Produktinformation

Total Page：16

File Type：pdf, Size：1020Kb

Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic PON2 (Human) Recombinant Protein members located adjacent to each other on the long arm (P01) of chromosome 7. The encoded protein is ubiquitously expressed in human tissues, membrane-bound, and Catalog Number: H00005445-P01 may act as a cellular antioxidant, protecting cells from oxidative stress. Hydrolytic activity against Regulation Status: For research use only (RUO) acylhomoserine lactones, important bacterial quorum-sensing mediators, suggests the encoded Product Description: Human PON2 full-length ORF ( protein may also play a role in defense responses to AAH46160, 1 a.a. - 219 a.a.) recombinant protein with pathogenic bacteria. Mutations in this gene may be GST-tag at N-terminal. associated with vascular disease and a number of quantitative phenotypes related to diabetes. Alternatively Sequence: spliced transcript variants encoding different isoforms MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVD have been described. [provided by RefSeq] LPHCHLIKGIEAGSEDIDILPNGLAFFSVGLKFPGLHSFA PDKPGGILMMDLKEEKPRARELRISRGFDLASFNPHGI STFIDNDDTVYLFVVNHPEFKNTVEIFKFEEGENSLLHL KTVKHELLPSVNDITAVGPAHFYATNDHYFSDPFLKYL ETYLNLHWANVVYYSPNEVKVVYLCC Host: Wheat Germ (in vitro) Theoretical MW (kDa): 49.83 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 5445 Gene Symbol: PON2 Gene Alias: - Gene Summary: This gene encodes a member of the paraoxonase gene family, which includes three known Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Transcriptome Analysis of Alzheimer's Disease Identifies Links to Cardiovascular Disease
Washington University in St. Louis Washington University Open Scholarship All Computer Science and Engineering Research Computer Science and Engineering Report Number: WUCSE-2008-6 2008-01-01 Transcriptome analysis of Alzheimer's disease identifies links ot cardiovascular disease Monika Ray, Jianhua Ruan, and Weixiong Zhang Follow this and additional works at: https://openscholarship.wustl.edu/cse_research Part of the Computer Engineering Commons, and the Computer Sciences Commons Recommended Citation Ray, Monika; Ruan, Jianhua; and Zhang, Weixiong, "Transcriptome analysis of Alzheimer's disease identifies links ot cardiovascular disease" Report Number: WUCSE-2008-6 (2008). All Computer Science and Engineering Research. https://openscholarship.wustl.edu/cse_research/237 Department of Computer Science & Engineering - Washington University in St. Louis Campus Box 1045 - St. Louis, MO - 63130 - ph: (314) 935-6160. Department of Computer Science & Engineering 2008-6 Transcriptome analysis of Alzheimer's disease identifies links to cardiovascular disease Authors: Monika Ray, Jianhua Ruan, Weixiong Zhang Corresponding Author: [email protected] Type of Report: Other Department of Computer Science & Engineering - Washington University in St. Louis Campus Box 1045 - St. Louis, MO - 63130 - ph: (314) 935-6160 Transcriptome analysis of Alzheimer’s disease identiﬁes links to cardiovascular disease Monika Ray1¤, Jianhua Ruan2¤, Weixiong Zhang1;3 1Washington University School of Engineering, Dept. of Computer Science and Engineering, St. Louis, MO 63130 2University of Texas at San Antonio, Dept. of Computer Science, San Antonio, TX 78249 3Washington University School of Medicine, Dept. of Genetics, St. Louis, MO 63110 Correspondence Email: [email protected] ¤ Co-ﬁrst authors Abstract Understanding the pathogenesis in the early stages of late-onset Alzheimer’s disease (AD) can help in gaining important mechanistic insights into this devastating neurode- generative disorder.
