Is There Any Intron Sliding in Mammals? Irina V

Total Page:16

File Type:pdf, Size:1020Kb

Is There Any Intron Sliding in Mammals? Irina V Poverennaya et al. BMC Evol Biol (2020) 20:164 https://doi.org/10.1186/s12862-020-01726-0 RESEARCH ARTICLE Open Access Is there any intron sliding in mammals? Irina V. Poverennaya1,2*† , Nadezhda A. Potapova3,4† and Sergey A. Spirin5,6,7 Abstract Background: Eukaryotic protein-coding genes consist of exons and introns. Exon–intron borders are conserved between species and thus their changes might be observed only on quite long evolutionary distances. One of the rarest types of change, in which intron relocates over a short distance, is called "intron sliding", but the reality of this event has been debated for a long time. The main idea of a search for intron sliding is to use the most accurate genome annotation and genome sequence, as well as high-quality transcriptome data. We applied them in a search for sliding introns in mammals in order to widen knowledge about the presence or absence of such phenomena in this group. Results: We didn’t fnd any signifcant evidence of intron sliding in the primate group (human, chimpanzee, rhesus macaque, crab-eating macaque, green monkey, marmoset). Only one possible intron sliding event supported by a set of high quality transcriptomes was observed between EIF1AX human and sheep gene orthologs. Also, we checked a list of previously observed intron sliding events in mammals and showed that most likely they are artifacts of genome annotations and are not shown in subsequent annotation versions as well as are not supported by transcriptomic data. Conclusions: We assume that intron sliding is indeed a very rare evolutionary event if it exists at all. Every case of intron sliding needs a lot of supportive data for detection and confrmation. Keywords: Intron sliding, Introns, Gene annotation, Transcriptome, Intron evolution Background mutations in splice sites or nearby, such as a birth or Eukaryotic genes consist of exons and introns whose death of new splice sites resulted in a loss or acquisi- borders, i.e. genomic coordinates, are evolutionarily tion of exons or their part [6–9]. But the rarest type of conservative which means they are under the pressure such alterations is called “intron sliding” (also known of negative selection [1–4]. Te changes of exon–intron as “intron shifting”, “intron drift”, “intron slippage” or boundaries might afect coding protein, therefore they “intron migration”). Intron sliding is a movement of are rare events and can be seen only on the long evolu- intron from one position to another within a gene [10]. tionary distances [5]. Such changes difer from the alter- In other words, during sliding the start and end of the native splicing, which is widespread in eukaryotes and certain intron move in the same direction for the same does not afect exon–intron coordinates. number of nucleotides. For example, if initially the intron Various reasons for exon–intron boundaries altera- start coordinate was 100 and the end coordinate was 500, tions were observed. All of them happen as a result of after hypothetical intron sliding event coordinates would be 101 and 501, respectively. Tis means that coordinate changes for both sides are the same (in this case 1 bp *Correspondence: [email protected] shift). Potential mechanisms of intron sliding appearance †Irina V. Poverennaya and Nadezhda A. Potapova contributed equally to this work as frst authors were proposed [10–12] and it was shown that almost 1 Vavilov Institute of General Genetics, Russian Academy of Sciences, always they are no longer than 1 bp [12], but potentially Moscow, Russia might be of a length of 15 bp [13] or even 60 bp [14]. Full list of author information is available at the end of the article © The Author(s) 2020. Open Access This article is licensed under a Creative Commons Attribution 4.0 International License, which permits use, sharing, adaptation, distribution and reproduction in any medium or format, as long as you give appropriate credit to the original author(s) and the source, provide a link to the Creative Commons licence, and indicate if changes were made. The images or other third party material in this article are included in the article’s Creative Commons licence, unless indicated otherwise in a credit line to the material. If material is not included in the article’s Creative Commons licence and your intended use is not permitted by statutory regulation or exceeds the permitted use, you will need to obtain permission directly from the copyright holder. To view a copy of this licence, visit http://creat iveco mmons .org/licen ses/by/4.0/. The Creative Commons Public Domain Dedication waiver (http://creat iveco mmons .org/publi cdoma in/zero/1.0/) applies to the data made available in this article, unless otherwise stated in a credit line to the