DOCSLIB.ORG

CFHR1 Monoclonal Antibody (M01), Clone 4D7

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
CFHR1 Monoclonal Antibody (M01), Clone 4D7 CFHR1 monoclonal antibody (M01), clone 4D7 Catalog # : H00003078-M01 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a full-length recombinant Sandwich ELISA (Recombinant protein) Description: CFHR1. Immunogen: CFHR1 (AAH16755.1, 19 a.a. ~ 330 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: EATFCDFPKINHGILYDEEKYKPFSQVPTGEVFYYSCEYNFVSPSKSFWT RITCTEEGWSPTPKCLRLCFFPFVENGHSESSGQTHLEGDTVQIICNTGY RLQNNENNISCVERGWSTPPKCRSTDTSCVNPPTVQNAHILSRQMSKYP enlarge SGERVRYECRSPYEMFGDEEVMCLNGNWTEPPQCKDSTGKCGPPPPI ELISA DNGDITSFPLSVYAPASSVEYQCQNLYQLEGNKRITCRNGQWSEPPKCL HPCVISREIMENYNIALRWTAKQKLYLRTGESAEFVCKRGYRLSSRSHTL RTTCWDGKLEYPTCAKR Host: Mouse Reactivity: Human Isotype: IgG2b Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Publication Reference 1. Glomerular complement factor H related protein 5 (FHR5) is highly prevalent in C3 glomerulopathy and associated with renal impairment. Medjeral-Thomas NR, Moffitt H, Lomax-Browne HJ, Constantinou N, Cairns T, Cook HT, Pickering MC.Kidney Int Rep. 2019 Jun 19;4(10):1387-1400. doi: 10.1016/j.ekir.2019.06.008. eCollection 2019 Oct. 2. Electrochemical ELISA-based platform for bladder cancer protein biomarker detection in urine. Arya SK, Estrela P.Biosens Bioelectron. 2018 Oct 15;117:620-627. doi: 10.1016/j.bios.2018.07.003. Epub 2018 Jul 3. 3. Progressive IgA Nephropathy Is Associated With Low Circulating Mannan-Binding Lectin-Associated Serine Protease-3 (MASP-3) and Increased Glomerular Factor H- Related Protein-5 (FHR5) Deposition. Medjeral-Thomas NR, Troldborg A, Constantinou N, Lomax-Browne HJ, Hansen AG, Willicombe M, Pusey CD, Cook HT, Thiel S, Pickering MC.Kidney Int Rep. 2017 Nov 29;3(2):426-438. doi: 10.1016/j.ekir.2017.11.015. eCollection 2018 Mar. Applications Sandwich ELISA (Recombinant protein) Page 1 of 2 2021/6/7 Detection limit for recombinant GST tagged CFHR1 is approximately 1ng/ml as a capture antibody. Protocol Download ELISA Gene Information Entrez GeneID: 3078 GeneBank BC016755 Accession#: Protein AAH16755.1 Accession#: Gene Name: CFHR1 Gene Alias: CFHL,CFHL1,CFHL1P,CFHR1P,FHR1,H36-1,H36- 2,HFL1,HFL2,MGC104329 Gene complement factor H-related 1 Description: Omim ID: 134371 Gene Ontology: Hyperlink Other H factor (complement)-like 1,H factor (complement)-like Designations: 2,OTTHUMP00000034408,complement factor H-related 1 pseudogene Related Disease Cardiovascular Diseases Diabetes Mellitus, Type 2 Edema Genetic Predisposition to Disease Hemolytic-Uremic Syndrome Lymphoma, Non-Hodgkin Macular Degeneration 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2021 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 2 of 2 2021/6/7.
