DOCSLIB.ORG

(12) Patent Application Publication (10) Pub. No.: US 2005/0239706A1 Backhed Et Al

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
(12) Patent Application Publication (10) Pub. No.: US 2005/0239706A1 Backhed Et Al US 2005O2397O6A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2005/0239706A1 Backhed et al. (43) Pub. Date: Oct. 27, 2005 (54) MODULATION OF FIAF AND THE Related U.S. Application Data GASTRONTESTINAL MICROBOTAASA MEANS TO CONTROL ENERGY STORAGE (63) Continuation-in-part of application No. 10/432,819, INA SUBJECT filed on Oct. 31, 2003. (75) Inventors: Fredrik Backhed, St. Louis, MO (US); (60) Provisional application No. 60/591.313, filed on Jul. John Rawls, St. Louis, MO (US); 27, 2004. Justin Sonnenburg, St. Louis, MO (US); Lora V. Hooper, Coppell, TX Publication Classification (US); Jeffrey I. Gordon, St. Louis, MO (US) (51) Int. Cl. ................................................. A61K 38/17 (52) U.S. Cl. ................................................................ 514/12 Correspondence Address: POLSINELL SHALTON WELTE (57) ABSTRACT SUELTHAUS PC. 700 W. 47TH STREET The invention provides compositions and methods to modu SUTE 1000 late fat Storage and weight loSS in a Subject. In certain KANSAS CITY, MO 64112-1802 (US) aspects of the invention, fat storage (adiposity) and weight (73) Assignee: Washington University in St. Louis loSS is modulated by altering the Subject's gastrointestinal microbiota population. In other aspects of the invention, fat (21) Appl. No.: 11/080,755 Storage and weight loSS is modulated by altering the amount of or the activity of the protein, fasting-induced adipocyte (22) Filed: Mar. 15, 2005 factor, in the Subject. B 1 2 5 10 2 5 a 4 WAT Heart 2 ? g3 52 5 al - O &sCS ésO C G D 2 F. 80 g5 150 3560in see a C- t sq 100 o 40 5 so 3 as). We 8.3 kb Neo 2320 & S. S. s' probe 3. ++ +- -- s SSSSSS in a 7 anis Fiafiafgenotype See of 4 + v. Patent Application Publication Oct. 27, 2005 Sheet 1 of 41 US 2005/0239706A1 Fig. 1 Epithelium Mesenchyme Before capture Before capture Patent Application Publication Oct. 27, 2005 Sheet 2 of 41 US 2005/0239706A1 Fig. 2 spr2a OOO 8O SOO 40. 2O Colipase 8O SO O O 1.5 1.O O cS isN tS isN tS isN. vius crypt se epithelium chyne Patent Application Publication Oct. 27, 2005 Sheet 3 of 41 US 2005/0239706A1 Fig. 3 lactase O OB OS OA O2 Golipase angiogenin-3 O 2 OO V 50 Patent Application Publication Oct. 27, 2005 Sheet 4 of 41 US 2005/0239706A1 Figure 4: Angiogenin-4 and -3 nucleotide sequence alignment angiogeniu- l -gaacrracaceaasaccorsiclecassascacacagorasacriticariccaeill 2. t s angiogeniu-3 Cuscicarecscacisco Stecca'ssacACSAASCUAACACAccCCs Consensus agott adao Og aggadootgtotodaggagdao agotaged to to go to g 6. Bl 9. ill angiogenin- Sec.ScGSCCGCSA CAAccCAS analogerlin-3 TSGAGSAAGonggccaccTLSSAATCGEAAG start Casersus ttggaggaaagatggoopagotttggaatu stgttgaaagagats atgagtega st 2 lil s lsi augiogenil- s (CPS angiogenit-3 exact sect CC sease NCAGS-Ace ecCACNGCCF Cascal Coasess otttgttgttggtott tutg gttctg. ittgat oatge actatggotoag at l 2D 2. 2. angiogenin-s gaa-...--AGGTACGAAAAATTCCTACGICAGCACIAGATGCCAASCCAAAGGGCCGGGac angiogenin-3 AACTACASGAAAAAAccreacticaGCACAARSCCAGCCACCSCCGSGAE Consensus aggtao aaaattgot to aggagtatatgcaa.go Gala godggga 2. as s 2. 2B 2. anoriocrenit-4Ai is Cussless al 3. 32. 33 3. 