[Show full text]
Association of Paraoxonase-2 Genetic Variation with Serum
ASSOCIATION OF PARAOXONASE-2 GENETIC VARIATION WITH SERUM PARAOXONASE ACTIVITY AND SYSTEMIC LUPUS ERYTHEMATOSUS by Sudeshna Dasgupta B.S., University of Calcutta, India, 2001 M.S., University of Calcutta, India, 2003 Submitted to the Graduate Faculty of Graduate School of Public Health in partial fulfillment of the requirements for the degree of Doctor of Philosophy University of Pittsburgh 2008 UNIVERSITY OF PITTSBURGH Graduate School of Public Health This dissertation was presented by Sudeshna Dasgupta It was defended on November 3rd, 2008 and approved by F. Yesim Demirci M.D., Research Assistant Professor, Department of Human Genetics, Graduate School of Public Health, University of Pittsburgh Susan M. Manzi, MD, MPH, Associate Professor, Department of Medicine, School of Medicine and Department of Epidemiology, Graduate School of Public Health, University of Pittsburgh Candace M. Kammerer, Ph.D. Associate Professor, Department of Human Genetics Graduate School of Public Health, University of Pittsburgh Committee Chair Person Robert E. Ferrell, Ph.D. Professor, Department of Human Genetics, Graduate School of Public Health, University of Pittsburgh Dissertation Advisor, M. Ilyas Kamboh, Ph.D. Professor and Chair, Department of Human Genetics, Graduate School of Public Health, University of Pittsburgh ii Dedicated to my mother Mrs. Susmita Dasgupta and my father Dr. Gautam Dasgupta iii Copyright © by Sudeshna Dasgupta 2008 iv M. Ilyas Kamboh PhD ASSOCIATION OF PARAOXONASE-2 GENETIC VARIATION WITH SERUM PARAOXONASE ACTIVITY AND SYSTEMIC LUPUS ERYTHEMATOSUS Sudeshna Dasgupta, PhD University of Pittsburgh, 2008 SLE, a severe autoimmune disease is of major public health relevance since it predominantly affects women at child bearing age and even though immunosuppressives have increased the life span of SLE patients, lack of absolute cure is still troubling.
[Show full text]
Polymorphism of Paraoxonase-2 Gene Is Associated With
Molecular Psychiatry (2002) 7, 110–112 2002 Nature Publishing Group All rights reserved 1359-4184/02 $15.00 www.nature.com/mp ORIGINAL RESEARCH ARTICLE Codon 311 (Cys → Ser) polymorphism of paraoxonase-2 gene is associated with apolipoprotein E4 allele in both Alzheimer’s and vascular dementias Z Janka1, A Juha´sz1,A´ Rimano´czy1, K Boda2,JMa´rki-Zay3 and J Ka´lma´n1 1Department of Psychiatry; 2Medical Informatics, Albert Szent-Gyo¨rgyi Center for Medical and Pharmaceutical Sciences, Faculty of Medicine, University of Szeged, Semmelweis u. 6, H-6725 Szeged, Hungary; 3Central Laboratory, Be´ke´s County Hospital, PO Box 46, H-5701, Gyula, Hungary Keywords: paraoxonase; apolipoprotein E; genetic mark- Table 1 Frequency distribution of PON2 and apoE geno- ers; Alzheimer’s disease; vascular dementia; DNA polymor- types and alleles in the control, Alzheimer’s and vascular phism dementia populations The gene of an esterase enzyme, called paraoxonase (PON, EC.3.1.8.1.) is a member of a multigene family that Control Alzheimer’s Vascular comprises three related genes PON1, PON2, and PON3 dementia dementia with structural homology clustering on the chromosome 7.1,2 The PON1 activity and the polymorphism of the PON2 genotype PON1 and PON2 genes have been found to be associa- CC 4 (8%) 2 (4%) 3 (6%) ted with risk of cardiovascular diseases such as hyper- CS 20 (39%) 23 (43%) 19 (34%) cholesterolaemia, non-insulin-dependent diabetes, coron- SS 27 (53%) 28 (53%) 33 (60%) ary heart disease (CHD) and myocardial infaction.3–8 The PON2 allele importance of cardiovascular risk factors in the patho- C (cys) 28 (27%) 27 (25%) 25 (23%) mechanism of Alzheimer’s disease (AD) and vascular S (ser) 74 (73%) 79 (75%) 85 (77%) dementia (VD)9–13 prompted us to examine the genetic ApoE genotype effect of PON2 gene codon 311 (Cys→Ser; PON2*S) 22 – – – polymorphism and the relationship between the PON2*S 2 3 6 (12%) 3 (6%) 6 (11%) allele and the other dementia risk factor, the apoE poly- 2 4 – – 1 (2%) morphism in these dementias.
