DOCSLIB.ORG

Transgenics (I): How to Make Them

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Transgenics (I): How to Make Them Transgenics (I): how to make them Stable transgenesis: !! !• Tol2! !• BAC transgenesis ! ! Making transgenesis vectors:! !• Gateway-based methods !! ! !! Other methods:! !• Ac/Ds (Maize), Sleeping Beauty, !Emelyanov et al., 2006 " Tol1, other transposons? ! !Davidson et al., 2003! !• I-SceI ! !Thermes et al., 2002! ! Transgenesis methods Linear or circularized DNA !most mosaic; inserts as rearranged concatamers;" transgenesis rate ~1%! ! DNA linearized with I-SceI !less mosaic; sometimes inserts as single-copy; transgenesis rate ~10%! ! BACs (linear) !mosaic; smaller concatamers; 1% (variable); iTol2, 20%+! ! Transposons (Tol2 etc.) !least mosaic; usually inserts as clean single copies; transgenesis rates of 30-50%! ! Plasmid transgenesis isl2b:gfp! Andrew Pittman! Transgenesis problems Driving expression in desired cells/tissues! !• find appropriate enhancer/promoter! !• avoid ectopic expression! !• BACs can be a solution! ! Silencing/variegation! !• depends on construct sequence! !• made worse by concatamerization! !• depends on insertion position! BAC recombination (recombineering) BAC transgenics phox2b:gfp! neuroD:gfp! Alex Nechiporuk! Tol2 transposon Kawakami et al.! iTol2: inverse tol2 for BACS Bussmann and Sculte- Merker 2011 the Tol2kit: a system for rapid construction of transgenesis vectors • transgenesis efficiency => Tol2! • tedious conventional subcloning => 3-part multisite Gateway, multiple pretested standard elements! • difficulty detecting nonfluorescent transgenes (hs or UAS; Gal4, etc.) => IRES markers, cmlc2:egfp transgenesis marker in backbone! more info: http://chien.neuro.utah.edu/tol2kitwiki/! The 3-way LR reaction is very efficient entry clones destination vector • entry clones made by PCR, then simple BP reaction! • LR: overnight in vitro recombination, then transformation! • >99% correct colonies with clear/opaque selection! Kristen Kwan, Esther Fujimoto mix and match: Tol2kit entry clones beta-actin! EGFP! polyA! hsp70! EGFP-CAAX! EGFP-pA! h2afx! nls-EGFP! mCherry-pA! CMV/SP6! mCherry! myc-pA! 10x UAS! mCherry-CAAX! IRES-EGFP-pA! MCS! nls-mCherry! IRES-EGFP-CAAX-pA! my favorite! H2A-mCherry! IRES-nls-EGFP-pA! promoter! Gal4VP16! my favorite! gene! Kwan, Fujimoto, et al. Transgenics (II): how to identify/propagate them Tracking transgenes:! •# linked transgenesis marker! •# IRES! •# PTV viral 2A peptide! Making transgenes visible: cmlc2:gfp Two transgenes act independently:! • cmlc2:gfp marker drives only in heart, not after heat-shock! • hsp70l:mCherry-CAAX drives only after HS, not in heart! Kristen Kwan Making transgenes visible: EMCV IRES confocal images of trunk, 24 hpf! • transient expression from beta-actin promoter shows excellent colocalization between two cistrons! Kristen Kwan Making transgenes visible: viral 2A tagging Provost et al., 2007! nls-mCherry 2A EGFPCAAX nls-mCherry HPAFLYKVGGSGATNFSLLKQAGDVEENPG + P EGFPCAAX 9+21 aa C-terminal fusion N-terminal proline red green merge A A’ A’’ IRES vs. 2A bactin2: nlsEGFP - bactin2: nlsEGFP - IRES-EGFPCAAXpA 2A-EGFPCAAXpA C D B B’ B’’ Kristen Kwan Transgenics (III): conditional or tissue-specific expression heatshock! Gal4/UAS! ! Others: ! !! !