35. angiogenil anogenin-5 a Salf Yu is a WAY is v Y WAY Wor Consensus aaoacotttat datg tado agaa aadata go oatatgttgga agaa gigaag 35 37 3. 3 4. angiogeniu-4. CCITATGGAGAAAACTTCAGAATAASCAATTCTCCCTCCAGATCACGACTTGEACGCAC angiogenin-3 ce accusetta seates Cease Consensus gettatag aaa.ott agaataagaattute tteoag to assactites augao s2. s t 45 3. angiogenia- ICAAGAGGGIGLXCCCLX3GCGTCGAIGCGSGIACCGAgCCTTTAAASATTCAGACATAT angiogen-3 Acciacoscoes seccuccius CAct Costases a gagggittgct giggoto gatga gtag gotstttaaagattittaga atatt El al SO 52 3. creat- graecceeaaga SCCEGGCGNPCCAcacca's Crack GE E-3 Gasco SGAEGSGCGGCCXCCNCCASCANAGIC stop Consensus ttattooitgttgaagatggotggaetgtoca uttegatagtotttitato agbo cigtag E. iogenin- eccleocococcCaesacagogic coccacAcces Willis CASCGCCCCCGCACAGACCASPSPs acceCCCAcces Corpseuss aigiocreli Eli s sy, A., M. War. O Consensus atgaatgttca d tactitta giged tgaattatuttgaaatatattot 55 S. 7. ogeniu-4 ccTCATIATAATGCACASAAAAAAGATATOEXCAAAAMCCATAAAAAAAAAAAAAAAAA EEis CCS is a GCACSAAAAAAAACAAAAACAAAAAAAA----------- sees got atttataatguagagaaataaagatatotaaraa dua aaaaaa 72. 73 7. 75 7. 77 angiogenail- ABAAAAAAA SEQDNO29 aloren-3 --------- SEOD NO30 Cocsetes Patent Application Publication Oct. 27, 2005 Sheet 5 of 41 US 2005/0239706A1 Figure 5: Alignment of mouse angi genin family members l ll 2. 3. 4. angiogenin TiSPCPFFWGYWPTA-IRYKFIREDAKKRDDRC angiogenin ASGPLF,F,GVWFADDSETEFTDARPERDDRYC angiogelin-3 EVESFGSLLIVFLISLDVIPPTLAnNYRYIKFTTEYDAKPTGRDYRYC angiogenin RB ESPGPLFFFTLGVWPPTSDDSKYKFTYEAKPKGRDDRYC Conseals In mappillwflglwvipptland ry kfilthydarpkgridryc 5 5. 7. Bl 9. angiogenin-6 ESSKERKLTSPCKDWTFEGTKKRRICKKGSPYEREISNSPF angiogelin-l ERKRRSLTSPCKDYRTFEG, KSRRAICG.GSPYRNassPFC ESKKRKTSPCKETFESTKRRKACGETRYGFRSNESRF Esi KRRTSFCKDWTFETKRKACGESPYRIRISKRF esmkrkltepckdwateih tk nikai.cg aspyg n ris B to lol lill 2. 3. l SEID angiogelin-6 TTCTBSRGSPPPCGRFKDRWADGEESFS 3 . angiogenin WTTKTGGSFRPFCYRASAGFREWWACEGLUEFDESEFSI. 32 angiogenin-3 vTTCTHKGGSPRPPCOYNAFKDFRYIVLACEDCPVHFDESFISP 33 angiogenir WTTCTERGRSPRPPCRRASKGFRIIIGCEGFWBFDESISP 34 CDs easis wittcth ggsprppc yra k fryiviace gapvhfdesfisp Patent Application Publication Oct. 27, 2005 Sheet 6 of 41 US 2005/0239706A1 Fig. 6 Locations of primers specific for mouse angiogenin family members angiogenin-d angiogenin-3 angiogenin-1 i angiogening? Consensus angiogenin-d angiogenit-3 angiogenin-1. angiogenin RP Consensus O). ll l2 3. 4. angiogenin-4 ACGS RS angiogenin-3 angiogenin-1 : W angiogeninrPSA Consensus 15 l6 l 8. 19 angiogenin-4 angiogenin-3 angiogenil angiogeninkp SS SittigiassissiTTEgg Consensus gaaagtatgatgaagaaaagaaagctaaccto co tigcaaagatgtcaa 20 21 22 23. 24l angiogenin-d angiogenin-3 angiogeninri angiogen?inEP 35 OE. E. s Consensus cacctttatcCatg ceccaagaacaa.catceaeggc.catctgtgga age 2S 25i 27 28 29 angiogenin-d Saayaaaass s s angiogenin-3 T. angiogenin-i alagiotein Siii.55:iii.5iSigEcESi3S2, Consensus a gigaegcc.cttatggag aaactu agaataegcaa tactc ctitccag 30 3. 32. 34 angiogenium-4 E332 says: saxa se:sawaxy's angiogenin-3 angiogenin-1 angiogenirrP Consensus 35 36 3. 