Produktinformation
Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien
Weitere Information auf den folgenden Seiten! See the following pages for more information!
Lieferung & Zahlungsart
Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic ADD1 (Human) Recombinant Protein Glutathione, pH=8.0 in the elution buffer. (P01) Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Catalog Number: H00000118-P01
Entrez GeneID: 118 Regulation Status: For research use only (RUO)
Gene Symbol: ADD1 Product Description: Human ADD1 full-length ORF ( AAH42998, 1 a.a. - 662 a.a.) recombinant protein with Gene Alias: ADDA, MGC3339, MGC44427 GST-tag at N-terminal. Gene Summary: Adducins are a family of cytoskeleton Sequence: proteins encoded by three genes (alpha, beta, gamma). MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYL Adducin is a heterodimeric protein that consists of RERNMAPDLRQDFNMMEQKKRVSMILQSPAFCEELE related subunits, which are produced from distinct genes SMIQEQFKKGKNPTGLLALQQIADFMTTNVPNVYPAAP but share a similar structure. Alpha- and beta-adducin QGGMAALNMSLGMVTPVNDLRGSDSIAYDKGEKLLR include a protease-resistant N-terminal region and a CKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFLIVPF protease-sensitive, hydrophilic C-terminal region. Alpha- GLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFTL and gamma-adducins are ubiquitously expressed. In HSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPE contrast, beta-adducin is expressed at high levels in ALSLGEVAYHDYHGILVDEEEKVLIQKNLGPKSKVLILR brain and hematopoietic tissues. Adducin binds with high NHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGP affinity to Ca(2+)/calmodulin and is a substrate for DNLVLLNPEKYKAKSRSPGSPVGEGTGSPPKWQIGEQ protein kinases A and C. Alternative splicing results in EFEALMRMLDNLGYRTGYPYRYPALREKSKKYSDVEV multiple variants encoding distinct isoforms; however, PASVTGYSFASDGDSGTCSPLRHSFQKQQREKTRWL not all variants have been fully described. [provided by NSGRGDEASEEGQNGSSPKSKTKWTKEDGHRTSTSA RefSeq] VPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTAGPQS QVLCGVVMDRSLVQDAPLSDCTETIEGLELTEQTFSPA KSLSFRKGELVTASKAIIEKEYQPHVIVSTTGPNPFTTL TDRELEEYRREVERKQKGSEENLDEAREQKEKSPPD QPAVPHPPPSTPIKLEEGDGCAREYLLP
Host: Wheat Germ (in vitro)
Theoretical MW (kDa): 98.56
Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)
Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols
Preparation Method: in vitro wheat germ expression system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced
Page 1/1
Powered by TCPDF (www.tcpdf.org)