• Cre/Lox !Thummel et al., 2005 ! !! !• Tet on/off !Huang et al., 2005! !• ecdysone receptor !Esengil et al., 2007! !• mifepristone/PR !Emelyanov and Parinov, 2008! hsp70l promoter hs for 1 hour at 37°C gives ubiquitous expression! Halloran et al., 2000! Gal4 enhancer trapping Baier lab enhancer trap screen Scott et al., 2007! Issues with Gal4 enhancer traps Toxicity of Gal4VP16 overexpression! !• modified Gal4s (Gal4FF)! Basal/background expression! !• different minimal promoters! Variegation! !• UAS prone to methylation (Goll et al., 2009)! !• improved but not eliminated by Tol2! Position effects! !• development of site-specific integration (phi31c)?! Transgenics (IV): what to express Genes of interest! ! Activatable fluorescent proteins! ! Calcium reporters (or FRET-based reporters)! ! Activity modifiers! • ion channels! • tetanus toxin! ! Photoactivatable channels (channelrhodopsin)! ! Cell killing (nitroreductase)! UAS:Kaede Parsons et al., 2006! Hatta et al., 2006! Nitroreductase ablation Metronidazole! conversion! Pisharath et al., 2007; also Curado et al., 2008! References! Asakawa K, Kawakami K. Targeted gene expression by the Gal4-UAS system in zebrafish. Dev Growth Difer. 2008 Aug;50(6):391-9. Curado S, Stainier DY, Anderson RM. Nitroreductase-mediated cell/tissue ablation in zebrafish: a spatially and temporally controlled ablation method with applications in developmental and regeneration studies. Nat Protoc. 2008;3(6):948-54. Davidson AE, Balciunas D, Mohn D, Shafer J, Hermanson S, Sivasubbu S, Clif MP, Hackett PB, Ekker SC. Efcient gene delivery and gene expression in zebrafish using the Sleeping Beauty transposon. Dev Biol. 2003 Nov 15;263(2):191-202. Emelyanov A, Gao Y, Naqvi NI, Parinov S. Trans-kingdom transposition of the maize dissociation element. Genetics. 2006 Nov;174(3):1095-104. Emelyanov A, Parinov S. Mifepristone-inducible LexPR system to drive and control gene expression in transgenic zebrafish. Dev Biol. 2008 Aug 1;320(1):113-21. Goll MG, Anderson R, Stainier DYR, Spradling AC, Halpern ME. Transcriptional silencing and reactivation in transgenic zebrafish. Halloran MC, Sato-Maeda M, Warren JT, Su F, Lele Z, Krone PH, Kuwada JY, Shoji W. Laser-induced gene expression in specific cells of transgenic zebrafish. Development. 2000 127(9):1953-60. Hatta K, Tsujii H, Omura T. Cell tracking using a photoconvertible fluorescent protein. Nat Protoc. 2006;1(2):960-7. Huang CJ, Jou TS, Ho YL, Lee WH, Jeng YT, Hsieh FJ, Tsai HJConditional expression of a myocardium-specific transgene in zebrafish transgenic lines. Dev Dyn. 2005 Aug;233(4): 1294-303. Bussmann J, Schulte-Merker S. Rapid BAC selection for tol2-mediated transgenesis in zebrafish. Development. 2011 Oct;138(19):4327-32. Kawakami K, Takeda H, Kawakami N, Kobayashi M, Matsuda N, Mishina M. A transposon-mediated gene trap approach identifies developmentally regulated genes in zebrafish. Dev Cell. 2004 Jul;7(1): 133-44. Kwan KM, Fujimoto E, Grabher C, Mangum BD, Hardy ME, Campbell DS, Parant JM, Yost HJ, Kanki JP, Chien CB.The Tol2kit: a multisite gateway-based construction kit for Tol2 transposon transgenesis constructs.Dev Dyn. 2007 Nov;236(11):3088-99. Pisharath H, Rhee JM, Swanson MA, Leach SD, Parsons MJ.Targeted ablation of beta cells in the embryonic zebrafish pancreas using E. coli nitroreductase. Mech Dev. 2007 Mar;124(3):218-29. Provost E, Rhee J, Leach SD. Viral 2A peptides allow expression of multiple proteins from a single ORF in transgenic zebrafish embryos. Genesis. 