38 39 angiogenin f - area 3. angiogenin-3 &E. M angiogenin-1 E. angiogenin RP C Casess SEO O NO. angiogenil- 61 angiogenin-3 62 angiogenin-1 63 angiogenin RP Egg 64 Consensus ggcc tigtocacttcgatgegtCttittetcagtcc tag Patent Application Publication Oct. 27, 2005 Sheet 7 of 41 US 2005/0239706A1 Figure 7: Tissue distribution of Angiogenin-4 mRNA qRT-PCR analysis: 6.0 S.O Agarose gel analysis (with Gapdh control) Patent Application Publication Oct. 27, 2005 Sheet 8 of 41 US 2005/0239706A1 Figure 8: Tissue distribution of angiogenin-1 mRNA qRT-PCR analysis: Patent Application Publication Oct. 27, 2005 Sheet 9 of 41 US 2005/0239706A1 Figure 9: Tissue distribution of angiogenin-3 mRNA Quantitative real-time RT-PCR analysis: Patent Application Publication Oct. 27, 2005 Sheet 10 of 41 US 2005/0239706A1 Figure 10: RT-PCR analysis showing absence of angiogenin-related protein expression - as a 2 a SA 2 S 22 R as & R & K SS bp 194 194 118- 18 72- -72 expected amplicon size: 130 bp Note that Gapdh expression levels for each of these tissues are shown in Figure 4 l. distal small 14. brain 2. middle Small S. heart 3. proximal small 16. bladder 4. Squamous 17. skin 5. glandular stomach 18. tranchealthyroid 6. ascending colon 19. pancreas 7. descending colon 20. Salivary gland 8. rect 21. testes 9. Cec 22. prostate 10. kidney 23. ovary 11. liver 24. uterus 12. lung 25. mammary gland 13. spleen w 26. genomic DNA 27. Water Patent Application Publication Oct. 27, 2005 Sheet 11 of 41 US 2005/0239706A1 Figure 11: Microbial regulation of angiogenin-4 expression in the small intestine Pair 1 -0-germ-free ys -- conventionalized8 is asi gs s 3 5 7 9 11 13 15 intestinal segment Pair 2 2.5 w -0-germ-free 2.0 -- conventionalized S. s 15 s 3. 1.0 O. 5 O. O 1 3 5. 7 9 11 13 15 inte tinals gment Patent Application Publication Oct. 27, 2005 Sheet 12 of 41 US 2005/0239706A1 Figure 12 Regulation of angiogenin-4 expression during postnatal development germ-free 11 5 10 15 20. 25 30 days after birth Patent Application Publication Oct. 27, 2005 Sheet 13 of 41 US 2005/0239706A1 Figure 13 Cellular localization of angiogenin-4 expression in small intestige: qRT-PCR analysis feels is lated from the crypt base wild-type CR2-tox176 (lacking Paneth mouse strain Patent Application Publication Oct. 27, 2005 Sheet 14 of 41 US 2005/0239706A1 Figs. 14A-14D <C(%)qe?ÁpOG O (Kep/6)uo?duunsu00MO?O LO<+croÇN•Q.D. Patent Application Publication Oct. 27, 2005 Sheet 15 of 41 US 2005/0239706A1 Figs. 15A-15C eye A 3 15 12 2 2 2 1.0 8 CD cy S c 8 1 0.5 2 4 - (D O O $ S dš -NQ S S OS C C i? CONV-D C B 300 -- GF 100 () r g 8 75 g200 o e CD 50 f 8 100 2 as 25 CD O SS O O 3O 6O 90 120 O 30 6O 90 120 time (min) time (min) Patent Application Publication Oct. 27, 2005 Sheet 16 of 41 US 2005/0239706A1 Figs. 16A-16D rt G in t S15 g D E a g 200 c 10 SS 22 100 9> 5 E3ed & 9 O eso D ChREBP 5 Patent Application Publication Oct. 27, 2005 Sheet 17 of 41 US 2005/0239706A1 Fig. 17A-17F A B 125 $5100 de 2 75 is59 50 E23 25 C o CC cr’ sS. (° 3 4 WA Heart 2. arra g3 S 52 s 5 o s $sCS &sC D 2 F. 80 5 150 gas 60 a g g t sq 100 o 40 6 sol E3 r as c 8.3 kb gi20 O .S. c. X Martinspotte see-H*3. ++ + -i- *S. \s S if 47 gi Fiafgenotype w Souther to Norther to 0-f v- 84 -- - -- Patent Application Publication Oct. 27, 2005 Sheet 18 of 41 US 2005/0239706A1 Fig. 18 increased hepatic u-1 (ChREBPISREBP-1)lipogenesis Processing of dietary Microbial u- polysaccharides colonization of the gut Suppression of u s Fiaf in the gut Triglyceride epithelium LPL activity - adipocytesstorage in Patent Application Publication Oct. 27, 2005 Sheet 19 of 41 US 2005/023970.6 A1 Fig.