Load more

Recommended publications
  • Modulation of the Alternative Pathway of Complement by Murine Factor H–Related Proteins
    The Journal of Immunology Modulation of the Alternative Pathway of Complement by Murine Factor H–Related Proteins Alexandra H. Antonioli,* Janice White,† Frances Crawford,† Brandon Renner,* Kevin J. Marchbank,‡ Jonathan P. Hannan,* Joshua M. Thurman,* Philippa Marrack,†,x,{ and V. Michael Holers* Factor H (FH) is a key alternative pathway regulator that controls complement activation both in the fluid phase and on specific cell surfaces, thus allowing the innate immune response to discriminate between self and foreign pathogens. However, the interrela- tionships between FH and a group of closely related molecules, designated the FH-related (FHR) proteins, are currently not well understood. Whereas some studies have suggested that human FHR proteins possess complement regulatory abilities, recent studies have shown that FHR proteins are potent deregulators. Furthermore, the roles of the FHR proteins have not been explored in any in vivo models of inflammatory disease. In this study, we report the cloning and expression of recombinant mouse FH and three FHR proteins (FHR proteins A–C). Results from functional assays show that FHR-A and FHR-B proteins antagonize the protective function of FH in sheep erythrocyte hemolytic assays and increase cell-surface C3b deposition on a mouse kidney proximal tubular cell line (TEC) and a human retinal pigment epithelial cell line (ARPE-19). We also report apparent KD values for the binding interaction of mouse C3d with mouse FH (3.85 mM), FHR-A (136 nM), FHR-B (546 nM), and FHR-C (1.04 mM), which directly correlate with results from functional assays. Collectively, our work suggests that similar to their human counterparts, a subset of mouse FHR proteins have an important modulatory role in complement activation.
    [Show full text]
  • Complement Factor H Deficiency and Endocapillary Glomerulonephritis Due to Paternal Isodisomy and a Novel Factor H Mutation
    Genes and Immunity (2011) 12, 90–99 & 2011 Macmillan Publishers Limited All rights reserved 1466-4879/11 www.nature.com/gene ORIGINAL ARTICLE Complement factor H deficiency and endocapillary glomerulonephritis due to paternal isodisomy and a novel factor H mutation L Schejbel1, IM Schmidt2, M Kirchhoff3, CB Andersen4, HV Marquart1, P Zipfel5 and P Garred1 1Department of Clinical Immunology, Laboratory of Molecular Medicine, Rigshospitalet, Copenhagen, Denmark; 2Department of Pediatrics, Rigshospitalet, Copenhagen, Denmark; 3Department of Clinical Genetics, Rigshospitalet, Copenhagen, Denmark; 4Department of Pathology, Rigshospitalet, Copenhagen, Denmark and 5Department of Infection Biology, Leibniz Institute for Natural Product Research and Infection Biology, Jena, Germany Complement factor H (CFH) is a regulator of the alternative complement activation pathway. Mutations in the CFH gene are associated with atypical hemolytic uremic syndrome, membranoproliferative glomerulonephritis type II and C3 glomerulonephritis. Here, we report a 6-month-old CFH-deficient child presenting with endocapillary glomerulonephritis rather than membranoproliferative glomerulonephritis (MPGN) or C3 glomerulonephritis. Sequence analyses showed homozygosity for a novel CFH missense mutation (Pro139Ser) associated with severely decreased CFH plasma concentration (o6%) but normal mRNA splicing and expression. The father was heterozygous carrier of the mutation, but the mother was a non-carrier. Thus, a large deletion in the maternal CFH locus or uniparental isodisomy was suspected. Polymorphic markers across chromosome 1 showed homozygosity for the paternal allele in all markers and a lack of the maternal allele in six informative markers. This combined with a comparative genomic hybridization assay demonstrated paternal isodisomy. Uniparental isodisomy increases the risk of homozygous variations in other genes on the affected chromosome.