data. Poverennaya et al. BMC Evol Biol (2020) 20:164 Page 2 of 8 According to the diferent data [13, 15, 16] introns relo- for intron sliding in a one certain gene. Second, essential cate their positions over the distances of 1–15 bp or even are high-quality genome annotations and transcriptomes, around 5% of the intron length. However, the longer the to avoid annotation errors. In the very frst intron slid- distance is, the more sceptical we might be about the ing studies limited sets of data were used, e.g. only gene presence of an intron sliding event rather than intron loss annotations and genomes, or even just genes [18, 19], and gain in diferent positions. and authors were cautious with claims about the exist- As proper intron recognition and removal from tran- ence of any intron sliding event. Later, a step with check- scripts require correct splice signals at the intron start ing intron sliding using RNA-seq data was added, which and end, i.e. donor and acceptor splice sites, intron slid- helps to consider each potential case more accurately ing might happen as a result of a series of mutations lead- (e.g. see [20]). But yet authors of only a few studies are ing to creation of the alternative splice sites and loss of confdent with the results of sliding intron presence [15, the old ones. It remains unclear whether canonical donor 16], while the majority of found cases failed after check- and acceptor splice sites GT-AG, which are the most ing [21]. For instance, in [10] a list of 32 sliding events common in eukaryotes, stay intact after intron sliding, or was examined and 20 cases were fltered out. However, intron sliding rather happens in introns with non-canon- the authors stayed skeptical about the remaining cases ical splice sites. Te recently suggested molecular mech- and suspected that most, if not all, of them were artifacts. anism for 1 bp sliding [12] considers the importance of In another study [22], 9 oomycete genomes were used canonical splice sites and focuses on so-called stwintron and it was concluded that intron sliding is only acciden- (spliceosomal twin intron) that is an intron with nested tal and plays a minor role in eukaryotic genome evolu- internal introns that could be alternatively spliced. tion [22]. Other works also showed that there is no intron Intron sliding does not afect the sequence of the tran- sliding in Cryptococcus species [23] and in Daphnia [24]. script but can lead to intron phase changes [15], which Summarizing, there is a very small possibility for intron might be important for alternative splicing. Let us con- sliding occurrences. All of such events were observed sider a hypothetical example with the sequence at the using outdated data or genome annotations that had exon–intron boundaries GAC|gtcct…tgag|CTAA where changed drastically in recent years. Some studies did not the splice site is shown by the vertical streak, donor and take into account transcriptomic data. Tus, each previ- acceptor splice sites are underlined, intron’s sequence is ously found possible case needs an accurate interpreta- highlighted in lowercase letters, while the sequences of tion and verifcation. neighbouring exons are in capital letters. If intron slid- We approached this task using the latest genome anno- ing, as it is generally predicted, happens as a result of tations, reference genome versions and high quality tran- the cut-and-paste mechanism then the sequence in the scriptomic data for some mammalian species (including case of 1 bp sliding will look like this: GACC|gtcct… human, chimpanzee, rhesus macaque and mouse), for tgag|TAA. Te intron sequence stays intact, while the which the mentioned list of data was available. In order exon sequences gain/lose 1 bp each at their border lead- to understand the prevalence of intron sliding phenom- ing to intron phase change. However, if intron sliding ena and, if it takes place, its characteristics, we identi- happens in a series of point mutations at the exon–intron fed and then verifed each possible case of intron sliding border or the presence of canonical splice signals stops between human and other mammals. being crucial for correct intron splicing for this particu- lar case (according to [17], the number of non-canonical sites is probably greatly underestimated due to imperfect Results genome annotations), we might fnd the intermediate Search for intron sliding events cases, e.g. GACG|tc ct…tgaac|TAA (the point mutation Search for parallel shifts of exon–intron borders in the G → A occurs at the end of intron leading to the creation pairwise genome alignments between human and other of a new acceptor site AC| and shifting the exon–intron species resulted in 35 potential intron sliding events. border). Here we might observe the changes not only in Te maximum number of sliding hits (13) were found intron sequences but in the afecting codons as well.
