Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic PON2 (Human) Recombinant Protein members located adjacent to each other on the long arm (P01) of chromosome 7. The encoded protein is ubiquitously expressed in human tissues, membrane-bound, and Catalog Number: H00005445-P01 may act as a cellular antioxidant, protecting cells from oxidative stress. Hydrolytic activity against Regulation Status: For research use only (RUO) acylhomoserine lactones, important bacterial quorum-sensing mediators, suggests the encoded Product Description: Human PON2 full-length ORF ( protein may also play a role in defense responses to AAH46160, 1 a.a. - 219 a.a.) recombinant protein with pathogenic bacteria. Mutations in this gene may be GST-tag at N-terminal. associated with vascular disease and a number of quantitative phenotypes related to diabetes. Alternatively Sequence: spliced transcript variants encoding different isoforms MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVD have been described. [provided by RefSeq] LPHCHLIKGIEAGSEDIDILPNGLAFFSVGLKFPGLHSFA PDKPGGILMMDLKEEKPRARELRISRGFDLASFNPHGI STFIDNDDTVYLFVVNHPEFKNTVEIFKFEEGENSLLHL KTVKHELLPSVNDITAVGPAHFYATNDHYFSDPFLKYL ETYLNLHWANVVYYSPNEVKVVYLCC Host: Wheat Germ (in vitro) Theoretical MW (kDa): 49.83 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 5445 Gene Symbol: PON2 Gene Alias: - Gene Summary: This gene encodes a member of the paraoxonase gene family, which includes three known Page 1/1 Powered by TCPDF (www.tcpdf.org).
Details
-
File Typepdf
-
Upload Time-
-
Content LanguagesEnglish
-
Upload UserAnonymous/Not logged-in
-
File Pages2 Page
-
File Size-