    [Show full text]
  • Mai Muudatuntuu Ti on Man Mini
    MAIMUUDATUNTUU US009809854B2 TI ON MAN MINI (12 ) United States Patent ( 10 ) Patent No. : US 9 ,809 ,854 B2 Crow et al. (45 ) Date of Patent : Nov . 7 , 2017 Whitehead et al. (2005 ) Variation in tissue - specific gene expression ( 54 ) BIOMARKERS FOR DISEASE ACTIVITY among natural populations. Genome Biology, 6 :R13 . * AND CLINICAL MANIFESTATIONS Villanueva et al. ( 2011 ) Netting Neutrophils Induce Endothelial SYSTEMIC LUPUS ERYTHEMATOSUS Damage , Infiltrate Tissues, and Expose Immunostimulatory Mol ecules in Systemic Lupus Erythematosus . The Journal of Immunol @(71 ) Applicant: NEW YORK SOCIETY FOR THE ogy , 187 : 538 - 552 . * RUPTURED AND CRIPPLED Bijl et al. (2001 ) Fas expression on peripheral blood lymphocytes in MAINTAINING THE HOSPITAL , systemic lupus erythematosus ( SLE ) : relation to lymphocyte acti vation and disease activity . Lupus, 10 :866 - 872 . * New York , NY (US ) Crow et al . (2003 ) Microarray analysis of gene expression in lupus. Arthritis Research and Therapy , 5 :279 - 287 . * @(72 ) Inventors : Mary K . Crow , New York , NY (US ) ; Baechler et al . ( 2003 ) Interferon - inducible gene expression signa Mikhail Olferiev , Mount Kisco , NY ture in peripheral blood cells of patients with severe lupus . PNAS , (US ) 100 ( 5 ) : 2610 - 2615. * GeneCards database entry for IFIT3 ( obtained from < http : / /www . ( 73 ) Assignee : NEW YORK SOCIETY FOR THE genecards. org /cgi - bin / carddisp .pl ? gene = IFIT3 > on May 26 , 2016 , RUPTURED AND CRIPPLED 15 pages ) . * Navarra et al. (2011 ) Efficacy and safety of belimumab in patients MAINTAINING THE HOSPITAL with active systemic lupus erythematosus : a randomised , placebo FOR SPECIAL SURGERY , New controlled , phase 3 trial . The Lancet , 377 :721 - 731. * York , NY (US ) Abramson et al . ( 1983 ) Arthritis Rheum .
    [Show full text]
  • A Hybrid CFHR3-1 Gene Causes Familial C3 Glomerulopathy
    BRIEF COMMUNICATION www.jasn.org A Hybrid CFHR3-1 Gene Causes Familial C3 Glomerulopathy †‡ Talat H. Malik,* Peter J. Lavin, Elena Goicoechea de Jorge,* Katherine A. Vernon,* | Kirsten L. Rose,* Mitali P. Patel,* Marcel de Leeuw,§ John J. Neary, Peter J. Conlon,¶ † Michelle P. Winn, and Matthew C. Pickering* *Centre for Complement and Inflammation Research, Imperial College, London, United Kingdom; †Department of Medicine, Duke University Medical Center, Durham, North Carolina; ‡Trinity Health Kidney Centre, Tallaght Hospital, Trinity College, Dublin, Ireland; §Beckman Coulter Genomics, Grenoble, France; |Department of Renal Medicine, Royal Infirmary Edinburgh, Edinburgh, United Kingdom; and ¶Department of Nephrology, Beaumont Hospital, Dublin, Ireland ABSTRACT Controlled activation of the complement system, a key component of innate immunity, that CFHR1 and CFHR3 impair comple- enables destruction of pathogens with minimal damage to host tissue. Complement ment processing within the kidney. This factor H (CFH), which inhibits complement activation, and five CFH-related proteins hypothesis would predict that an increase (CFHR1–5) compose a family of structurally related molecules. Combined deletion of in CFHR1 and CFHR3 copy number would CFHR3 and CFHR1 is common and confers a protective effect in IgA nephropathy. Here, enhance susceptibility to complement- we report an autosomal dominant complement-mediated GN associated with abnormal mediated kidney injury. Here, we report increases in copy number across the CFHR3 and CFHR1 loci. In addition to normal a novel CFHR3–1 hybrid gene located on copies of these genes, affected individuals carry a unique hybrid CFHR3–1 gene. an allele that also contained intact copies In addition to identifying an association between these genetic observations and of the CFHR1 and CFHR3 genes.