Recommended publications
  • The Landscape of Genomic Imprinting Across Diverse Adult Human Tissues
    Downloaded from genome.cshlp.org on October 3, 2021 - Published by Cold Spring Harbor Laboratory Press Research The landscape of genomic imprinting across diverse adult human tissues Yael Baran,1 Meena Subramaniam,2 Anne Biton,2 Taru Tukiainen,3,4 Emily K. Tsang,5,6 Manuel A. Rivas,7 Matti Pirinen,8 Maria Gutierrez-Arcelus,9 Kevin S. Smith,5,10 Kim R. Kukurba,5,10 Rui Zhang,10 Celeste Eng,2 Dara G. Torgerson,2 Cydney Urbanek,11 the GTEx Consortium, Jin Billy Li,10 Jose R. Rodriguez-Santana,12 Esteban G. Burchard,2,13 Max A. Seibold,11,14,15 Daniel G. MacArthur,3,4,16 Stephen B. Montgomery,5,10 Noah A. Zaitlen,2,19 and Tuuli Lappalainen17,18,19 1The Blavatnik School of Computer Science, Tel-Aviv University, Tel Aviv 69978, Israel; 2Department of Medicine, University of California San Francisco, San Francisco, California 94158, USA; 3Analytic and Translational Genetics Unit, Massachusetts General Hospital, Boston, Massachusetts 02114, USA; 4Program in Medical and Population Genetics, Broad Institute of Harvard and MIT, Cambridge, Massachusetts 02142, USA; 5Department of Pathology, Stanford University, Stanford, California 94305, USA; 6Biomedical Informatics Program, Stanford University, Stanford, California 94305, USA; 7Wellcome Trust Center for Human Genetics, Nuffield Department of Clinical Medicine, University of Oxford, Oxford, OX3 7BN, United Kingdom; 8Institute for Molecular Medicine Finland, University of Helsinki, 00014 Helsinki, Finland; 9Department of Genetic Medicine and Development, University of Geneva, 1211 Geneva, Switzerland;
    [Show full text]
  • Análise Integrativa De Perfis Transcricionais De Pacientes Com
    UNIVERSIDADE DE SÃO PAULO FACULDADE DE MEDICINA DE RIBEIRÃO PRETO PROGRAMA DE PÓS-GRADUAÇÃO EM GENÉTICA ADRIANE FEIJÓ EVANGELISTA Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas Ribeirão Preto – 2012 ADRIANE FEIJÓ EVANGELISTA Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas Tese apresentada à Faculdade de Medicina de Ribeirão Preto da Universidade de São Paulo para obtenção do título de Doutor em Ciências. Área de Concentração: Genética Orientador: Prof. Dr. Eduardo Antonio Donadi Co-orientador: Prof. Dr. Geraldo A. S. Passos Ribeirão Preto – 2012 AUTORIZO A REPRODUÇÃO E DIVULGAÇÃO TOTAL OU PARCIAL DESTE TRABALHO, POR QUALQUER MEIO CONVENCIONAL OU ELETRÔNICO, PARA FINS DE ESTUDO E PESQUISA, DESDE QUE CITADA A FONTE. FICHA CATALOGRÁFICA Evangelista, Adriane Feijó Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas. Ribeirão Preto, 2012 192p. Tese de Doutorado apresentada à Faculdade de Medicina de Ribeirão Preto da Universidade de São Paulo. Área de Concentração: Genética. Orientador: Donadi, Eduardo Antonio Co-orientador: Passos, Geraldo A. 1. Expressão gênica – microarrays 2. Análise bioinformática por module maps 3. Diabetes mellitus tipo 1 4. Diabetes mellitus tipo 2 5. Diabetes mellitus gestacional FOLHA DE APROVAÇÃO ADRIANE FEIJÓ EVANGELISTA Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas.
