a key protein with a transcriptome-wide manner using m6A-seq, proved molecular weight of 70 kDa and was the first protein the evolutionary conservation of m6A sites and identi- identified
Load more

Recommended publications
  • Genome Wide Association Study of Response to Interval and Continuous Exercise Training: the Predict‑HIIT Study Camilla J
    Williams et al. J Biomed Sci (2021) 28:37 https://doi.org/10.1186/s12929-021-00733-7 RESEARCH Open Access Genome wide association study of response to interval and continuous exercise training: the Predict-HIIT study Camilla J. Williams1†, Zhixiu Li2†, Nicholas Harvey3,4†, Rodney A. Lea4, Brendon J. Gurd5, Jacob T. Bonafglia5, Ioannis Papadimitriou6, Macsue Jacques6, Ilaria Croci1,7,20, Dorthe Stensvold7, Ulrik Wislof1,7, Jenna L. Taylor1, Trishan Gajanand1, Emily R. Cox1, Joyce S. Ramos1,8, Robert G. Fassett1, Jonathan P. Little9, Monique E. Francois9, Christopher M. Hearon Jr10, Satyam Sarma10, Sylvan L. J. E. Janssen10,11, Emeline M. Van Craenenbroeck12, Paul Beckers12, Véronique A. Cornelissen13, Erin J. Howden14, Shelley E. Keating1, Xu Yan6,15, David J. Bishop6,16, Anja Bye7,17, Larisa M. Haupt4, Lyn R. Grifths4, Kevin J. Ashton3, Matthew A. Brown18, Luciana Torquati19, Nir Eynon6 and Jef S. Coombes1* Abstract Background: Low cardiorespiratory ftness (V̇O2peak) is highly associated with chronic disease and mortality from all causes. Whilst exercise training is recommended in health guidelines to improve V̇O2peak, there is considerable inter-individual variability in the V̇O2peak response to the same dose of exercise. Understanding how genetic factors contribute to V̇O2peak training response may improve personalisation of exercise programs. The aim of this study was to identify genetic variants that are associated with the magnitude of V̇O2peak response following exercise training. Methods: Participant change in objectively measured V̇O2peak from 18 diferent interventions was obtained from a multi-centre study (Predict-HIIT). A genome-wide association study was completed (n 507), and a polygenic predictor score (PPS) was developed using alleles from single nucleotide polymorphisms= (SNPs) signifcantly associ- –5 ated (P < 1 ­10 ) with the magnitude of V̇O2peak response.
    [Show full text]
  • Caspases Switch Off M6a RNA Modification Pathway to Reactivate A
    bioRxiv preprint doi: https://doi.org/10.1101/2020.11.12.377127; this version posted November 13, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 6 1 Caspases switch off m A RNA modification pathway to reactivate a 2 ubiquitous human tumor virus 3 Kun Zhang1,2, Yucheng Zhang3, Jun Wan3,4,5 and Renfeng Li1,2,6,7,8* 4 1Philips Institute for Oral Health Research, School of Dentistry, Virginia Commonwealth 5 University, Richmond, Virginia, 23298, USA 6 2Department of Oral and Craniofacial Molecular Biology, School of Dentistry, Virginia 7 Commonwealth University, Richmond, Virginia, 23298, USA 8 3Department of Medical and Molecular Genetics, Indiana University School of Medicine, 9 Indianapolis, Indiana, 46202, USA 10 4Center for Computational Biology and Bioinformatics, Indiana University School of Medicine, 11 Indianapolis, Indiana, 46202, USA. 12 5Department of BioHealth Informatics, School of Informatics and Computing, Indiana University 13 – Purdue University at Indianapolis, Indianapolis, Indiana, 46202, USA 14 6Department of Microbiology and Immunology, School of Medicine, Virginia Commonwealth 15 University, Richmond, Virginia, 23298, USA 16 7Massey Cancer Center, Virginia Commonwealth University, Richmond, Virginia, 23298, USA. 17 8Lead Contact 18 19 *Corresponding author: [email protected] (RL) 20 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.11.12.377127; this version posted November 13, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity.