    [Show full text]
  • Cell-Deposited Matrix Improves Retinal Pigment Epithelium Survival on Aged Submacular Human Bruch’S Membrane
    Retinal Cell Biology Cell-Deposited Matrix Improves Retinal Pigment Epithelium Survival on Aged Submacular Human Bruch’s Membrane Ilene K. Sugino,1 Vamsi K. Gullapalli,1 Qian Sun,1 Jianqiu Wang,1 Celia F. Nunes,1 Noounanong Cheewatrakoolpong,1 Adam C. Johnson,1 Benjamin C. Degner,1 Jianyuan Hua,1 Tong Liu,2 Wei Chen,2 Hong Li,2 and Marco A. Zarbin1 PURPOSE. To determine whether resurfacing submacular human most, as cell survival is the worst on submacular Bruch’s Bruch’s membrane with a cell-deposited extracellular matrix membrane in these eyes. (Invest Ophthalmol Vis Sci. 2011;52: (ECM) improves retinal pigment epithelial (RPE) survival. 1345–1358) DOI:10.1167/iovs.10-6112 METHODS. Bovine corneal endothelial (BCE) cells were seeded onto the inner collagenous layer of submacular Bruch’s mem- brane explants of human donor eyes to allow ECM deposition. here is no fully effective therapy for the late complications of age-related macular degeneration (AMD), the leading Control explants from fellow eyes were cultured in medium T cause of blindness in the United States. The prevalence of only. The deposited ECM was exposed by removing BCE. Fetal AMD-associated choroidal new vessels (CNVs) and/or geo- RPE cells were then cultured on these explants for 1, 14, or 21 graphic atrophy (GA) in the U.S. population 40 years and older days. The explants were analyzed quantitatively by light micros- is estimated to be 1.47%, with 1.75 million citizens having copy and scanning electron microscopy. Surviving RPE cells from advanced AMD, approximately 100,000 of whom are African explants cultured for 21 days were harvested to compare bestro- American.1 The prevalence of AMD increases dramatically with phin and RPE65 mRNA expression.
    [Show full text]
  • Genetic Analysis of 400 Patients Refines Understanding And
    BASIC RESEARCH www.jasn.org Genetic Analysis of 400 Patients Refines Understanding and Implicates a New Gene in Atypical Hemolytic Uremic Syndrome Fengxiao Bu,1,2 Yuzhou Zhang,2 Kai Wang,3 Nicolo Ghiringhelli Borsa,2 Michael B. Jones,2 Amanda O. Taylor,2 Erika Takanami,2 Nicole C. Meyer,2 Kathy Frees,2 Christie P. Thomas,4 Carla Nester,2,4,5 and Richard J.H. Smith2,4,5 1Medical Genetics Center, Southwest Hospital, Chongqing, China; and 2Molecular Otolaryngology and Renal Research Laboratories, 3College of Public Health, 4Division of Nephrology, Department of Internal Medicine, Carver College of Medicine, and 5Department of Pediatrics, Carver College of Medicine, University of Iowa, Iowa City, Iowa ABSTRACT Background Genetic variation in complement genes is a predisposing factor for atypical hemolytic uremic syndrome (aHUS), a life-threatening thrombotic microangiopathy, however interpreting the effects of genetic variants is challenging and often ambiguous. Methods We analyzed 93 complement and coagulation genes in 400 patients with aHUS, using as controls 600 healthy individuals from Iowa and 63,345 non-Finnish European individuals from the Genome Aggre- gation Database. After adjusting for population stratification, we then applied the Fisher exact, modified Poisson exact, and optimal unified sequence kernel association tests to assess gene-based variant burden. We also applied a sliding-window analysis to define the frequency range over which variant burden was significant. Results We found that patients with aHUS are enriched for ultrarare coding variants in the CFH, C3, CD46, CFI, DGKE,andVTN genes. The majority of the significance is contributed by variants with a minor allele frequency of ,0.1%.