    [Show full text]
  • Communication in Asthmatic Airways Inflammation and Intercellular Gene
    Gene Expression Patterns of Th2 Inflammation and Intercellular Communication in Asthmatic Airways This information is current as David F. Choy, Barmak Modrek, Alexander R. Abbas, Sarah of September 28, 2021. Kummerfeld, Hilary F. Clark, Lawren C. Wu, Grazyna Fedorowicz, Zora Modrusan, John V. Fahy, Prescott G. Woodruff and Joseph R. Arron J Immunol 2011; 186:1861-1869; Prepublished online 27 December 2010; Downloaded from doi: 10.4049/jimmunol.1002568 http://www.jimmunol.org/content/186/3/1861 Supplementary http://www.jimmunol.org/content/suppl/2010/12/27/jimmunol.100256 http://www.jimmunol.org/ Material 8.DC1 References This article cites 63 articles, 10 of which you can access for free at: http://www.jimmunol.org/content/186/3/1861.full#ref-list-1 Why The JI? Submit online. by guest on September 28, 2021 • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2011 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Gene Expression Patterns of Th2 Inflammation and Intercellular Communication in Asthmatic Airways David F.
    [Show full text]
  • Dynamic Interplay Between Locus-Specific DNA Methylation and Hydroxymethylation Regulates Distinct Biological Pathways in Prostate Carcinogenesis Shivani N
    Kamdar et al. Clinical Epigenetics (2016) 8:32 DOI 10.1186/s13148-016-0195-4 RESEARCH Open Access Dynamic interplay between locus-specific DNA methylation and hydroxymethylation regulates distinct biological pathways in prostate carcinogenesis Shivani N. Kamdar1,2, Linh T. Ho1, Ken J. Kron1, Ruth Isserlin3, Theodorus van der Kwast1,4, Alexandre R. Zlotta5, Neil E. Fleshner6, Gary Bader3 and Bharati Bapat1,2* Abstract Background: Despite the significant global loss of DNA hydroxymethylation marks in prostate cancer tissues, the locus-specific role of hydroxymethylation in prostate tumorigenesis is unknown. We characterized hydroxymethylation and methylation marks by performing whole-genome next-generation sequencing in representative normal and prostate cancer-derived cell lines in order to determine functional pathways and key genes regulated by these epigenomic modifications in cancer. Results: Our cell line model shows disruption of hydroxymethylation distribution in cancer, with global loss and highly specific gain in promoter and CpG island regions. Significantly, we observed locus-specific retention of hydroxymethylation marks in specific intronic and intergenic regions which may play a novel role in the regulation of gene expression in critical functional pathways, such as BARD1 signaling and steroid hormone receptor signaling in cancer. We confirm a modest correlation of hydroxymethylation with expression in intragenic regions in prostate cancer, while identifying an original role for intergenic hydroxymethylation in differentially expressed regulatory pathways in cancer. We also demonstrate a successful strategy for the identification and validation of key candidate genes from differentially regulated biological pathways in prostate cancer. Conclusions: Our results indicate a distinct function for aberrant hydroxymethylation within each genomic feature in cancer, suggesting a specific and complex role for the deregulation of hydroxymethylation in tumorigenesis, similar to methylation.