[Show full text]
Genome-Wide DNA Methylation Dynamics During Epigenetic
Gómez‑Redondo et al. Clin Epigenet (2021) 13:27 https://doi.org/10.1186/s13148‑021‑01003‑x RESEARCH Open Access Genome‑wide DNA methylation dynamics during epigenetic reprogramming in the porcine germline Isabel Gómez‑Redondo1*† , Benjamín Planells1†, Sebastián Cánovas2,3, Elena Ivanova4, Gavin Kelsey4,5 and Alfonso Gutiérrez‑Adán1 Abstract Background: Prior work in mice has shown that some retrotransposed elements remain substantially methylated during DNA methylation reprogramming of germ cells. In the pig, however, information about this process is scarce. The present study was designed to examine the methylation profles of porcine germ cells during the time course of epigenetic reprogramming. Results: Sows were artifcially inseminated, and their fetuses were collected 28, 32, 36, 39, and 42 days later. At each time point, genital ridges were dissected from the mesonephros and germ cells were isolated through magnetic‑ activated cell sorting using an anti‑SSEA‑1 antibody, and recovered germ cells were subjected to whole‑genome bisulphite sequencing. Methylation levels were quantifed using SeqMonk software by performing an unbiased analysis, and persistently methylated regions (PMRs) in each sex were determined to extract those regions showing 50% or more methylation. Most genomic elements underwent a dramatic loss of methylation from day 28 to day 36, when the lowest levels were shown. By day 42, there was evidence for the initiation of genomic re‑methylation. We identifed a total of 1456 and 1122 PMRs in male and female germ cells, respectively, and large numbers of transpos‑ able elements (SINEs, LINEs, and LTRs) were found to be located within these PMRs. Twenty‑one percent of the introns located in these PMRs were found to be the frst introns of a gene, suggesting their regulatory role in the expression of these genes.
[Show full text]
1471-2105-8-217.Pdf
BMC Bioinformatics BioMed Central Software Open Access GenMAPP 2: new features and resources for pathway analysis Nathan Salomonis1,2, Kristina Hanspers1, Alexander C Zambon1, Karen Vranizan1,3, Steven C Lawlor1, Kam D Dahlquist4, Scott W Doniger5, Josh Stuart6, Bruce R Conklin1,2,7,8 and Alexander R Pico*1 Address: 1Gladstone Institute of Cardiovascular Disease, 1650 Owens Street, San Francisco, CA 94158 USA, 2Pharmaceutical Sciences and Pharmacogenomics Graduate Program, University of California, 513 Parnassus Avenue, San Francisco, CA 94143, USA, 3Functional Genomics Laboratory, University of California, Berkeley, CA 94720 USA, 4Department of Biology, Loyola Marymount University, 1 LMU Drive, MS 8220, Los Angeles, CA 90045 USA, 5Computational Biology Graduate Program, Washington University School of Medicine, St. Louis, MO 63108 USA, 6Department of Biomolecular Engineering, University of California, Santa Cruz, CA 95064 USA, 7Department of Medicine, University of California, San Francisco, CA 94143 USA and 8Department of Molecular and Cellular Pharmacology, University of California, San Francisco, CA 94143 USA Email: Nathan Salomonis - [email protected]; Kristina Hanspers - [email protected]; Alexander C Zambon - [email protected]; Karen Vranizan - [email protected]; Steven C Lawlor - [email protected]; Kam D Dahlquist - [email protected]; Scott W Doniger - [email protected]; Josh Stuart - [email protected]; Bruce R Conklin - [email protected]; Alexander R Pico* - [email protected] * Corresponding author Published: 24 June 2007 Received: 16 November 2006 Accepted: 24 June 2007 BMC Bioinformatics 2007, 8:217 doi:10.1186/1471-2105-8-217 This article is available from: http://www.biomedcentral.com/1471-2105/8/217 © 2007 Salomonis et al; licensee BioMed Central Ltd.