    [Show full text]
  • Bioinformatics Analyses of Genomic Imprinting
    Bioinformatics Analyses of Genomic Imprinting Dissertation zur Erlangung des Grades des Doktors der Naturwissenschaften der Naturwissenschaftlich-Technischen Fakultät III Chemie, Pharmazie, Bio- und Werkstoffwissenschaften der Universität des Saarlandes von Barbara Hutter Saarbrücken 2009 Tag des Kolloquiums: 08.12.2009 Dekan: Prof. Dr.-Ing. Stefan Diebels Berichterstatter: Prof. Dr. Volkhard Helms Priv.-Doz. Dr. Martina Paulsen Vorsitz: Prof. Dr. Jörn Walter Akad. Mitarbeiter: Dr. Tihamér Geyer Table of contents Summary________________________________________________________________ I Zusammenfassung ________________________________________________________ I Acknowledgements _______________________________________________________II Abbreviations ___________________________________________________________ III Chapter 1 – Introduction __________________________________________________ 1 1.1 Important terms and concepts related to genomic imprinting __________________________ 2 1.2 CpG islands as regulatory elements ______________________________________________ 3 1.3 Differentially methylated regions and imprinting clusters_____________________________ 6 1.4 Reading the imprint __________________________________________________________ 8 1.5 Chromatin marks at imprinted regions___________________________________________ 10 1.6 Roles of repetitive elements ___________________________________________________ 12 1.7 Functional implications of imprinted genes _______________________________________ 14 1.8 Evolution and parental conflict ________________________________________________
    [Show full text]
  • 'Next- Generation' Sequencing Data Analysis
    Novel Algorithm Development for ‘Next- Generation’ Sequencing Data Analysis Agne Antanaviciute Submitted in accordance with the requirements for the degree of Doctor of Philosophy University of Leeds School of Medicine Leeds Institute of Biomedical and Clinical Sciences 12/2017 ii The candidate confirms that the work submitted is her own, except where work which has formed part of jointly-authored publications has been included. The contribution of the candidate and the other authors to this work has been explicitly given within the thesis where reference has been made to the work of others. This copy has been supplied on the understanding that it is copyright material and that no quotation from the thesis may be published without proper acknowledgement ©2017 The University of Leeds and Agne Antanaviciute The right of Agne Antanaviciute to be identified as Author of this work has been asserted by her in accordance with the Copyright, Designs and Patents Act 1988. Acknowledgements I would like to thank all the people who have contributed to this work. First and foremost, my supervisors Dr Ian Carr, Professor David Bonthron and Dr Christopher Watson, who have provided guidance, support and motivation. I could not have asked for a better supervisory team. I would also like to thank my collaborators Dr Belinda Baquero and Professor Adrian Whitehouse for opening new, interesting research avenues. A special thanks to Dr Belinda Baquero for all the hard wet lab work without which at least half of this thesis would not exist. Thanks to everyone at the NGS Facility – Carolina Lascelles, Catherine Daley, Sally Harrison, Ummey Hany and Laura Crinnion – for the generation of NGS data used in this work and creating a supportive and stimulating work environment.
    [Show full text]
  • Large-Scale Functional Prediction of Individual M6a RNA Methylation Sites from an RNA Co-Methylation Network
    Wu et al. BMC Bioinformatics (2019) 20:223 https://doi.org/10.1186/s12859-019-2840-3 RESEARCHARTICLE Open Access m6Acomet: large-scale functional prediction of individual m6A RNA methylation sites from an RNA co- methylation network Xiangyu Wu1,2, Zhen Wei1,2, Kunqi Chen1,2, Qing Zhang1,4, Jionglong Su5, Hui Liu6, Lin Zhang6* and Jia Meng1,3* Abstract Background: Over one hundred different types of post-transcriptional RNA modifications have been identified in human. Researchers discovered that RNA modifications can regulate various biological processes, and RNA methylation, especially N6-methyladenosine, has become one of the most researched topics in epigenetics. Results: To date, the study of epitranscriptome layer gene regulation is mostly focused on the function of mediator proteins of RNA methylation, i.e., the readers, writers and erasers. There is limited investigation of the functional relevance of individual m6A RNA methylation site. To address this, we annotated human m6A sites in large-scale based on the guilt-by-association principle from an RNA co-methylation network. It is constructed based on public human MeRIP-Seq datasets profiling the m6A epitranscriptome under 32 independent experimental conditions. By systematically examining the network characteristics obtained from the RNA methylation profiles, a total of 339,158 putative gene ontology functions associated with 1446 human m6A sites were identified. These are biological functions that may be regulated at epitranscriptome layer via reversible m6A RNA methylation. The results were further validated on a soft benchmark by comparing to a random predictor. Conclusions: An online web server m6Acomet was constructed to support direct query for the predicted biological functions of m6A sites as well as the sites exhibiting co-methylated patterns at the epitranscriptome layer.