    [Show full text]
  • DDB1 Functions As a Linker to Recruit Receptor WD40 Proteins to CUL4− ROC1 Ubiquitin Ligases
    Downloaded from genesdev.cshlp.org on October 6, 2021 - Published by Cold Spring Harbor Laboratory Press RESEARCH COMMUNICATION domain to bind with a conserved protein motif, the F DDB1 functions as a linker box, which, via its additional protein–protein interaction to recruit receptor WD40 modules, recruits various substrates, often phosphory- lated, to the CUL1–ROC1 catalytic core. To bring spe- proteins to CUL4–ROC1 cific substrates to CUL2- and CUL5-dependent ligases, a ubiquitin ligases heterodimeric linker complex containing elongins B and C binds simultaneously to an analogous N-terminal do- Yizhou Joseph He, Chad M. McCall, Jian Hu, main in CUL2 and CUL5 and to two similar protein 1 motifs, the VHL box and SOCS box. VHL and SOCS pro- Yaxue Zeng, and Yue Xiong teins, via their additional protein–protein interaction Lineberger Comprehensive Cancer Center, Department of modules, target various substrates differentially to the Biochemistry and Biophysics, Program in Molecular Biology CUL2–ROC1 or CUL5–ROC2 catalytic cores (Kamura et and Biotechnology, University of North Carolina, Chapel Hill, al. 1998, 2001, 2004; Stebbins et al. 1999; Zhang et al. North Carolina 27599, USA 1999). Omitting a linker, CUL3 utilizes its N-terminal domain to bind to proteins with a conserved 100-residue Cullins assemble the largest family of ubiquitin ligases protein motif known as a BTB domain, which, via addi- by binding with ROC1 and various substrate receptors. tional protein–protein interaction domains, then target CUL4 function is linked with many cellular processes, various substrates to the CUL3–ROC1 catalytic core (Fu- rukawa et al. 2003; Geyer et al.
    [Show full text]
  • Chip-Seq Analysis to Explore DNA Replication Profile in Trifluridine
    ANTICANCER RESEARCH 39 : 3565-3570 (2019) doi:10.21873/anticanres.13502 ChIP-seq Analysis to Explore DNA Replication Profile in Trifluridine-treated Human Colorectal Cancer Cells In Vitro TAKASHI KOBUNAI 1* , KAZUAKI MATSUOKA 2* and TEIJI TAKECHI 1 1Taiho Pharmaceutical Co., Ltd., Translational Research Laboratory, Tokyo, Japan; 2Taiho Pharmaceutical Co., Ltd., Translational Research Laboratory (Tokushima office), Tokushima, Japan Abstract. Background/Aim: Trifluridine (FTD) is a key efficacy and a tolerable safety profile for previously treated component of the novel oral antitumor drug trifluridine/ metastatic colorectal cancer (2). tipiracil that has been approved for the treatment of metastatic In basic research, FTD, the active antitumor component of colorectal cancer. In this study, a comprehensive analysis of FTD/TPI, is an antineoplastic thymidine analog (3), efficiently DNA replication profile in FTD-treated colon cancer cells was incorporated into genomic DNA in tumor cells (4-7). FTD performed. Materials and Methods: HCT-116 cells were transported into the cytoplasm of tumor cells by equilibrative exposed to BrdU or FTD and subjected to DNA immuno- nucleoside transporter 1 and 2 is phosphorylated to mono- precipitation. Immunoprecipitated DNA was sequenced; the phosphate, diphosphate, and triphosphate (FTD-TP) forms by density of aligned reads along the genome was calculated. Peak thymidine kinase 1 and nucleoside diphosphate kinase, finding, gene ontology, and motif analysis were performed using respectively. DNA polymerase α incorporates FTD-TP into MACS, GREAT, and MEME, respectively. Results: We identified DNA at sites aligned with adenine on the opposite strand (8). 6,043 and 5,080 high-confidence FTD and BrdU peaks in HCT- FTD/TPI exerts its antitumor activity in vivo predominantly 116 cells, respectively.