[Show full text]
Comparative Genome Mapping in the Sequence-Based Era: Early Experience with Human Chromosome 7
Downloaded from genome.cshlp.org on September 24, 2021 - Published by Cold Spring Harbor Laboratory Press First Glimpses/Report Comparative Genome Mapping in the Sequence-based Era: Early Experience with Human Chromosome 7 James W. Thomas,1 Tyrone J. Summers,1 Shih-Queen Lee-Lin,1 Valerie V. Braden Maduro,1 Jacquelyn R. Idol,1 Stephen D. Mastrian,1 Joseph F. Ryan,1 D. Curtis Jamison,1 and Eric D. Green1,2 1Genome Technology Branch, National Human Genome Research Institute, National Institutes of Health, Bethesda, Maryland 20892 USA The success of the ongoing Human Genome Project has resulted in accelerated plans for completing the human genome sequence and the earlier-than-anticipated initiation of efforts to sequence the mouse genome. As a complement to these efforts, we are utilizing the available human sequence to refine human-mouse comparative maps and to assemble sequence-ready mouse physical maps. Here we describe how the first glimpses of genomic sequence from human chromosome 7 are directly facilitating these activities. Specifically, we are actively enhancing the available human-mouse comparative map by analyzing human chromosome 7 sequence for the presence of orthologs of mapped mouse genes. Such orthologs can then be precisely positioned relative to mapped human STSs and other genes. The chromosome 7 sequence generated to date has allowed us to more than double the number of genes that can be placed on the comparative map. The latter effort reveals that human chromosome 7 is represented by at least 20 orthologous segments of DNA in the mouse genome. A second component of our program involves systematically analyzing the evolving human chromosome 7 sequence for the presence of matching mouse genes and expressed-sequence tags (ESTs).
[Show full text]
Association of Genetic and Environmental Factors with Non-Alcoholic Fatty Liver Disease in a Chinese Han Population
International Journal of Environmental Research and Public Health Article Association of Genetic and Environmental Factors with Non-Alcoholic Fatty Liver Disease in a Chinese Han Population Zheng Li , Cheng-Yin Ye, Li Wang, Jin-Mei Li and Lei Yang * Medical School, Hangzhou Normal University, Hangzhou 310000, China; [email protected] (Z.L.); [email protected] (C.-Y.Y.); [email protected] (L.W.); [email protected] (J.-M.L.) * Correspondence: [email protected]; Tel.: +86-05-712-886-5010 Received: 24 June 2020; Accepted: 11 July 2020; Published: 20 July 2020 Abstract: Lifestyle choices such as the intake of sweets, history of diseases, and genetic variants seem to play a role in the pathogenesis of non-alcoholic fatty liver disease (NAFLD). To explore which genetic and environmental factors are associated with NAFLD in a Chinese Han population, we conducted this study. We collected the medical reports, lifestyle details, and blood samples of individuals and used the polymerase chain reaction-ligase detection reaction method to genotype the single-nucleotide polymorphism (SNPs) from the 2113 eligible people. The GG genotype of the additive model of rs7493 in the PON2, the CC genotype of the additive and recessive models of rs7593130 in the ADCY3, together with dyslipidemia, regular intake of egg and sweets and hypertension, increased the risk of NAFLD (adjusted OR > 1, p < 0.05). The TT genotype of the additive and dominant models of rs11583680 in the PCSK9, together with the regular intake of vegetable, reduced the risk of NAFLD (adjusted OR < 1, p < 0.05).
[Show full text]
The Relevance of Noncoding DNA Variations of Paraoxonase Gene Cluster in Atherosclerosis-Related Diseases
International Journal of Molecular Sciences Review The Relevance of Noncoding DNA Variations of Paraoxonase Gene Cluster in Atherosclerosis-Related Diseases Anna Wysocka 1,2,* and Agnieszka Zwolak 1,3 1 Chair of Internal Medicine and Department of Internal Medicine in Nursing, Faculty of Health Sciences, Medical University of Lublin, 20-093 Lublin, Poland; [email protected] 2 Chair and Department of Cardiology, Medical University of Lublin, 20-954 Lublin, Poland 3 Chair and Department of Endocrinology, Medical University of Lublin, 20-954 Lublin, Poland * Correspondence: [email protected]; Tel.: +48-814487720 Abstract: The human paraoxonase (PON) gene cluster is comprised of three contiguous genes (PON1, PON2 and PON3) of presumably common origin coding three lactonases of highly similar struc- ture and substrate specificity. The catalytic activity of PON proteins is directed toward artificial organophosphates and in physiological conditions toward thiolactones and oxidized phospholipids. Consequently, PON enzymes are regarded as an effective defense against oxidative stress and, as a result, against atherosclerosis development. Additionally, both PON’s serum activity and its con- centration are influenced by several polymorphic variations in coding and noncoding DNA regions of the PON gene cluster remaining in linkage disequilibrium. Hence, the genetic polymorphism of the PON gene cluster may contribute to atherosclerotic process progression or deceleration. In this review the authors analyzed the relevance of noncoding DNA polymorphic variations of PON genes in atherosclerosis-related diseases involving coronary and peripheral artery disease, stroke, diabetes mellitus, dementia and renal disease and concluded that the effect of PON gene cluster’ Citation: Wysocka, A.; Zwolak, A. polymorphism has a considerable impact on the course and outcome in these conditions.