2007 Oct;45(10):625-9. Scott EK, Mason L, Arrenberg AB, Ziv L, Gosse NJ, Xiao T, Chi NC, Asakawa K, Kawakami K, Baier H. Targeting neural circuitry in zebrafish using GAL4 enhancer trapping. Nat Methods. 2007 Apr;4(4): 323-6. Thermes V, Grabher C, Ristoratore F, Bourrat F, Choulika A, Wittbrodt J, Joly JS. I-SceI meganuclease mediates highly efcient transgenesis in fish. Mech Dev. 2002 Oct;118(1-2):91-8. Thummel R, Burket CT, Brewer JL, Sarras MP Jr, Li L, Perry M, McDermott JP, Sauer B, Hyde DR, Godwin AR. Cre-mediated site-specific recombination in zebrafish embryos. Dev Dyn. 2005 Aug; 233(4):1366-77. Villefranc JA, Amigo J, Lawson ND. Gateway compatible vectors for analysis of gene function in the zebrafish. Dev Dyn. 2007 Nov;236(11):3077-87. Yang Z, Jiang H, Chachainasakul T, Gong S, Yang XW, Heintz N, Lin S. Modified bacterial artificial chromosomes for zebrafish transgenesis. Methods. 2006 Jul;39(3):183-8. .
Load more

Recommended publications
  • Rapid Effects of Sex Steroids on PGF2 Approach Response in Zebrafish
    Rapid effects of sex steroids on PGF2� approach response in zebrafish (Danio rerio) Student Researcher: Leah B. Kratochvil, Advisor: Richmond R. Thompson Bowdoin College Department of Neuroscience Abstract Steroids are molecular messengers that regulate a variety of bodily functions, including behaviors and sexual motivation. Steroids have long been known to induce behavioral effects in days or weeks, but more recently have been discovered to effect these changes within seconds. Research surrounding these so-called “rapid” effects of steroids on sensory systems is lacking. I took advantage of the sophisticated sex pheromone system in zebrafish to study this system, and the male zebrafish approach response to the pre-ovulatory pheromone prostaglandin F2� (PGF2�). Sexually mature male zebrafish were treated with vehicle, T, or 11-ketotestosterone (11-KT) for 40 minutes, and then immediately evaluated for time spent near vehicle or PGF2� administered to their test tank. Initial data suggests that T-treated fish spent more time near the pheromone, indicating that T may rapidly modulate this response in zebrafish. There were no significant differences between treatments. Further investigation, with higher steroid and pheromone concentrations and a slightly different experimental design, is underway to confirm how T and/or 11-KT modulate(s) the male zebrafish approach response to PGF2�. Project Objectives Classically, steroids have been thought to act in the body by binding to intracellular receptors and inducing gene transcription, protein translation and ultimately behavioral responses. However, because this process – termed the “genomic” mechanism due to its interactions with the genome – takes time, these genomic behavioral effects usually take days or weeks to appear.