    [Show full text]
  • Chromosome 20 Shows Linkage with DSM-IV Nicotine Dependence in Finnish Adult Smokers
    Nicotine & Tobacco Research, Volume 14, Number 2 (February 2012) 153–160 Original Investigation Chromosome 20 Shows Linkage With DSM-IV Nicotine Dependence in Finnish Adult Smokers Kaisu Keskitalo-Vuokko, Ph.D.,1 Jenni Hällfors, M.Sc.,1,2 Ulla Broms, Ph.D.,1,3 Michele L. Pergadia, Ph.D.,4 Scott F. Saccone, Ph.D.,4 Anu Loukola, Ph.D.,1,3 Pamela A. F. Madden, Ph.D.,4 & Jaakko Kaprio, M.D., Ph.D.1,2,3 1 Hjelt Institute, Department of Public Health, University of Helsinki, Helsinki, Finland 2 Institute for Molecular Medicine Finland (FIMM), University of Helsinki, Helsinki, Finland 3 National Institute for Health and Welfare (THL), Helsinki, Finland 4 Department of Psychiatry, Washington University School of Medicine, St. Louis, MO Corresponding Author: Jaakko Kaprio, M.D., Ph.D., Department of Public Health, University of Helsinki, PO Box 41 (Manner- heimintie 172), Helsinki 00014, Finland. Telephone: +358-9-191-27595; Fax: +358-9-19127570; E-mail: [email protected] Received February 5, 2011; accepted June 21, 2011 2009). Despite several gene-mapping studies, the genes underlying Abstract liability to nicotine dependence (ND) remain largely unknown. Introduction: Chromosome 20 has previously been associated Recently, Han, Gelernter, Luo, and Yang (2010) performed a with nicotine dependence (ND) and smoking cessation. Our meta-analysis of 15 genome-wide linkage scans of smoking aim was to replicate and extend these findings. behavior. Linkage signals were observed on chromosomal regions 17q24.3–q25.3, 5q33.1–q35.2, 20q13.12–32, and 22q12.3–13.32. Methods: First, a total of 759 subjects belonging to 206 Finnish The relevance of the chromosome 20 finding is highlighted families were genotyped with 18 microsatellite markers residing by the fact that CHRNA4 encoding the nicotinic acetylcholine on chromosome 20, in order to replicate previous linkage findings.
    [Show full text]
  • Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva
    UCSF UC San Francisco Previously Published Works Title Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva. Permalink https://escholarship.org/uc/item/95h5g8mq Journal Cell reports, 33(7) ISSN 2211-1247 Authors Saitou, Marie Gaylord, Eliza A Xu, Erica et al. Publication Date 2020-11-01 DOI 10.1016/j.celrep.2020.108402 Peer reviewed eScholarship.org Powered by the California Digital Library University of California HHS Public Access Author manuscript Author ManuscriptAuthor Manuscript Author Cell Rep Manuscript Author . Author manuscript; Manuscript Author available in PMC 2020 November 30. Published in final edited form as: Cell Rep. 2020 November 17; 33(7): 108402. doi:10.1016/j.celrep.2020.108402. Functional Specialization of Human Salivary Glands and Origins of Proteins Intrinsic to Human Saliva Marie Saitou1,2,3, Eliza A. Gaylord4, Erica Xu1,7, Alison J. May4, Lubov Neznanova5, Sara Nathan4, Anissa Grawe4, Jolie Chang6, William Ryan6, Stefan Ruhl5,*, Sarah M. Knox4,*, Omer Gokcumen1,8,* 1Department of Biological Sciences, University at Buffalo, The State University of New York, Buffalo, NY, U.S.A 2Section of Genetic Medicine, Department of Medicine, University of Chicago, Chicago, IL, U.S.A 3Faculty of Biosciences, Norwegian University of Life Sciences, Ås, Viken, Norway 4Program in Craniofacial Biology, Department of Cell and Tissue Biology, School of Dentistry, University of California, San Francisco, CA, U.S.A 5Department of Oral Biology, School of Dental Medicine, University at Buffalo, The State University of New York, Buffalo, NY, U.S.A 6Department of Otolaryngology, School of Medicine, University of California, San Francisco, CA, U.S.A 7Present address: Weill-Cornell Medical College, Physiology and Biophysics Department 8Lead Contact SUMMARY Salivary proteins are essential for maintaining health in the oral cavity and proximal digestive tract, and they serve as potential diagnostic markers for monitoring human health and disease.
