Produktinformation

Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien

Weitere Information auf den folgenden Seiten! See the following pages for more information!

Lieferung & Zahlungsart

Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic PON2 (Human) Recombinant Protein members located adjacent to each other on the long arm (P01) of chromosome 7. The encoded protein is ubiquitously expressed in human tissues, membrane-bound, and Catalog Number: H00005445-P01 may act as a cellular antioxidant, protecting cells from oxidative stress. Hydrolytic activity against Regulation Status: For research use only (RUO) acylhomoserine lactones, important bacterial quorum-sensing mediators, suggests the encoded Product Description: Human PON2 full-length ORF ( protein may also play a role in defense responses to AAH46160, 1 a.a. - 219 a.a.) recombinant protein with pathogenic bacteria. Mutations in this gene may be GST-tag at N-terminal. associated with vascular disease and a number of quantitative phenotypes related to diabetes. Alternatively Sequence: spliced transcript variants encoding different isoforms MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVD have been described. [provided by RefSeq] LPHCHLIKGIEAGSEDIDILPNGLAFFSVGLKFPGLHSFA PDKPGGILMMDLKEEKPRARELRISRGFDLASFNPHGI STFIDNDDTVYLFVVNHPEFKNTVEIFKFEEGENSLLHL KTVKHELLPSVNDITAVGPAHFYATNDHYFSDPFLKYL ETYLNLHWANVVYYSPNEVKVVYLCC

Host: Wheat Germ (in vitro)

Theoretical MW (kDa): 49.83

Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Preparation Method: in vitro wheat germ expression system

Purification: Glutathione Sepharose 4 Fast Flow

Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 5445

Gene Symbol: PON2

Gene Alias: -

Gene Summary: This gene encodes a member of the paraoxonase gene family, which includes three known

Page 1/1