    [Show full text]
  • Novel Candidate Genes of Thyroid Tumourigenesis Identified in Trk-T1 Transgenic Mice
    Endocrine-Related Cancer (2012) 19 409–421 Novel candidate genes of thyroid tumourigenesis identified in Trk-T1 transgenic mice Katrin-Janine Heiliger*, Julia Hess*, Donata Vitagliano1, Paolo Salerno1, Herbert Braselmann, Giuliana Salvatore 2, Clara Ugolini 3, Isolde Summerer 4, Tatjana Bogdanova5, Kristian Unger 6, Gerry Thomas6, Massimo Santoro1 and Horst Zitzelsberger Research Unit of Radiation Cytogenetics, Helmholtz Zentrum Mu¨nchen, Ingolsta¨dter Landstr. 1, 85764 Neuherberg, Germany 1Istituto di Endocrinologia ed Oncologia Sperimentale del CNR, c/o Dipartimento di Biologia e Patologia Cellulare e Molecolare, Universita` Federico II, Naples 80131, Italy 2Dipartimento di Studi delle Istituzioni e dei Sistemi Territoriali, Universita` ‘Parthenope’, Naples 80133, Italy 3Division of Pathology, Department of Surgery, University of Pisa, 56100 Pisa, Italy 4Institute of Radiation Biology, Helmholtz Zentrum Mu¨nchen, 85764 Neuherberg, Germany 5Institute of Endocrinology and Metabolism, Academy of Medical Sciences of the Ukraine, 254114 Kiev, Ukraine 6Department of Surgery and Cancer, Imperial College London, Hammersmith Hospital, London W12 0HS, UK (Correspondence should be addressed to H Zitzelsberger; Email: [email protected]) *(K-J Heiliger and J Hess contributed equally to this work) Abstract For an identification of novel candidate genes in thyroid tumourigenesis, we have investigated gene copy number changes in a Trk-T1 transgenic mouse model of thyroid neoplasia. For this aim, 30 thyroid tumours from Trk-T1 transgenics were investigated by comparative genomic hybridisation. Recurrent gene copy number alterations were identified and genes located in the altered chromosomal regions were analysed by Gene Ontology term enrichment analysis in order to reveal gene functions potentially associated with thyroid tumourigenesis. In thyroid neoplasms from Trk-T1 mice, a recurrent gain on chromosomal bands 1C4–E2.3 (10.0% of cases), and losses on 3H1–H3 (13.3%), 4D2.3–E2 (43.3%) and 14E4–E5 (6.7%) were identified.
    [Show full text]
  • B01P) Gene Alias: IME4, M6A, MGC4336, MT-A70, Spo8
    METTL3 purified MaxPab mouse Gene Symbol: METTL3 polyclonal antibody (B01P) Gene Alias: IME4, M6A, MGC4336, MT-A70, Spo8 Catalog Number: H00056339-B01P Gene Summary: This gene encodes the 70 kDa subunit of MT-A which is part of Regulatory Status: For research use only (RUO) N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal Product Description: Mouse polyclonal antibody raised adenosine residues in eukaryotic mRNAs, forming against a full-length human METTL3 protein. N6-methyladenosine. [provided by RefSeq] Immunogen: METTL3 (NP_062826.2, 1 a.a. ~ 580 a.a) References: full-length human protein. 1. Synaptic N6-methyladenosine (m6A) epitranscriptome Sequence: reveals functional partitioning of localized transcripts. MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLR Merkurjev D, Hong WT, Iida K, Oomoto I, Goldie BJ, NPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVPELAT Yamaguti H, Ohara T, Kawaguchi SY, Hirano T, Martin DPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQ KC, Pellegrini M, Wang DO. Nat Neurosci. 2018 DGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADHS Jul;21(7):1004-1014. doi: 10.1038/s41593-018-0173-6. KLSAMMGAVAEKKGPGEVAGTVTGQKRRAEQDSTTV Epub 2018 Jun 27. AAFASSLVSGLNSSASEPAKEPAKKSRKHAASDVDLEI 2. The RNA Methyltransferase Complex of WTAP, ESLLNQQSTKEQQSKKVSQEILELLNTTTAKEQSIVEKF METTL3, and METTL14 Regulates Mitotic Clonal RSRGRAQVQEFCDYGTKEECMKASDADRPCRKLHFR Expansion in Adipogenesis. Kobayashi M, Ohsugi M, RIINKHTDESLGDCSFLNTCFHMDTCKYVHYEIDACMD Sasako T, Awazawa M, Umehara T, Iwane A, Kobayashi SEAPGSKDHTPSQELALTQSVGGDSSADRLFPPQWIC