    [Show full text]
  • Development and Validation of a Serum Biomarker Panel for The
    Journal of Cancer 2017, Vol. 8 2346 Ivyspring International Publisher Journal of Cancer 2017; 8(12): 2346-2355. doi: 10.7150/jca.19465 Research Paper Development and Validation of a Serum Biomarker Panel for the Detection of Esophageal Squamous Cell Carcinoma through RNA Transcriptome Sequencing Shan Xing1,2†, Xin Zheng1,2†, Li-Qiang Wei4†, Shi-Jian Song5, Dan Liu1,3, Ning Xue1,3, Xiao-Min Liu1,2, Mian-Tao Wu1,2, Qian Zhong1,3, Chu-Mei Huang6, Mu-Sheng Zeng1,3, Wan-Li Liu1,2 1. State Key Laboratory of Oncology in Southern China, Collaborative Innovation Center for Cancer Medicine, Guangzhou, China 2. Department of Clinical Laboratory, Sun Yat-sen University Cancer Center, Guangzhou, China 3. Department of Experimental Research, Sun Yat-sen University cancer center, Guangzhou, China 4. Department of Clinical Laboratory, Shaanxi Provincial People’s Hospital, Xian, China 5. Guangdong Experimental High School, Guangzhou, China 6. Department of Laboratory Medicine, Sun Yat-sen University First Affiliated Hospital, Guangzhou, China † Xing S, Zheng X and Wei LQ contributed equally to this work Corresponding authors: Wan-Li Liu. Email: [email protected]; Phone: 86-020-87343196. Department of Clinical Laboratory, Sun Yat-sen University Cancer Center, 651 Dongfeng Road East,Guangzhou 510060, P.R. China. Mu-Sheng Zeng; Email: [email protected] Phone: +86-020-87343192. Department of Experimental Research, Sun Yat-sen University cancer center, 651 Dongfeng Road East,Guangzhou 510060, P.R.China © Ivyspring International Publisher. This is an open access article distributed under the terms of the Creative Commons Attribution (CC BY-NC) license (https://creativecommons.org/licenses/by-nc/4.0/).
    [Show full text]
  • Expression and Purification of Functional Recombinant CUL2
    www.nature.com/scientificreports OPEN Expression and purifcation of functional recombinant CUL2•RBX1 from E. coli Stephanie Diaz1, Lihong Li1,2, Kankan Wang1 & Xing Liu1,2* Cullin-2 (CUL2) based cullin-RING ligases (CRL2s) comprise a family of ubiquitin E3 ligases that exist only in multi-cellular organisms and are crucial for cellular processes such as embryogenesis and viral pathogenesis. CUL2 is the scafold protein that binds one of the interchangeable substrate receptor modules, which consists of adaptor proteins and the substrate receptor protein. The VHL protein is a substrate receptor known to target hypoxia-inducible factor α (HIF1α) for ubiquitination and degradation. Because of its critical role in the ubiquitination of important cellular factors such as HIF1α, CRL2s have been investigated for their biological functions and the development of novel therapeutics against diseases. Given the importance of CRL2s in biological and biomedical research, methods that efciently produce functional CUL2 proteins will greatly facilitate studies on the mechanism and regulation of CRL2s. Here, we report two cost-efective systems for the expression and purifcation of recombinant human CUL2 from E. coli cells. The purifed CUL2 proteins were ~ 95% pure, could bind their substrate receptor modules, and were enzymatically active in transferring ubiquitin or ubiquitin-like protein to the corresponding substrate in in vitro assays. The presented methodological advancements will help advance research in CRL2 function and regulation. Protein turnover is a cellular regulatory system defned by the continuous synthesis and decomposition of specifc proteins to maintain the integrity of optimally functioning proteins 1,2. Abnormalities during protein turnover, specifcally during protein degradation, ofen result in human diseases such as cystic fbrosis and liposarcoma.