Load more

Recommended publications
  • Clostridium Aerotolerans Sp
    INTERNATIONALJOURNAL OF SYSTEMATICBACTERIOLOGY, Apr. 1987, p. 102-105 Vol. 37, No. 2 0020-7713/87/020102-04$02.OO/O Copyright 0 1987, International Union of Microbiological Societies Clostridium aerotolerans sp. nov. a Xylanolytic Bacterium from Corn Stover and from the Rumina of Sheep Fed Corn Stover N. 0. VAN GYLSWYK" AND J. J. T. K. VAN DER TOORN Anaerobic Microbiology Division, Laboratory for Molecular and Cell Biology, Onderstepoort 01 10, South Africa Two strains of sporeforming, xylan-digesting, rod-shaped bacteria were isolated from a lo-* dilution of rumen ingesta taken from two sheep fed a corn stover ration. To determine the source of these strains, we examined the corn stover and isolated two strains of similar bacteria from it. The four strains were remarkably tolerant to oxygen although they did not grow in liquid medium that was shaken while exposed to air. They fermented a wide variety of carbon sources and produced formic, acetic, and lactic acids, ethanol, carbon dioxide, and hydrogen from xylan. The deoxyribonucleic acid base composition was 40 mol% guanine plus cytosine. The name proposed for these strains is Clostridiurn aerotolerans; the type strain is strain XSA62 (ATCC 43524). Two strains of sporeforming bacteria were found among a in which glucose (5 g/liter) replaced xylan. Spores were large number of bacteria isolated from colonies that pro- stained with malachite green (10). Motility was determined duced clearing zones in xylan (3%) agar medium inoculated after cells were grown overnight on maintenance slants. with a loh8 dilution of rumen ingesta from sheep fed corn Growth in basal medium containing cellobiose (5 g/liter) stover diets (14) as briefly described by van der Toorn and from which reducing agent (cysteine and sulfide) had been vim Gylswyk (15).
    [Show full text]
  • • Glycolysis • Gluconeogenesis • Glycogen Synthesis
    Carbohydrate Metabolism! Wichit Suthammarak – Department of Biochemistry, Faculty of Medicine Siriraj Hospital – Aug 1st and 4th, 2014! • Glycolysis • Gluconeogenesis • Glycogen synthesis • Glycogenolysis • Pentose phosphate pathway • Metabolism of other hexoses Carbohydrate Digestion! Digestive enzymes! Polysaccharides/complex carbohydrates Salivary glands Amylase Pancreas Oligosaccharides/dextrins Dextrinase Membrane-bound Microvilli Brush border Maltose Sucrose Lactose Maltase Sucrase Lactase ‘Disaccharidase’ 2 glucose 1 glucose 1 glucose 1 fructose 1 galactose Lactose Intolerance! Cause & Pathophysiology! Normal lactose digestion Lactose intolerance Lactose Lactose Lactose Glucose Small Intestine Lactase lactase X Galactose Bacteria 1 glucose Large Fermentation 1 galactose Intestine gases, organic acid, Normal stools osmotically Lactase deficiency! active molecules • Primary lactase deficiency: อาการ! genetic defect, การสราง lactase ลด ลงเมออายมากขน, พบมากทสด! ปวดทอง, ถายเหลว, คลนไสอาเจยนภาย • Secondary lactase deficiency: หลงจากรบประทานอาหารทม lactose acquired/transient เชน small bowel เปนปรมาณมาก เชนนม! injury, gastroenteritis, inflammatory bowel disease! Absorption of Hexoses! Site: duodenum! Intestinal lumen Enterocytes Membrane Transporter! Blood SGLT1: sodium-glucose transporter Na+" Na+" •! Presents at the apical membrane ! of enterocytes! SGLT1 Glucose" Glucose" •! Co-transports Na+ and glucose/! Galactose" Galactose" galactose! GLUT2 Fructose" Fructose" GLUT5 GLUT5 •! Transports fructose from the ! intestinal lumen into enterocytes!