    [Show full text]
  • Integrated Functional Genomic Analysis Enables Annotation of Kidney Genome-Wide Association Study Loci
    BASIC RESEARCH www.jasn.org Integrated Functional Genomic Analysis Enables Annotation of Kidney Genome-Wide Association Study Loci Karsten B. Sieber,1 Anna Batorsky,2 Kyle Siebenthall,2 Kelly L. Hudkins,3 Jeff D. Vierstra,2 Shawn Sullivan,4 Aakash Sur,4,5 Michelle McNulty,6 Richard Sandstrom,2 Alex Reynolds,2 Daniel Bates,2 Morgan Diegel,2 Douglass Dunn,2 Jemma Nelson,2 Michael Buckley,2 Rajinder Kaul,2 Matthew G. Sampson,6 Jonathan Himmelfarb,7,8 Charles E. Alpers,3,8 Dawn Waterworth,1 and Shreeram Akilesh3,8 Due to the number of contributing authors, the affiliations are listed at the end of this article. ABSTRACT Background Linking genetic risk loci identified by genome-wide association studies (GWAS) to their causal genes remains a major challenge. Disease-associated genetic variants are concentrated in regions con- taining regulatory DNA elements, such as promoters and enhancers. Although researchers have previ- ously published DNA maps of these regulatory regions for kidney tubule cells and glomerular endothelial cells, maps for podocytes and mesangial cells have not been available. Methods We generated regulatory DNA maps (DNase-seq) and paired gene expression profiles (RNA-seq) from primary outgrowth cultures of human glomeruli that were composed mainly of podo- cytes and mesangial cells. We generated similar datasets from renal cortex cultures, to compare with those of the glomerular cultures. Because regulatory DNA elements can act on target genes across large genomic distances, we also generated a chromatin conformation map from freshly isolated human glomeruli. Results We identified thousands of unique regulatory DNA elements, many located close to transcription factor genes, which the glomerular and cortex samples expressed at different levels.
    [Show full text]
  • Rare Variants in the Complement Factor H–Related Protein 5 Gene Contribute to Genetic Susceptibility to Iga Nephropathy
    CLINICAL RESEARCH www.jasn.org Rare Variants in the Complement Factor H–Related Protein 5 Gene Contribute to Genetic Susceptibility to IgA Nephropathy †‡ †‡ †‡ †‡ †‡ Ya-Ling Zhai,* § Si-Jun Meng,* § Li Zhu,* § Su-Fang Shi,* § Su-Xia Wang,* § †‡ †‡ †‡ †‡ †‡ Li-Jun Liu,* § Ji-Cheng Lv,* § Feng Yu,* § Ming-Hui Zhao,* § and Hong Zhang* § *Renal Division, Department of Medicine, Peking University First Hospital, Beijing, China; †Institute of Nephrology, Peking University, Beijing, China; ‡Key Laboratory of Renal Disease, Ministry of Health of China, Beijing, China; and §Key Laboratory of Chronic Kidney Disease Prevention and Treatment (Peking University), Ministry of Education, Beijing, China ABSTRACT A recent genome–wide association study of IgA nephropathy (IgAN) identified 1q32, which contains multiple complement regulatory genes, including the complement factor H (CFH) gene and the comple- ment factor H–related (CFHRs) genes, as an IgAN susceptibility locus. Abnormal complement activation caused by a mutation in CFHR5 was shown to cause CFHR5 nephropathy, which shares many character- istics with IgAN. To explore the genetic effect of variants in CFHR5 on IgAN susceptibility, we recruited 500 patients with IgAN and 576 healthy controls for genetic analysis. We sequenced all exons and their intronic flanking regions as well as the untranslated regions of CFHR5 and compared the frequencies of identified variants using the sequence kernel association test. We identified 32 variants in CFHR5, includ- ing 28 rare and four common variants. The distribution of rare variants in CFHR5 in patients with IgAN differed significantly from that in controls (P=0.002). Among the rare variants, in silico programs predicted nine as potential functional variants, which we then assessed in functional assays.
