CFHR1 Monoclonal Antibody (M01), Clone 4D7

CFHR1 monoclonal antibody (M01), clone 4D7

Catalog # : H00003078-M01 規格 : [ 100 ug ] List All

Specification Application Image

Product Mouse monoclonal antibody raised against a full-length recombinant Sandwich ELISA (Recombinant protein) Description: CFHR1.

Immunogen: CFHR1 (AAH16755.1, 19 a.a. ~ 330 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence: EATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWT RITCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGY RLQNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYP enlarge SGERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPI ELISA DNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCL HPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTL RTTCWDGKLEYPTCAKR

Host: Mouse

Reactivity: Human

Isotype: IgG2b Kappa

Quality Control Antibody Reactive Against Recombinant Protein. Testing:

Storage Buffer: In 1x PBS, pH 7.4

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction:

MSDS: Download

Datasheet: Download

Publication Reference 1. Glomerular complement factor H related protein 5 (FHR5) is highly prevalent in C3 glomerulopathy and associated with renal impairment. Medjeral-Thomas NR, Moffitt H, Lomax-Browne HJ, Constantinou N, Cairns T, Cook HT, Pickering MC.Kidney Int Rep. 2019 Jun 19;4(10):1387-1400. doi: 10.1016/j.ekir.2019.06.008. eCollection 2019 Oct. 2. Electrochemical ELISA-based platform for bladder cancer protein biomarker detection in urine. Arya SK, Estrela P.Biosens Bioelectron. 2018 Oct 15;117:620-627. doi: 10.1016/j.bios.2018.07.003. Epub 2018 Jul 3. 3. Progressive IgA Nephropathy Is Associated With Low Circulating Mannan-Binding Lectin-Associated Serine Protease-3 (MASP-3) and Increased Glomerular Factor H- Related Protein-5 (FHR5) Deposition. Medjeral-Thomas NR, Troldborg A, Constantinou N, Lomax-Browne HJ, Hansen AG, Willicombe M, Pusey CD, Cook HT, Thiel S, Pickering MC.Kidney Int Rep. 2017 Nov 29;3(2):426-438. doi: 10.1016/j.ekir.2017.11.015. eCollection 2018 Mar.

Applications Sandwich ELISA (Recombinant protein) Page 1 of 2 2021/6/7 Detection limit for recombinant GST tagged CFHR1 is approximately 1ng/ml as a capture antibody. Protocol Download

ELISA

Gene Information

Entrez GeneID: 3078

GeneBank BC016755 Accession#:

Protein AAH16755.1 Accession#:

Gene Name: CFHR1

Gene Alias: CFHL,CFHL1,CFHL1P,CFHR1P,FHR1,H36-1,H36- 2,HFL1,HFL2,MGC104329

Gene complement factor H-related 1 Description:

Omim ID: 134371

Gene Ontology: Hyperlink

Other H factor (complement)-like 1,H factor (complement)-like Designations: 2,OTTHUMP00000034408,complement factor H-related 1 pseudogene

Related Disease Cardiovascular Diseases Diabetes Mellitus, Type 2 Edema Genetic Predisposition to Disease Hemolytic-Uremic Syndrome Lymphoma, Non-Hodgkin Macular Degeneration

Page 2 of 2 2021/6/7