    [Show full text]
  • Structure, Function, and Regulation of Intestinal Lactase-Phlorizin Hydrolase and Sucrase- Isomaltase in Health and Disease
    Gastrointestinal Functions, edited by Edgard E. Delvin and Michael J. Lentze. Nestle Nutrition Workshop Series, Pediatric Program, Vol. 46. Nestec Ltd.. Vevey/Lippincott Williams & Wilkins. Philadelphia © 2001. Structure, Function, and Regulation of Intestinal Lactase-Phlorizin Hydrolase and Sucrase- Isomaltase in Health and Disease Hassan Y. Nairn Department of Physiological Chemistry, School of Veterinary Medicine Hannover, Hannover, Germany Carbohydrates are essential constituents of the mammalian diet. They occur as oligosaccharides, such as starch and cellulose (plant origin), as glycogen (animal origin), and as free disaccharides such as sucrose (plant) and lactose (animal). These carbohydrates are hydrolyzed in the intestinal lumen by specific enzymes to mono- saccharides before transport across the brush border membrane of epithelial cells into the cell interior. The specificity of the enzymes is determined by the chemical structure of the carbohydrates. The monosaccharide components of most of the known carbohydrates are linked to each other in an a orientation. Examples of this type are starch, glycogen, sucrose, and maltose. (3-Glycosidic linkages are minor. Nevertheless, this type of covalent bond is present in one of the major and most essential carbohydrates in mammalian milk, lactose, which constitutes the primary diet source for the newborn. The enzymes implicated in the digestion of carbohydrates in the intestinal lumen are membrane-bound glycoproteins that are expressed at the apical or microvillus membrane of the enterocytes (1-3). In this chapter, the structural and biosynthetic features of the most important disaccharidases, sucrase-isomaltase and lac- tase-phlorizin hydrolase, and the molecular basis of sugar malabsorption (i.e., en- zyme deficiencies) are discussed.
    [Show full text]
  • Modulation of the Gut Microbiota Alters the Tumour-Suppressive Efficacy of Tim-3 Pathway Blockade in a Bacterial Species- and Host Factor-Dependent Manner
    microorganisms Article Modulation of the Gut Microbiota Alters the Tumour-Suppressive Efficacy of Tim-3 Pathway Blockade in a Bacterial Species- and Host Factor-Dependent Manner Bokyoung Lee 1,2, Jieun Lee 1,2, Min-Yeong Woo 1,2, Mi Jin Lee 1, Ho-Joon Shin 1,2, Kyongmin Kim 1,2 and Sun Park 1,2,* 1 Department of Microbiology, Ajou University School of Medicine, Youngtongku Wonchondong San 5, Suwon 442-749, Korea; [email protected] (B.L.); [email protected] (J.L.); [email protected] (M.-Y.W.); [email protected] (M.J.L.); [email protected] (H.-J.S.); [email protected] (K.K.) 2 Department of Biomedical Sciences, The Graduate School, Ajou University, Youngtongku Wonchondong San 5, Suwon 442-749, Korea * Correspondence: [email protected]; Tel.: +82-31-219-5070 Received: 22 August 2020; Accepted: 9 September 2020; Published: 11 September 2020 Abstract: T cell immunoglobulin and mucin domain-containing protein-3 (Tim-3) is an immune checkpoint molecule and a target for anti-cancer therapy. In this study, we examined whether gut microbiota manipulation altered the anti-tumour efficacy of Tim-3 blockade. The gut microbiota of mice was manipulated through the administration of antibiotics and oral gavage of bacteria. Alterations in the gut microbiome were analysed by 16S rRNA gene sequencing. Gut dysbiosis triggered by antibiotics attenuated the anti-tumour efficacy of Tim-3 blockade in both C57BL/6 and BALB/c mice. Anti-tumour efficacy was restored following oral gavage of faecal bacteria even as antibiotic administration continued. In the case of oral gavage of Enterococcus hirae or Lactobacillus johnsonii, transferred bacterial species and host mouse strain were critical determinants of the anti-tumour efficacy of Tim-3 blockade.