    [Show full text]
  • N6-Methyladenosine RNA Modification Regulates Embryonic Neural Stem Cell Self-Renewal Through Histone Modifications
    ARTICLES https://doi.org/10.1038/s41593-017-0057-1 Corrected: Publisher Correction N6-methyladenosine RNA modification regulates embryonic neural stem cell self-renewal through histone modifications Yang Wang1, Yue Li 2, Minghui Yue3,4, Jun Wang1, Sandeep Kumar5, Robert J. Wechsler-Reya1, Zhaolei Zhang6, Yuya Ogawa3,4, Manolis Kellis2, Gregg Duester 5 and Jing Crystal Zhao 1* Internal N6-methyladenosine (m6A) modification is widespread in messenger RNAs (mRNAs) and is catalyzed by heterodimers of methyltransferase-like protein 3 (Mettl3) and Mettl14. To understand the role of m6A in development, we deleted Mettl14 in embryonic neural stem cells (NSCs) in a mouse model. Phenotypically, NSCs lacking Mettl14 displayed markedly decreased proliferation and premature differentiation, suggesting that m6A modification enhances NSC self-renewal. Decreases in the NSC pool led to a decreased number of late-born neurons during cortical neurogenesis. Mechanistically, we discovered a genome-wide increase in specific histone modifications in Mettl14 knockout versus control NSCs. These changes correlated with altered gene expression and observed cellular phenotypes, suggesting functional significance of altered histone modi- fications in knockout cells. Finally, we found that m6A regulates histone modification in part by destabilizing transcripts that encode histone-modifying enzymes. Our results suggest an essential role for m6A in development and reveal m6A-regulated histone modifications as a previously unknown mechanism of gene regulation in mammalian cells. ost-transcriptional modification of mRNA has emerged as an (VZ) showed a decrease in number relative to those seen in control important mechanism for gene regulation. Among internal mice, and this reduction was accompanied by fewer late-born corti- mRNA modifications, m6A is by far the most abundant, tagging cal neurons.
    [Show full text]
  • Related Genes in TP53-Mutant Non-Small-Cell Lung Cancer
    Expression and Prognostic Signicance of m6A- Related Genes in TP53-Mutant Non-Small-Cell Lung Cancer Zhuochen Zhao First Aliated Hospital of Zhengzhou University Junhu Wan First Aliated Hospital of Zhengzhou University Manman Guo First Aliated Hospital of Zhengzhou University Yangxia Wang First Aliated Hospital of Zhengzhou University Zhengwu Yang First Aliated Hospital of Zhengzhou University Zhuofang Li First Aliated Hospital of Zhengzhou University Liang Ming ( [email protected] ) First Aliated Hospital of Zhengzhou University Research Article Keywords: TP53 mutant, N-6-methylation, NSCLC, prognostic, bioinformatics Posted Date: December 29th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-127631/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/18 Abstract Background: TP53 is an important tumor suppressor gene on human chromosome 17. TP53 mutations have been conrmed in more than 60% of tumor patients' somatic cells. N6-methyladenosine is an enzyme that plays an important role in mRNA splicing, translation, and stabilization. It is a common internal modication of nucleotides, that is regulated by methyltransferases ("writer"), binding proteins ("reader"), and demethylases ("eraser"). However, its role in TP53 mutant non-small-cell lung cancer remains unknown. In this study, we investigated 17 common N-6-Methyladenosine regulators' contributions and prognostic values. Results: Wilcox test showed that 9 of 17 m6A regulators were expressed differently between TP53 mutant and wild type NSCLC (p<0.05). A new way of tumor typing is attempted by consensus clustering. Using univariate cox regression analysis, ALKBH5, HNRNPA2B1 were associated with the prognostic of TP53 mutant patients.