    [Show full text]
  • The Effect of Fluoxetine on Self-Control in Betta Splendens
    University of Montana ScholarWorks at University of Montana Graduate Student Theses, Dissertations, & Professional Papers Graduate School 2014 The effect of fluoxetine on self-control in betta splendens Kathryn Gwen Lamp The University of Montana Follow this and additional works at: https://scholarworks.umt.edu/etd Let us know how access to this document benefits ou.y Recommended Citation Lamp, Kathryn Gwen, "The effect of fluoxetine on self-control in betta splendens" (2014). Graduate Student Theses, Dissertations, & Professional Papers. 10770. https://scholarworks.umt.edu/etd/10770 This Dissertation is brought to you for free and open access by the Graduate School at ScholarWorks at University of Montana. It has been accepted for inclusion in Graduate Student Theses, Dissertations, & Professional Papers by an authorized administrator of ScholarWorks at University of Montana. For more information, please contact [email protected]. THE EFFECT OF FLUOXETINE ON SELF-CONTROL IN BETTA SPLENDENS by KATHRYN GWEN LAMP Bachelor of Arts, Christopher Newport University, Newport News, VA, 2008 Master of Arts, The University of Montana, Missoula, MT, 2012 Dissertation presented in partial fulfillment of the requirements for the degree of Doctor of Philosophy in Experimental Psychology The University of Montana Missoula, MT June 2014 Approved by: Dr. Allen Szalda-Petree, Chair Department of Psychology Dr. Nabil Haddad Department of Psychology Dr. Stuart Hall Department of Psychology Dr. Jerry Smith Department of Biomedical and Pharmaceutical Sciences Dr. Keith Parker Department of Biomedical and Pharmaceutical Sciences UMI Number: 3628951 All rights reserved INFORMATION TO ALL USERS The quality of this reproduction is dependent upon the quality of the copy submitted.
    [Show full text]
  • Housing, Husbandry and Welfare of a “Classic” Fish Model, the Paradise Fish (Macropodus Opercularis)
    animals Article Housing, Husbandry and Welfare of a “Classic” Fish Model, the Paradise Fish (Macropodus opercularis) Anita Rácz 1,* ,Gábor Adorján 2, Erika Fodor 1, Boglárka Sellyei 3, Mohammed Tolba 4, Ádám Miklósi 5 and Máté Varga 1,* 1 Department of Genetics, ELTE Eötvös Loránd University, Pázmány Péter stny. 1C, 1117 Budapest, Hungary; [email protected] 2 Budapest Zoo, Állatkerti krt. 6-12, H-1146 Budapest, Hungary; [email protected] 3 Fish Pathology and Parasitology Team, Institute for Veterinary Medical Research, Centre for Agricultural Research, Hungária krt. 21, 1143 Budapest, Hungary; [email protected] 4 Department of Zoology, Faculty of Science, Helwan University, Helwan 11795, Egypt; [email protected] 5 Department of Ethology, ELTE Eötvös Loránd University, Pázmány Péter stny. 1C, 1117 Budapest, Hungary; [email protected] * Correspondence: [email protected] (A.R.); [email protected] (M.V.) Simple Summary: Paradise fish (Macropodus opercularis) has been a favored subject of behavioral research during the last decades of the 20th century. Lately, however, with a massively expanding genetic toolkit and a well annotated, fully sequenced genome, zebrafish (Danio rerio) became a central model of recent behavioral research. But, as the zebrafish behavioral repertoire is less complex than that of the paradise fish, the focus on zebrafish is a compromise. With the advent of novel methodologies, we think it is time to bring back paradise fish and develop it into a modern model of Citation: Rácz, A.; Adorján, G.; behavioral and evolutionary developmental biology (evo-devo) studies. The first step is to define the Fodor, E.; Sellyei, B.; Tolba, M.; housing and husbandry conditions that can make a paradise fish a relevant and trustworthy model.