    [Show full text]
  • Detoxification of Lignocellulose-Derived Microbial Inhibitory Compounds by Clostridium Beijerinckii NCIMB 8052 During Acetone-Butanol-Ethanol Fermentation
    Detoxification of Lignocellulose-derived Microbial Inhibitory Compounds by Clostridium beijerinckii NCIMB 8052 during Acetone-Butanol-Ethanol Fermentation DISSERTATION Presented in Partial Fulfillment of the Requirements for the Degree Doctor of Philosophy in the Graduate School of The Ohio State University By Yan Zhang Graduate Program in Animal Sciences The Ohio State University 2013 Dissertation Committee: Thaddeus C. Ezeji, Advisor Steven C. Loerch Sandra G. Velleman Zhongtang Yu Venkat Gopalan Copyrighted by Yan Zhang 2013 Abstract Pretreatment and hydrolysis of lignocellulosic biomass to fermentable sugars generate a complex mixture of microbial inhibitors such as furan aldehydes (e.g., furfural), which at sublethal concentration in the fermentation medium can be tolerated or detoxified by acetone butanol ethanol (ABE)-producing Clostridium beijerinckii NCIMB 8052. The response of C. beijerinckii to furfural at the molecular level, however, has not been directly studied. Therefore, this study was to elucidate mechanism employed by C. beijerinckii to detoxify lignocellulose-derived microbial inhibitors and use this information to develop inhibitor-tolerant C. beijerinckii. Towards the long-term goal of developing inhibitor-tolerant Clostridium strains, the first objective was to evaluate ABE fermentation by C. beijerinckii using different proportions of Miscanthus giganteus hydrolysates as carbon source. Compared to the growth of C. beijerinckii in control medium, C. beijerinckii experienced different degrees of inhibition. The degree of inhibition was dose-dependent, and C. beijerinckii did not grow in P2 medium with greater than 25% (v/v) Miscanthus giganteus hydrolysates. To improve tolerance of C. beijerinckii to inhibitors, supplementation of P2 medium with undiluted (100%) Miscanthus giganteus hydrolysates with 4 g/L CaCO3 resulted in successful growth of and ABE production by C.
    [Show full text]
  • The Proteolytic Systems of Ruminal Microorganisms Rj Wallace
    The proteolytic systems of ruminal microorganisms Rj Wallace To cite this version: Rj Wallace. The proteolytic systems of ruminal microorganisms. Annales de zootechnie, INRA/EDP Sciences, 1996, 45 (Suppl1), pp.301-308. hal-00889635 HAL Id: hal-00889635 https://hal.archives-ouvertes.fr/hal-00889635 Submitted on 1 Jan 1996 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. The proteolytic systems of ruminal microorganisms RJ Wallace Rowett Research Institute, Bucksburn, Aberdeen AB2 9SB, UK Protein breakdown in the rumen is generally the breakdown process and assesses the regarded as detrimental to the efficiency of relative importance of different species in the ruminant nutrition, certainly for animals on a light of population densities and the properties relatively high plane of nutrition. Peptides and of the mixed rumen population. amino acids arising from proteolysis are potential nutrients for the growth of rumen microorganisms, but they are also liable to be Proteolytic ruminal microorganisms degraded to ammonia and lost from the rumen. Proteolytic activity occurs in all three main The mixed rumen microbial population has a categories of rumen microorganisms. Bacteria proteolytic activity that is only moderate are mainly responsible for dietary protein compared with other proteolytic micro- breakdown, while ciliate protozoa break down organisms and the host’s own gastric and particulate feed protein of appropriate size and pancreatic secretions, but the length of time also bacterial protein.
    [Show full text]
  • Antibitoic Treatment for Tuberculosis Induces a Profound Dysbiosis of the Gut Microbiome That Persists Long After Therapy Is Completed
    ANTIBITOIC TREATMENT FOR TUBERCULOSIS INDUCES A PROFOUND DYSBIOSIS OF THE GUT MICROBIOME THAT PERSISTS LONG AFTER THERAPY IS COMPLETED A Thesis Presented to the Faculty of the Weill Cornell Graduate School of Medical Sciences in Partial Fulfillment of the Requirements for the Degree of Masters of Science by Matthew F. Wipperman May 2017 © 2017 Matthew F. Wipperman ABSTRACT Mycobacterium tuberculosis, the cause of Tuberculosis (TB), infects one third of the world’s population and causes substantial mortality worldwide. In its shortest format, treatment of drug sensitive TB requires six months of multidrug therapy with a mixture of broad spectrum and mycobacterial specific antibiotics, and treatment of multidrug resistant TB is much longer. The widespread use of this regimen worldwide makes this one the largest exposures of humans to antimicrobials, yet the effects of antimycobacterial agents on intestinal microbiome composition and long term stability are unknown. We compared the microbiome composition, assessed by both 16S rDNA and metagenomic DNA sequencing, of Haitian TB cases during antimycobacterial treatment and following cure by 6 months of TB therapy. TB treatment does not perturb overall diversity, but nonetheless dramatically depletes multiple immunologically significant commensal bacteria. The perturbation by TB therapy lasts at least 1.5 years after completion of treatment, indicating that the effects of TB treatment are long lasting and perhaps permanent. These results demonstrate that TB treatment has dramatic and durable effects on the intestinal microbiome and highlight unexpected extreme consequences of treatment for the world’s most common infection on human ecology. BIOGRAPHICAL SKETCH NAME POSITION TITLE Wipperman, Matthew Frederick Postdoctoral Researcher at eRA COMMONS USER NAME Memorial Sloan Kettering Cancer Center MFWIPPERMAN DEGREE INSTITUTION AND (if MM/YY FIELD OF STUDY LOCATION applicable) Franklin & Marshall College B.A.