    [Show full text]
  • Rna Methylation As a New Epigenetic Regulatory
    THE UNIVERSITY OF CHICAGO THE EXUBERANT VINE OF EPITRANSCRIPTOME: RNA METHYLATION AS A NEW EPIGENETIC REGULATORY MECHANISM A DISSERTATION SUBMITTED TO THE FACULTY OF THE DIVISION OF THE PHYSICAL SCIENCES IN CANDIDACY FOR THE DEGREE OF DOCTOR OF PHILOSOPHY DEPARTMENT OF CHEMISTRY BY BOXUAN ZHAO CHICAGO, ILLINOIS AUGUST 2017 Table of Contents List of Figures ..................................................................................................................................v Acknowledgement ....................................................................................................................... viii Abstract .......................................................................................................................................... xi List of Publications ....................................................................................................................... xii Chapter 1 Introduction: RNA Modifications and Epitranscriptomics ................................. 1 1.1 Genetics and epigenetics: beyond the primary sequence .....................................................1 1.2 Epigenetic regulation of chromatin structure: histone and DNA modifications ..................2 1.3 Emergence of RNA epigenetics: chemical modifications on RNA .....................................4 1.4 N6-methyladenosine (m6A): the protagonist of epitranscriptomics ....................................7 1.5 Scope of this dissertation ...................................................................................................10
    [Show full text]
  • RNA M6 a Modification Enzymes Shape Innate Responses to DNA by Regulating Interferon Β
    Downloaded from genesdev.cshlp.org on October 1, 2021 - Published by Cold Spring Harbor Laboratory Press RNA m6A modification enzymes shape innate responses to DNA by regulating interferon β Rosa M. Rubio,1 Daniel P. Depledge,1 Christopher Bianco,1 Letitia Thompson,1 and Ian Mohr1,2 1Department of Microbiology, 2Laura and Isaac Perlmutter Cancer Institute, New York University School of Medicine, New York, New York 10016, USA Modification of mRNA by N6-adenosine methylation (m6A) on internal bases influences gene expression in eukaryotes. How the dynamic genome-wide landscape of m6A-modified mRNAs impacts virus infection and host immune responses remains poorly understood. Here, we show that type I interferon (IFN) production triggered by dsDNA or human cytomegalovirus (HCMV) is controlled by the cellular m6A methyltrasferase subunit METTL14 and ALKBH5 demethylase. While METTL14 depletion reduced virus reproduction and stimulated dsDNA- or HCMV-induced IFNB1 mRNA accumulation, ALKBH5 depletion had the opposite effect. Depleting METTL14 increased both nascent IFNB1 mRNA production and stability in response to dsDNA. In contrast, ALKBH5 deple- tion reduced nascent IFNB1 mRNA production without detectably influencing IFN1B mRNA decay. Genome-wide transcriptome profiling following ALKBH5 depletion identified differentially expressed genes regulating antiviral immune responses, while METTL14 depletion altered pathways impacting metabolic reprogramming, stress responses, and aging. Finally, we determined that IFNB1 mRNA was m6A-modified within both the coding sequence and the 3′ untranslated region (UTR). This establishes that the host m6A modification machinery controls IFNβ production triggered by HCMV or dsDNA. Moreover, it demonstrates that responses to nonmicrobial dsDNA in uninfected cells, which shape host immunity and contribute to autoimmune disease, are regulated by enzymes controlling m6A epitranscriptomic changes.
    [Show full text]
  • N6-Methyladenosine-Dependent Regulation of Messenger RNA Stability
    LETTER doi:10.1038/nature12730 N6-methyladenosine-dependent regulation of messenger RNA stability Xiao Wang1, Zhike Lu1, Adrian Gomez1,GaryC.Hon2, Yanan Yue1, Dali Han1,YeFu1, Marc Parisien3, Qing Dai1, Guifang Jia1,4, Bing Ren2, Tao Pan3 & Chuan He1 N6-methyladenosine (m6A) is the most prevalent internal (non-cap) The YTH domain family is widespread in eukaryotes and known to modification present in the messenger RNA of all higher eukaryotes1,2. bind single-stranded RNA with the conserved YTH domain (.60% Although essential to cell viability and development3–5, the exact role identity) located at the C terminus16,17. In addition to previously reported of m6A modification remains to be determined. The recent discovery YTHDF2 and YTHDF314, we also discovered YTHDF1 as another m6A- of two m6A demethylases in mammalian cells highlighted the impor- selective binding protein by using methylated RNA bait containing the tance of m6A in basic biological functions and disease6–8.Herewe known consensus sites of G(m6A)C and A(m6A)C versus unmethy- show that m6A is selectively recognized by the human YTH domain lated control (Extended Data Fig. 1a). Further, highly purified poly(A)- family 2 (YTHDF2) ‘reader’ protein to regulate mRNA degradation. tailed RNAs were incubated with recombinant glutathione-S-transferase We identified over 3,000 cellular RNA targets of YTHDF2, most of (GST)-tagged YTHDF1-3 and then separated by GST-affinity column. which are mRNAs, but which also include non-coding RNAs, with a By using a previously reported liquid chromatography-tandem mass conserved core motif of G(m6A)C. We further establish the role of spectrometry (LC-MS/MS) method7,8, we found that the m6A-containing YTHDF2 in RNA metabolism, showing that binding of YTHDF2 RNAs were greatly enriched in the YTHDF-bound portion and dimin- results in the localization of bound mRNA from the translatable ished in the flow-through portion (Fig.
    [Show full text]