[Show full text]
Potential of Human PON2 As an Anti- Pseudomonal Therapy
Potential of human PON2 as an anti- Pseudomonal therapy by Naseem Mohammad Ali School of Medicine Submitted in fulfilment of the requirements for the Doctor of Philosophy (Medical Studies) University of Tasmania June, 2015 DECLARATION OF ORIGINALITY This thesis contains no material which has been accepted for a degree or diploma by the University or any other institution, except by way of background information and duly acknowledged in the thesis, and to the best of my knowledge and belief no material previously published or written by another person except where due acknowledgement is made in the text of the thesis, nor does the thesis contain any material that infringes copyright. Signature Date - 02/11/15 [i] AUTHORITY OF ACCESS This thesis may be made available for loan. Copying and communication of any part of this thesis is prohibited for two years from the date this statement was signed; after that time limited copying and communication is permitted in accordance with the Copyright Act 1968. Signature Date - 02-11-15 [i] STATEMENT OF ETHICAL CONDUCT The research associated with this thesis abides by the international and Australian codes on human and animal experimentation, the guidelines by the Australian Government's Office of the Gene Technology Regulator and the rulings of the Safety, Ethics and Institutional Biosafety Committees of the University [i] Abstract ABSTRACT Cystic Fibrosis (CF) is the most common life-limiting single gene disorder in Caucasian populations. CF results from mutations in the gene encoding the CF transmembrane conductance regulator (CFTR) protein, which leads to accumulation of thick and sticky mucus in the airways of people with CF, ultimately dampening immune clearance of potential respiratory pathogens.
[Show full text]
Human Paraoxonase-2 (PON2): Protein Functions and Modulation
antioxidants Review Human Paraoxonase-2 (PON2): Protein Functions and Modulation Giuseppe Manco *, Elena Porzio and Teresa Maria Carusone * Institute of Biochemistry and Cell Biology (IBBC, CNR), National Research Council, 80131 Naples, Italy; [email protected] * Correspondence: [email protected] (G.M.); [email protected] (T.M.C.); Fax: +30-0816132277 or +39-0816132296 (G.M.) Abstract: PON1, PON2, and PON3 belong to a family of lactone hydrolyzing enzymes endowed with various substrate specificities. Among PONs, PON2 shows the highest hydrolytic activity toward many acyl-homoserine lactones (acyl-HL) involved in bacterial quorum-sensing signaling. Accord- ingly, defense against pathogens, such as Brevundimonas aeruginosa (B. aeruginosa), was postulated to be the principal function of PON2. However, recent findings have highlighted the importance of PON2 in oxidative stress control, inhibition of apoptosis, and the progression of various types of malignancies. This review focuses on all of these aspects of PON2. Keywords: PON2; catalytic activity; lactonase; antioxidant; bacterial infections; inflammation; cancer; isoforms; SNPs; post-translational modifications; PON2 regulation Citation: Manco, G.; Porzio, E.; 1. Introduction Carusone, T.M. Human Paraoxonase 2 (PON2) is the oldest member and the most potent quorum quencher Paraoxonase-2 (PON2): Protein of the paraoxonase family, nevertheless it is less studied than PON1. Its intracellular Functions and Modulation. localization, in contrast to PON1 and PON3 secreted extracellularly, makes PON2 studies Antioxidants 2021, 10, 256. https:// more challenging. In fact in cells functional assays to measure its activity in different doi.org/10.3390/antiox10020256 compartments are still not available and the lack of the 3D structure does not allow one to clarify reaction mechanisms.