    [Show full text]
  • Carbohydrate Metabolism
    CARBOHYDRATE METABOLISM By Prof. Dr SOUAD M. ABOAZMA MEDICAL BIOCHEMISTRY DEP. Digestion of carbohydrate The principle sites of carbohydrate digestion are the mouth and small intestine. The dietary carbohydrate consist of : • polysaccharides : Starch, glycogen and cellulose • Disaccharides : Sucrose and Lactose • Monosaccharides : Mainly glucose and fructose monosaccharides need no digestion prior to absorption, wherease disaccharides and polysaccharides must be hydrolysed to simple sugars before their absorption. DIGESTION OF CARBOHYDRATE •Salivary amylase partially digests starch and glycogen to dextrin and few maltoses. It acts on cooked starch. •Pancreatic amylase completely digests starch, glycogen, and dextrin with help of 1: 6 splitting enzyme into maltose and few glucose. It acts on cooked and uncooked starch. Amylase enzyme is hydrolytic enzyme responsible for splitting α 1: 4 glycosidic link. •Cellulose is not digested due to absence of β-glucosidase •Maltase, lactase and sucrase are enzymes secreted from intestinal mucosa, which hydrolyses the corresponding disaccharides to produce glucose, fructose, and galactose. •HCl secreted from the stomach can hydrolyse the disaccharides and polysaccharides. ABSORPTION OF MONOSACCHARIDES •Simple absorption (passive diffusion): The absorption depends upon the concentration gradient of sugar between intestinal lumen and intestinal mucosa. This is true for all monosaccharides especially fructose & pentoses. •Facilitative diffusion by Na+-independent glucose transporter system (GLUT5). There are mobile carrier proteins responsible for transport of fructose, glucose, and galactose with their conc. gradient. •Active transport by sodium-dependent glucose transporter system (SGLUT1). In the intestinal cell membrane there is a mobile carrier protein coupled with Na+- K+ pump. The carrier protein has 2 separate sites one for Na+ ,the other for glucose.
    [Show full text]
  • Hygiene Aspects of the Biogas Process with Emphasis on Spore-Forming Bacteria
    Hygiene Aspects of the Biogas Process with Emphasis on Spore-Forming Bacteria Elisabeth Bagge Department of Bacteriology, National Veterinary Institute and Faculty of Veterinary Medicine and Animal Sciences Department of Biomedical Sciences and Veterinary Public Health Uppsala Doctoral Thesis Swedish University of Agricultural Sciences Uppsala 2009 Acta Universitatis Agriculturae Sueciae 2009:28 Cover: Västerås biogas plant (photo: E. Bagge, November 2006) ISSN 1652-6880 ISBN 978-91-86195-75-5 © 2009 Elisabeth Bagge, Uppsala Print: SLU Service/Repro, Uppsala 2009 Hygiene Aspects of the Biogas Process with Emphasis on Spore-Forming Bacteria Abstract Biogas is a renewable source of energy which can be obtained from processing of biowaste. The digested residues can be used as fertiliser. Biowaste intended for biogas production contains pathogenic micro-organisms. A pre-pasteurisation step at 70°C for 60 min before anaerobic digestion reduces non spore-forming bacteria such as Salmonella spp. To maintain the standard of the digested residues it must be handled in a strictly hygienic manner to avoid recontamination and re-growth of bacteria. The risk of contamination is particularly high when digested residues are transported in the same vehicles as the raw material. However, heat treatment at 70°C for 60 min will not reduce spore-forming bacteria such as Bacillus spp. and Clostridium spp. Spore-forming bacteria, including those that cause serious diseases, can be present in substrate intended for biogas production. The number of species and the quantity of Bacillus spp. and Clostridium spp. in manure, slaughterhouse waste and in samples from different stages during the biogas process were investigated.