    [Show full text]
  • Catenin/T-Cell Factor Signaling Identified by Gene Expression Profiling of Ovarian Endometrioid Adenocarcinomas1
    [CANCER RESEARCH 63, 2913–2922, June 1, 2003] Novel Candidate Targets of ␤-Catenin/T-cell Factor Signaling Identified by Gene Expression Profiling of Ovarian Endometrioid Adenocarcinomas1 Donald R. Schwartz,2 Rong Wu,2 Sharon L. R. Kardia, Albert M. Levin, Chiang-Ching Huang, Kerby A. Shedden, Rork Kuick, David E. Misek, Samir M. Hanash, Jeremy M. G. Taylor, Heather Reed, Neali Hendrix, Yali Zhai, Eric R. Fearon, and Kathleen R. Cho3 Comprehensive Cancer Center and Departments of Pathology [D. R. S., R. W., H. R., N. H., Y. Z., E. R. F., K. R. C.], Internal Medicine [E. R. F., K. R. C.], Pediatrics and Communicable Diseases [R. K., D. E. M., S. M. H.], and Biostatistics [C-C. H., J. M. G. T.], School of Medicine, Department of Epidemiology [S. L. R. K., A. M. L.], School of Public Health and Statistics [K. A. S.], College of Literature Science and the Arts, University of Michigan, Ann Arbor, Michigan 48109-0638 ABSTRACT specific molecular and pathobiological features [reviewed by Feeley and Wells (2) and Aunoble et al. (3)]. ␤ ␤ The activity of -catenin ( -cat), a key component of the Wnt signaling OEAs4 are characterized by frequent (16–54%) mutations of pathway, is deregulated in about 40% of ovarian endometrioid adenocar- CTNNB1, the gene encoding ␤-cat, a critical component of the Wnt cinomas (OEAs), usually as a result of CTNNB1 gene mutations. The signaling pathway (4–9). Wnts are a highly conserved family of function of ␤-cat in neoplastic transformation is dependent on T-cell factor (TCF) transcription factors, but specific genes activated by the secreted growth factors that bind members of the frizzled family of interaction of ␤-cat with TCFs in OEAs and other cancers with Wnt transmembrane receptors and, through downstream signaling, modu- pathway defects are largely unclear.
    [Show full text]
  • CST1 Purified Maxpab Mouse Polyclonal Antibody (B01P)
    CST1 purified MaxPab mouse polyclonal antibody (B01P) Catalog # : H00001469-B01P 規格 : [ 50 ug ] List All Specification Application Image Product Mouse polyclonal antibody raised against a full-length human CST1 Western Blot (Transfected lysate) Description: protein. Immunogen: CST1 (NP_001889.2, 1 a.a. ~ 141 a.a) full-length human protein. Sequence: MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHF AISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQP NLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES enlarge Host: Mouse Reactivity: Human Quality Control Antibody reactive against mammalian transfected lysate. Testing: Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Publication Reference 1. Cystatin SN Upregulation in Patients with Seasonal Allergic Rhinitis. Imoto Y, Tokunaga T, Matsumoto Y, Hamada Y, Ono M, Yamada T, Ito Y, Arinami T, Okano M, Noguchi E, Fujieda SPLoS One. 2013;8(8):e67057. doi: 10.1371/journal.pone.0067057. 2. Upregulation of the cysteine protease inhibitor, Cystatin SN, contributes to cell proliferation and cathepsin inhibition in gastric cancer. Choi EH, Kim JT, Kim JH, Kim SY, Song EY, Kim JW, Kim SY, Yeom YI, Kim IH, Lee HG.Clin Chim Acta. 2009 Aug;406(1-2):45-51. Epub 2009 May 19. Applications Western Blot (Transfected lysate) Page 1 of 2 2016/5/20 Western Blot analysis of CST1 expression in transfected 293T cell line (H00001469-T01) by CST1 MaxPab polyclonal antibody. Lane 1: CST1 transfected lysate(15.51 KDa). Lane 2: Non-transfected lysate. Protocol Download Gene Information Entrez GeneID: 1469 GeneBank NM_001898.2 Accession#: Protein NP_001889.2 Accession#: Gene Name: CST1 Gene Alias: - Gene cystatin SN Description: Omim ID: 123855 Gene Ontology: Hyperlink Gene Summary: The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences.
    [Show full text]