    [Show full text]
  • Routine Use of Clinical Exome-Based Next-Generation Sequencing for Evaluation of Patients with Thrombotic Microangiopathies
    Modern Pathology (2017) 30, 1739–1747 © 2017 USCAP, Inc All rights reserved 0893-3952/17 $32.00 1739 Routine use of clinical exome-based next-generation sequencing for evaluation of patients with thrombotic microangiopathies Joseph P Gaut1,2, Sanjay Jain1,2, John D Pfeifer1, Katinka A Vigh-Conrad1, Meagan Corliss1, Mukesh K Sharma1, Jonathan W Heusel1,3 and Catherine E Cottrell1,3,4 1Department of Pathology and Immunology, Division of Anatomic and Molecular Pathology, Washington University School of Medicine, St Louis, MO, USA; 2Department of Medicine, Washington University School of Medicine, Renal Division, St Louis, MO, USA; 3Department of Genetics, Washington University School of Medicine, St Louis, MO, USA and 4Institute for Genomic Medicine, Nationwide Children’s Hospital, St Louis, MO, USA Next-generation sequencing is increasingly used for clinical evaluation of patients presenting with thrombotic microangiopathies because it allows for simultaneous interrogation of multiple complement and coagulation pathway genes known to be associated with disease. However, the diagnostic yield is undefined in routine clinical practice. Historic studies relied on case–control cohorts, did not apply current guidelines for variant pathogenicity assessment, and used targeted gene enrichment combined with next-generation sequencing. A clinically enhanced exome, targeting ~ 54 Mb, was sequenced for 73 patients. Variant analysis and interpretation were performed on genes with biological relevance in thrombotic microangiopathy (C3, CD46, CFB, CFH, CFI, DGKE, and THBD). CFHR3-CFHR1 deletion status was also assessed using multiplex ligation-dependent probe amplification. Variants were classified using American College of Medical Genetics and Genomics guidelines. We identified 5 unique novel and 14 unique rare variants in 25% (18/73) of patients, including a total of 5 pathogenic, 4 likely pathogenic, and 15 variants of uncertain clinical significance.
    [Show full text]
  • Qt04m4702n Nosplash 808Bca
    ARTICLE https://doi.org/10.1038/s41467-020-14499-3 OPEN Increased circulating levels of Factor H-Related Protein 4 are strongly associated with age-related macular degeneration Valentina Cipriani 1,2,3,4,16*, Laura Lorés-Motta5,16, Fan He 6, Dina Fathalla 7, Viranga Tilakaratna6, Selina McHarg6, Nadhim Bayatti6, İlhan E. Acar 5, Carel B. Hoyng5, Sascha Fauser8,9, Anthony T. Moore2,3,10, John R.W. Yates2,3,11, Eiko K. de Jong 5, B. Paul Morgan7,17, Anneke I. den Hollander 5,12,17, Paul N. Bishop6,13,17 & Simon J. Clark 6,14,15,17* 1234567890():,; Age-related macular degeneration (AMD) is a leading cause of blindness. Genetic variants at the chromosome 1q31.3 encompassing the complement factor H (CFH,FH)andCFH related genes (CFHR1-5) are major determinants of AMD susceptibility, but their molecular consequences remain unclear. Here we demonstrate that FHR-4 plays a prominent role in AMD pathogenesis. We show that systemic FHR-4 levels are elevated in AMD (P-value = 7.1 × 10−6), whereas no difference is seen for FH. Furthermore, FHR-4 accumulates in the choriocapillaris, Bruch’s membrane and drusen, and can compete with FH/FHL-1 for C3b binding, preventing FI-mediated C3b cleavage. Critically, the protective allele of the strongest AMD-associated CFH locus variant rs10922109 has the highest association with reduced FHR-4 levels (P-value = 2.2 × 10−56), independently of the AMD-protective CFHR1–3 deletion, and even in those individuals that carry the high-risk allele of rs1061170 (Y402H). Our findings identify FHR-4 as a key molecular player contributing to comple- ment dysregulation in AMD.