    [Show full text]
  • Phylogenetic Analysis of Butyrivibrio Strains Reveals Three Distinct Groups of Species Within the Clostvidium Subphylum of the Gram-Positive Bacteria
    INTERNATIONALJOURNAL OF SYSTEMATICBACTERIOLOGY, Jan. 1996, p. 195-199 Vol. 46, No. 1 0020-7713/96/$04.00+0 Copyright 0 1996, International Union of Microbiological Societies Phylogenetic Analysis of Butyrivibrio Strains Reveals Three Distinct Groups of Species within the Clostvidium Subphylum of the Gram-Positive Bacteria ANNE WILLEMS," MONICA AMAT-MARCO, AND MATTHEW D. COLLINS Department of Microbial Physiology, Institute of Food Research, Reading Laboratoy, Reading RG6 6BZ, United Kingdom The phylogenetic positions of 40 Butyrivibrio strains were determined by performing a comparative sequence analysis of the 165 rRNA genes of these organisms. We found that all of the strains which we studied belong to cluster XIVa (M. D. Collins, P. A. Lawson, A. Willems, J. J. Cordoba, J. Fernandez-Garayzabal, P. Garcia, J. Cai, H. Hippe, and J. A. E. Farrow, Int. J. Syst. Bacteriol. 442312-826, 1994) of the Clostridium subphylum of the gram-positive bacteria, which also includes several Clostridium, Coprococcus,Eubacterium, and Rumino- coccus species. We also found that the Butyrivibrio strains which we examined were genotypically heterogeneous and exhibited 12 distinct rRNA sequence types. The 12 rRNA sequence types formed three distinct lineages in cluster XIVa, which were separate from each other and from all other species belonging to this cluster. One lineage consisted of strains which exhibited a single rRNA type and corresponded to the species Butyrivibrio crossotus. The second lineage consisted of 12 strains designated Butyrivibrio Jibrisolvens which exhibited seven distinct rRNA sequence types. The type strain of B. Jibrisolvens was a member of this lineage, but its position was peripheral. The third lineage comprised 26 B.
    [Show full text]
  • Mapping the Diversity of Microbial Lignin Catabolism: Experiences from the Elignin Database
    Applied Microbiology and Biotechnology (2019) 103:3979–4002 https://doi.org/10.1007/s00253-019-09692-4 MINI-REVIEW Mapping the diversity of microbial lignin catabolism: experiences from the eLignin database Daniel P. Brink1 & Krithika Ravi2 & Gunnar Lidén2 & Marie F Gorwa-Grauslund1 Received: 22 December 2018 /Revised: 6 February 2019 /Accepted: 9 February 2019 /Published online: 8 April 2019 # The Author(s) 2019 Abstract Lignin is a heterogeneous aromatic biopolymer and a major constituent of lignocellulosic biomass, such as wood and agricultural residues. Despite the high amount of aromatic carbon present, the severe recalcitrance of the lignin macromolecule makes it difficult to convert into value-added products. In nature, lignin and lignin-derived aromatic compounds are catabolized by a consortia of microbes specialized at breaking down the natural lignin and its constituents. In an attempt to bridge the gap between the fundamental knowledge on microbial lignin catabolism, and the recently emerging field of applied biotechnology for lignin biovalorization, we have developed the eLignin Microbial Database (www.elignindatabase.com), an openly available database that indexes data from the lignin bibliome, such as microorganisms, aromatic substrates, and metabolic pathways. In the present contribution, we introduce the eLignin database, use its dataset to map the reported ecological and biochemical diversity of the lignin microbial niches, and discuss the findings. Keywords Lignin . Database . Aromatic metabolism . Catabolic pathways
    [Show full text]
  • The Comparison of Commercially Available Β-Galactosidases for Dairy Industry: Review
    FOOD SCIENCE DOI:10.22616/rrd.23.2017.032 THE COMPARISON OF COMMERCIALLY AVAILABLE β-GALACTOSIDASES FOR DAIRY INDUSTRY: REVIEW Kristine Zolnere, Inga Ciprovica Latvia University of Agriculture [email protected] Abstract β-Galactosidase (EC 3.2.1.23) is one of the widely used enzymes for lactose-free milk production and whey permeate treatment. Enzymes can be obtained from microorganisms, plants and animals. Nowadays, microorganisms are becoming an important source for production of commercially available enzymes, which are of great interest and offer several advantages such as easy handling and high production yield. The aim of this review was to summarize findings of research articles on the application of commercially available β-galactosidase preparates in dairy industry, to analyse and compare the most suitable β-galactosidase commercial preparates for lactose hydrolysis. The results showed that the main factor to choose an appropriate β-galactosidase for lactose hydrolysis was reaction condition. Enzymes from microorganisms contain a wide range of optimal pH from 4.0 (Penicillium simplicissimum and Aspergillus niger) to 8.5 (Bacillus subtilis). The greatest commercial potential have enzymes obtained from fungi (Aspergillus oryzae and Aspergillus niger) and yeasts (Kluyveromyces lactis and Kluyveromyces fragilis). Fungal origin enzymes are more suitable for the hydrolysis of lactose in acid whey due to its acidic pH but yeasts origin enzymes for milk and sweet whey. In the study, commercial preparates from different suppliers with the purpose to analyse their lactose hydrolysis potential and give more detailed characteristics of each preparate advantages and drawbacks were also summarized. Key words: β-Galactosidase, lactose hydrolysis, commercial preparates.
    [Show full text]