    [Show full text]
  • Zebrafish Embryos and Bioinformatics: Useful and Marketable Exercises for Students Enrolled in Upper-Level Undergraduate Courses
    2019 Eastern Biologist Special Issue 1 Zebrafish as a Model System for Research and Teaching A. Davis, H. Nguyen, and J. Qian 2019 Eastern Biologist Special Issue 1:47–63 Zebrafish Embryos and Bioinformatics: Useful and Marketable Exercises for Students Enrolled in Upper-Level Undergraduate Courses Adam Davis1*, Hong Nguyen1, and Jo Qian1 Abstract - The zebrafish (Danio rerio) is a widely used vertebrate model system in several branches of biological research, including molecular biology, developmental biology, and evolutionary biology. The rapid and transparent development of embryos outside of the mother allows for real- time observation of embryonic development of different types of organ systems. However, the types of wet-lab exercises involving zebrafish embryos that undergraduate students can perform during a 2-3 hour laboratory period are limited. Recent advances in bioinformatics applications and the availability of genomic sequence data from zebrafish and other evolutionarily divergent vertebrates, including human, allow students to be actively involved in semester-long molecular, evolutionary, and developmental biology projects that can be performed both in and out of the laboratory. In this paper, we report several exercises that can be used in upper level undergraduate biology courses that include a 2-3 hour weekly laboratory session. These exercises include amino acid and genomic DNA sequence alignment and gene expression analysis of Hoxa2, a developmental regulatory gene that is highly characterized in its expression and function. All exercises make use of standard operating procedures for training students on new techniques. The exercises presented will provide several learning outcomes for students, including the identification of conserved protein domains and cis- regulatory elements and how mutations to these motifs can lead to evolutionary diversity as well as the development of homeostatic imbalances in humans.
    [Show full text]
  • Lower Organisms As Alternatives for Toxicity Testing in Rodents with a Focus on Ceanorhabditis Elegans and the Zebrafish (Danio Rerio)
    Report 340720003/2009 L.T.M. van der Ven Lower organisms as alternatives for toxicity testing in rodents With a focus on Ceanorhabditis elegans and the zebrafish (Danio rerio) RIVM report 340720003/2009 Lower organisms as alternatives for toxicity testing in rodents With a focus on Caenorhabditis elegans and the zebrafish (Danio rerio) L.T.M. van der Ven Contact: L.T.M. van der Ven Laboratory for Health Protection Research [email protected] This investigation has been performed by order and for the account of the Ministry of Health, Welfare and Sport, within the framework of V/340720 Alternatives for animal testing RIVM, P.O. Box 1, 3720 BA Bilthoven, the Netherlands Tel +31 30 274 91 11 www.rivm.nl © RIVM 2009 Parts of this publication may be reproduced, provided acknowledgement is given to the 'National Institute for Public Health and the Environment', along with the title and year of publication. RIVM report 340720003 2 Abstract Lower organisms as alternatives for toxicity testing in rodents With a focus on Caenorhabiditis elegans and the zebrafish (Danio rerio) The nematode C. elegans and the zebrafish embryo are promising alternative test models for assessment of toxic effects in rodents. Tests with these lower organisms may have a good predictive power for effects in humans and are thus complementary to tests with in vitro models (cell cultures). However, all described tests need further validation. This is the outcome of a literature survey, commissioned by the ministry of Health, Welfare and Sport of the Netherlands. The survey is part of the policy to reduce, refine and replace animal testing (3R policy).
    [Show full text]
  • Stages of Embryonic Development of the Zebrafish
    DEVELOPMENTAL DYNAMICS 2032553’10 (1995) Stages of Embryonic Development of the Zebrafish CHARLES B. KIMMEL, WILLIAM W. BALLARD, SETH R. KIMMEL, BONNIE ULLMANN, AND THOMAS F. SCHILLING Institute of Neuroscience, University of Oregon, Eugene, Oregon 97403-1254 (C.B.K., S.R.K., B.U., T.F.S.); Department of Biology, Dartmouth College, Hanover, NH 03755 (W.W.B.) ABSTRACT We describe a series of stages for Segmentation Period (10-24 h) 274 development of the embryo of the zebrafish, Danio (Brachydanio) rerio. We define seven broad peri- Pharyngula Period (24-48 h) 285 ods of embryogenesis-the zygote, cleavage, blas- Hatching Period (48-72 h) 298 tula, gastrula, segmentation, pharyngula, and hatching periods. These divisions highlight the Early Larval Period 303 changing spectrum of major developmental pro- Acknowledgments 303 cesses that occur during the first 3 days after fer- tilization, and we review some of what is known Glossary 303 about morphogenesis and other significant events that occur during each of the periods. Stages sub- References 309 divide the periods. Stages are named, not num- INTRODUCTION bered as in most other series, providing for flexi- A staging series is a tool that provides accuracy in bility and continued evolution of the staging series developmental studies. This is because different em- as we learn more about development in this spe- bryos, even together within a single clutch, develop at cies. The stages, and their names, are based on slightly different rates. We have seen asynchrony ap- morphological features, generally readily identi- pearing in the development of zebrafish, Danio fied by examination of the live embryo with the (Brachydanio) rerio, embryos fertilized simultaneously dissecting stereomicroscope.