    [Show full text]
  • CFHR Gene Variations Provide Insights in the Pathogenesis of the Kidney Diseases Atypical Hemolytic Uremic Syndrome and C3 Glomerulopathy
    REVIEW www.jasn.org CFHR Gene Variations Provide Insights in the Pathogenesis of the Kidney Diseases Atypical Hemolytic Uremic Syndrome and C3 Glomerulopathy Peter F. Zipfel ,1,2 Thorsten Wiech,3 Emma D. Stea,1 and Christine Skerka 1 1Department of Infection Biology, Leibniz Institute for Natural Product Research and Infection Biology, Jena, Germany; 2Institute of Microbiology, Friedrich-Schiller-University, Jena, Germany; and 3Section of Nephropathology, Institute of Pathology, University Hospital Hamburg-Eppendorf, Hamburg, Germany ABSTRACT Sequence and copy number variations in the human CFHR–Factor H gene cluster regulation on endothelial surfaces and comprising the complement genes CFHR1, CFHR2, CFHR3, CFHR4, CFHR5, and fluid-phase regulation remains intact. In Factor H are linked to the human kidney diseases atypical hemolytic uremic syn- C3 glomerulopathy, FHR mutants in the drome (aHUS) and C3 glomerulopathy. Distinct genetic and chromosomal alter- context of intact Factor H and FHL1 (the ations, deletions, or duplications generate hybrid or mutant CFHR genes, as well Factor H–like protein) affect complement as hybrid CFHR–Factor H genes, and alter the FHR and Factor H plasma repertoire. regulation in the fluid phase and on the A clear association between the genetic modifications and the pathologic outcome glomerular surface, and FHR mutants is emerging: CFHR1, CFHR3,andFactor H gene alterations combined with intact with duplicated interaction segments CFHR2, CFHR4,andCFHR5 genes are reported in atypical hemolytic uremic syn- form large oligomers, which deregulate drome. But alterations in each of the five CFHR genes in the context of an intact complement and compete with Factor H Factor H gene are described in C3 glomerulopathy.
    [Show full text]
  • Downloaded in October 2016) Were Retained for The
    bioRxiv preprint doi: https://doi.org/10.1101/432823; this version posted October 8, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. GENETIC AND EPIGENETIC FINE MAPPING OF COMPLEX TRAIT ASSOCIATED LOCI IN THE HUMAN LIVER Minal Çalışkan1,2*, Elisabetta Manduchi3,4,5, H. Shanker Rao1,2, Julian A Segert1, Marcia Holsbach Beltrame1, Marco Trizzino1, YoSon Park1, Samuel W Baker1, Alessandra Chesi3,4, Matthew E Johnson3,4, Kenyaita M Hodge3,4, Michelle E Leonard3,4, Baoli Loza6, Dong Xin6, Andrea M Berrido1, Nicholas J Hand1, Robert C Bauer7, Andrew D Wells4,8, Kim M Olthoff6, Abraham Shaked6, Daniel J Rader1,9, Struan FA Grant1,3,4,10, Christopher D Brown1,2* 1Department of Genetics, Perelman School of Medicine, University of Pennsylvania, Philadelphia, PA, 19104, USA 2Institute for Biomedical Informatics, Perelman School of Medicine, University of Pennsylvania, Philadelphia, PA, 19104, USA 3Division of Human Genetics, The Children's Hospital of Philadelphia, Philadelphia, PA, 19104, USA 4Center for Spatial and Functional Genomics, The Children's Hospital of Philadelphia, Philadelphia, PA, 19104, USA 5Department of Biostatistics, Epidemiology, & Informatics, Perelman School of Medicine, University of Pennsylvania, Philadelphia, PA, 19104, USA 6Division of Transplant Surgery, Perelman School of Medicine, University of Pennsylvania, Philadelphia, PA, 19104,
    [Show full text]