CRYM monoclonal antibody (M03), latter class constitutes the major of vertebrate clone 6B3 eye lens and maintains the transparency and refractive index of the lens. This encodes a taxon-specific Catalog Number: H00001428-M03 that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The Regulatory Status: For research use only (RUO) encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for Product Description: Mouse monoclonal antibody possible regulatory or developmental roles. Multiple raised against a partial recombinant CRYM. alternatively spliced transcript variants have been found for this gene. [provided by RefSeq] Clone Name: 6B3 References: Immunogen: CRYM (NP_001879, 215 a.a. ~ 314 a.a) 1. Overexpression of the double homeodomain protein partial recombinant protein with GST tag. MW of the DUX4c interferes with myofibrillogenesis and induces GST tag alone is 26 KDa. clustering of myonuclei. Vanderplanck C, Tassin A, Ansseau E, Charron S, Wauters A, Lancelot C, Sequence: Vancutsem K, Laoudj-Chenivesse D, Belayew A, EWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDS Coppee F. Skelet Muscle. 2018 Jan 12;8(1):2. QEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTT 2. The FSHD Atrophic Myotube Phenotype Is Caused by VFKSLGMAVEDTVAAKLIYDSWSSGK DUX4 Expression. Vanderplanck C, Ansseau E, Charron S, Stricwant N, Tassin A, Laoudj-Chenivesse D, Wilton Host: Mouse SD, Coppee F, Belayew A. PLoS One. Reactivity: Human 2011;6(10):e26820. Epub 2011 Oct 28. 3. Comprehensive expression analysis of FSHD Applications: ELISA, IHC-P, IP, S-ELISA, WB-Ce, candidate at the mRNA and protein level. Klooster WB-Re, WB-Tr R, Straasheijm K, Shah B, Sowden J, Frants R, (See our web site product page for detailed applications Thornton C, Tawil R, van der Maarel S. Eur J Hum information) Genet. 2009 Dec;17(12):1615-24. Epub 2009 Oct 7.

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Isotype: IgG1 Kappa

Storage Buffer: In 1x PBS, pH 7.4

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 1428

Gene Symbol: CRYM

Gene Alias: DFNA40, THBP

Gene Summary: are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The

Page 1/1

Powered by TCPDF (www.tcpdf.org)