    [Show full text]
  • Guidelines for Use of Zebrafish in the NIH Intramural Research Program
    Guidelines for Use of Zebrafish in the NIH Intramural Research Program Background: The PHS Policy on Humane Care and Use of Laboratory Animals defines animal as, “any live, vertebrate animal used or intended for use in research, research training, experimentation or biological testing or for related purposes.”1 Furthermore, OLAW interpretation of PHS policy considers aquatic species as "live, vertebrate animals" at hatching.2 Although this is an imprecise stage for zebrafish it can be approximated at 72 hours post fertilization. General Guidelines for Animal Study Proposals (ASPs): • For purposes of animal number accountability, all stages of development greater than three days post fertilization(dpf) should be counted in an approved ASP. Due to the high throughput nature of the zebrafish model, large numbers of animals may be listed on ASPs (Section B and Section H in the NIH ASP Template). However, the majority of studies are completed on larval zebrafish between 4-7dpf. Therefore, to understand animal use, an Animal Care and Use Committee (ACUC) may request that investigators report their annual animal numbers separately as larval stages (4-7 dpf) and those animals reared past > 8dpf. • Brain structures required for the affective experience of noxious stimuli are immature at early larval stages (up to 7 dpf).3-9 The number of larvae used may be provided as an estimate considering their size and normal housing conditions. • When evaluating “Sex as a biological variable…”, the Principal Investigator (PI) and ACUC must consider age since sex is undetermined until at least 25 dpf.10,11 Common Zebrafish Procedures: Tissue Collection for Genotyping • Fin clipping for DNA analysis and/or genotyping must be described in the ASP and approved by the IC ACUC.
    [Show full text]
  • Enrichment for Laboratory Zebrafish—A Review of the Evidence and the Challenges
    animals Review Enrichment for Laboratory Zebrafish—A Review of the Evidence and the Challenges Chloe H. Stevens *, Barney T. Reed and Penny Hawkins Animals in Science Department, RSPCA, Wilberforce Way, Southwater, West Sussex RH13 9RS, UK; [email protected] (B.T.R.); [email protected] (P.H.) * Correspondence: [email protected] Simple Summary: The zebrafish is one of the most commonly used animals in scientific research, but there remains a lack of consensus over good practice for zebrafish housing and care. One such area which lacks agreement is whether laboratory zebrafish should be provided with environmental enrichment—additions or modifications to the basic laboratory environment which aim to improve welfare, such as plastic plants in tanks. The need for the provision of appropriate environmental enrichment has been recognised in other laboratory animal species, but some scientists and animal care staff are hesitant to provide enrichment for zebrafish, arguing that there is little or no evidence that enrichment can benefit zebrafish welfare. This review aims to summarise the current literature on the effects of enrichment on zebrafish physiology, behaviour and welfare, and identifies some forms of enrichment which are likely to benefit zebrafish. It also considers the possible challenges that might be associated with introducing more enrichment, and how these might be addressed. Abstract: Good practice for the housing and care of laboratory zebrafish Danio rerio is an increasingly discussed topic, with focus on appropriate water quality parameters, stocking densities, feeding Citation: Stevens, C.H.; Reed, B.T.; regimes, anaesthesia and analgesia practices, methods of humane killing, and more.