[Show full text]
(PON1 and PON2) Are Associated with the Risk of Coronary Heart Disease Dharambir K
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Am. J. Hum. Genet. 62:36–44, 1998 DNA Polymorphisms in Two Paraoxonase Genes (PON1 and PON2) Are Associated with the Risk of Coronary Heart Disease Dharambir K. Sanghera, Christopher E. Aston, Nilmani Saha, and M. Ilyas Kamboh Department of Human Genetics, Graduate School of Public Health, University of Pittsburgh, Pittsburgh Summary Introduction A common polymorphism at codon 192 in the human Oxidized LDL is believed to play an important role in paraoxonase (PON) 1 gene has been shown to be as- initiation of atherosclerosis. Numerous studies suggest sociated with increased risk for coronary heart disease the formation of fatty-acid streaks in response to a series (CHD) in Caucasian populations. However, these find- of events, followed by the migration of oxidized LDL- ings have not been reported consistently in all Caucasian loaded monocytes into the subendothelial space of the and non-Caucasian populations, suggesting that this is arteries (Navab et al. 1996). HDL has been shown to not a functional mutation but may mark a functional prevent oxidative modification of LDL in vivo (Klimov mutation present in either PON1 or a nearby gene. Re- et al. 1993) as well as in vitro (Mackness et al. 1993). cently, two other PON-like genes, designated “PON2” Recent studies indicate that two HDL-associated en- and “PON3,” have been identified, and they are linked zymes, PON and platelet-activating–factor acetyl hydro- with the known PON1 gene on chromosome 7. Iden- lase, are responsible for its antioxidative and anti-in- tification of additional polymorphisms in the PON-gene flammatory properties (Stafforini et al.
[Show full text]
PON2 (NM 001018161) Human Untagged Clone Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for SC302202 PON2 (NM_001018161) Human Untagged Clone Product data: Product Type: Expression Plasmids Product Name: PON2 (NM_001018161) Human Untagged Clone Tag: Tag Free Symbol: PON2 Vector: pCMV6-XL5 E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: None This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 PON2 (NM_001018161) Human Untagged Clone – SC302202 Fully Sequenced ORF: >OriGene sequence for NM_001018161 edited GTAAGTTTCTCACTGGAATAGCGAGTGAGAAATGTGTTTGAAGACTAGGGAAACGAGAAG GTATGCGGGCTGCTAGAGGGTTTCGGGTGGGTTGTTTGAAAAAGGAAGTGAAGGAATTCA AAGTTTCACATCATGAGCCTAATGTAAGGCGTGTCCGGGCCGTCCCGAAGGTATCTGGGG AAATAGGTTTGTGAGGACAAAGACCAGGGCCAGGCCCAGGGCGGAGCCTCCGCGGCCCCG ACGCAGGGACTCGGCCTAGGCGGAGGACGGGGCGGAGCGCGGCCGGCACCATCGAGCCGG GAAGATGGCACCGCCCACGGAGCTGCTGGCCAGGCCGGAGCGAGGCAGCGCGCCCGGCTC CCGCGCCATGGGGCGGCTGGTGGCTGTGGGCTTGCTGGGGATCGCGCTGGCGCTCCTGGG CGAGAGGCTTCTGGCACTCAGAAATCGACTTAAAGCCTCCAGAGAAGTAGAATCTGTAGA CCTTCCACACTGCCACCTGATTAAAGGAATTGAAGCTGGCTCTGAAGATATTGACATACT TCCCAATGGTCTGGCTTTTTTTAGTGTGGGTCTAAAATTCCCAGGACTCCACAGCTTTGC ACCAGATAAGCCTGGAGGAATACTAATGATGGATCTAAAAGAAGAAAAACCAAGGGCACG GGAATTAAGAATCAGTCGTGGGTTTGATTTGGCCTCATTCAATCCACATGGCATCAGCAC TTTCATAGACAACGAATTCAAGAATACAGTGGAAATTTTTAAATTTGAAGAAGCAGAAAA
[Show full text]