    [Show full text]
  • Structure of the Zebrafish Snail1 Gene and Its Expression in Wild-Type
    Development 119, 1203-1215 (1993) 1203 Printed in Great Britain © The Company of Biologists Limited 1993 Structure of the zebrafish snail1 gene and its expression in wild-type, spadetail and no tail mutant embryos C. Thisse1, B. Thisse1, T. F. Schilling2 and J. H. Postlethwait1 1Institute of Molecular Biology and 2Institute of Neuroscience, University of Oregon, Eugene OR 97403 USA SUMMARY Mesoderm formation is critical for the establishment of cephalic neural crest derivatives. Many snail1-express- the animal body plan and in Drosophila requires the ing cells were missing from mutant spadetail embryos snail gene. This report concerns the cloning and and the quantity of snail1 RNA was greatly reduced in expression pattern of the structurally similar gene snail1 mutant no tail embryos. The work presented here from zebrafish. In situ hybridization shows that the suggests that snail1 is involved in morphogenetic events quantity of snail1 RNA increases at the margin of the during gastrulation, somitogenesis and development of blastoderm in cells that involute during gastrulation. As the cephalic neural crest, and that no tail may act as a gastrulation begins, snail1 RNA disappears from the positive regulator of snail1. dorsal axial mesoderm and becomes restricted to the paraxial mesoderm and the tail bud. snail1 RNA increases in cells that define the posterior border of each Key words: branchial arches, Brachydanio rerio, epiboly, somite and then disappears when somitic cells differen- gastrulation, mesoderm, neural crest, no tail, paraxial mesoderm, tiate. Later in development, expression appears in snail1, somitogenesis, spadetail, zebrafish, zinc finger INTRODUCTION and snail (Ip et al., 1991) that are required for mesoderm formation (Thisse et al., 1988; Alberga et al., 1991).
    [Show full text]
  • The Art and Design of Genetic Screens: Zebrafish
    REVIEWS THE ART AND DESIGN OF GENETIC SCREENS: ZEBRAFISH E. Elizabeth Patton and Leonard I. Zon Inventive genetic screens in zebrafish are revealing new genetic pathways that control vertebrate development, disease and behaviour. By exploiting the versatility of zebrafish, biological processes that had been previously obscured can be visualized and many of the responsible genes can be isolated. Coupled with gene knockdown and overexpression technologies, and small-molecule-induced phenotypes, genetic screens in zebrafish provide a powerful system by which to dissect vertebrate gene function and gene networks. GYNOGENESIS Twenty years ago, George Streisinger’s pioneering First large-scale vertebrate genetic screens Development of an organism research revealed the potential of the zebrafish as a ver- Systematic genome-wide screens for mutations in derived from the genetic tebrate organism that was suitable for forward genetic worms, flies and plants have successfully identified material of the female gamete. screening1. A relatively small fish (3–4 cm long as an many genes that define embryological pathways. adult), zebrafish can be easily managed in large num- Smaller collections of mammalian mutants provide bers in the laboratory environment. The ability to com- valuable insights into developmental processes. bine embryological and genetic methodology has However, identifying large numbers of mutations in established the zebrafish as a powerful research tool. the mammalian system is problematic because of External development of transparent embryos allows intrauterine development and expensive supporting fundamental vertebrate developmental processes — laboratory facilities. The remarkable characteristics of from gastrulation to organogenesis — to be visualized the zebrafish, along with the initial success of the first and studied; in addition, the heart beats and blood cir- zebrafish genetic screens4, inspired two groups of scien- culation of the embryo are readily observed.
    [Show full text]
  • A Multifunctional Mutagenesis System for Analysis of Gene Function in Zebrafish
    G3: Genes|Genomes|Genetics Early Online, published on April 2, 2015 as doi:10.1534/g3.114.015842 A Multifunctional Mutagenesis System for Analysis of Gene Function in Zebrafish Helen Ngoc Bao Quach*,#, Shijie Tao*,§#, Pavle Vrljicak*,†,#, Adita Joshi*, Hua Ruan *, Rashmi Sukumaran*, Gaurav K. Varshneyǂ, Matthew C. LaFaveǂ, The Ds screen team^, Shawn M. Burgessǂ, Christoph Winkler§,**, Alexander Emelyanov*, Sergey Parinov*, and Karuna Sampath§,†,1 # These authors contributed equally * Temasek Life Sciences Laboratory, National University of Singapore, Singapore 117604 § Department of Biological Sciences, National University of Singapore, Singapore 117543 † Division of Biomedical Cell Biology, Warwick Medical School, Coventry, United Kingdom CV4 7AJ ǂ National Human Genome Research Institute, National Institutes of Health, Bethesda, MD 20892-8004 ** Centre for Bioimaging Sciences, National University of Singapore, Singapore 117543 ^ The Ds screen team: DBS, NUS: Joerg Renn, Yin Jun, Jan Brocher, Bernd Willems, Yao Sheng, Flora Rajaei, Ram Vinod Roy NUS: Robyn Lim, Nur Adilah Bte Mahbob, Krishna Balasubramaniam, Choi Kwun, Ng Xiu Li NTU: Engel Teo, Kau Jie Hung, Eirene Koh, Sim Zhi Wei; Nur Zatul Ezza Bte Zainal Rong Li (Ngee Ann Polytechnic), Kim Wei Liang (Republic Polytechnic), Melvin Teo (Singapore Polytechnic) NUS High School of Mathematics and Science: Kiang Teng, Phan Nop 1 © The Author(s) 2013. Published by the Genetics Society of America. Running Title: Zebrafish Ac/Ds Mutagenesis screen Key words: functional genomics, insertional mutagenesis, Ac/Ds transposon, gene expression 1Author for correspondence: Karuna Sampath Division of Biomedical Cell Biology Warwick Medical School University of Warwick Coventry CV4 7AJ United Kingdom Phone: +44 (0) 24 765 73412 Email: [email protected] 2 ABSTRACT Since the sequencing of the human reference genome, many human disease-related genes have been discovered.
    [Show full text]
  • Expansion Microscopy of Zebrafish for Neuroscience and Developmental
    Expansion microscopy of zebrafish for neuroscience PNAS PLUS and developmental biology studies Limor Freifelda, Iris Odstrcilb, Dominique Försterc, Alyson Ramirezb, James A. Gagnonb, Owen Randlettb, Emma K. Costad, Shoh Asanoa, Orhan T. Celikere, Ruixuan Gaoa,f, Daniel A. Martin-Alarcong, Paul Reginatog,h, Cortni Dicka, Linlin Chena,i, David Schoppikj,k,l, Florian Engertb, Herwig Baierc, and Edward S. Boydena,d,e,f,m,1 aMedia Lab, Massachusetts Institute of Technology (MIT), Cambridge, MA 02139; bDepartment of Molecular and Cellular Biology, Harvard University, Cambridge, MA 02138; cDepartment Genes–Circuits–Behavior, Max Planck Institute of Neurobiology, Martinsried 82152, Germany; dDepartment of Brain and Cognitive Sciences, MIT, Cambridge, MA 02139; eDepartment of Electrical Engineering and Computer Science, MIT, Cambridge, MA 02139; fMcGovern Institute for Brain Research, MIT, Cambridge, MA 02139; gDepartment of Biological Engineering, MIT, Cambridge, MA 02139; hDepartment of Genetics, Harvard Medical School, Cambridge, MA 02138; iNeuroscience Program, Wellesley College, Wellesley, MA 02481; jDepartment of Otolaryngology, New York University School of Medicine, New York, NY 10016; kDepartment of Neuroscience and Physiology, New York University School of Medicine, New York, NY 10016; lNeuroscience Institute, New York University School of Medicine, New York NY 10016; and mCenter for Neurobiological Engineering, MIT, Cambridge, MA 02139 Edited by Lalita Ramakrishnan, University of Cambridge, Cambridge, United Kingdom, and approved October 25, 2017 (received for review April 17, 2017) Expansion microscopy (ExM) allows scalable imaging of preserved nections in the intact brain, using circuitry responsible for the 3D biological specimens with nanoscale resolution on fast vestibulo-ocular reflex (11–13) and the escape response (14) as diffraction-limited microscopes.
    [Show full text]