DOCSLIB.ORG

2016 IPA LB Articles Prev Yrs

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
2016 IPA LB Articles Prev Yrs 2016 International Publication Awardees Publications (Journal Articles and Conference Papers) during the Previous Years UP LOS BAÑOS (as of 31 December 2016) SEQ UNIT AUTHOR(S) TITLE JOURNAL 1 AGRICULTURE Absulio, Wella L. Tamarind ( Tamarindus indica L.) Extracts Philippine Agricultural Scientist, Dizon, Erlinda I. as Antimicrobial Agent Against Common 98 (4): 421-428, December 2015 Esguerra, Elda B. Spoilage Microorganisms of Fresh-Cut Vegatables 2 AGRICULTURE Adorada, Jessamyn R. Six New Species of the Genus Philippine Entomologist, 26 (2): Callimetopus Blanchard (Coleoptera: 103-119, October 2012 Cerambycidae: Lamiinae: Pteropliini) from the Philippines 3 AGRICULTURE Aguilar, Kristel Grace I. Phylogenetic Analysis, Fumonisin Journal of the Science of Food Cumagun, Christian Joseph Production and Pathogenicity of Fusarium Agriculture, 93 (12): 3032–3039, fujikuroi Strains Isolated from Rice in the September 2013 Philippines 4 AGRICULTURE Alviar, April N. Assessing the Response of Tolerant Papaya Philippine Journal of Crop Sta. Cruz, Filomena C. (Carica papaya L.) Varieties to Papaya Science, 37 (2): 20-28, August Hautea, Desiree M. Ringspot Virus (PRSV) Infection and 2012 Establishment of Symptom Severity Rating Scale for Resistance Screening 5 AGRICULTURE Barcos, Ana Kristine S. Foraging Behavior of the Yellow Netted Philippine Agricultural Scientist, Velasco, Luis Rey I. Ladybeetle Heteroneda billardieri Crotch 97 (2): 155-160, June 2014 Medina, Celia dR. (Coleoptera: Coccinellidae) 6 AGRICULTURE Cabanos, Cerrone S. Compositional Analysis of Transgenic Philippine Agricultural Scientist, Garcia, Roberta N. Papaya with Delayed Ripening Trait 96 (4): 331-339, December 2013 Mendoza, Evelyn Mae T. Page 1 of 20 SEQ UNIT AUTHOR(S) TITLE JOURNAL 7 AGRICULTURE Cumagun, Christian Joseph Identification of a Hidden Resistance Gene Phytopathology, 104 (6): 634-640, in Tetraploid Wheat Using Laboratory June 2014 Strains of Pyricularia oryzae Produced by Backcrossing 8 AGRICULTURE Cumagun, Christian Joseph Managing Plant Diseases and Promoting Journal of Agricultural Science Sustainability and Productivity with and Technology, 14 (4): 699-714, Trichoderma: The Philippine Experience July-August 2012 9 AGRICULTURE Cumagun, Christian Joseph First Report of Pseudocercospora jahnii in Australasian Plant Disease Notes, Acabal, Bienvenido Jr. D. the Philippines 9 (1): 148, 2 pages, December 2014 10 AGRICULTURE De la Cueva, Fe M. Elucidating the Resistance Response of Philippine Entomologist, 28 (2): Sison, Maria Luz J. Irradiated Banana cv. Lakatan to Banana 140-154, October 2014 Dinglasan, Eric G. Bunchy Top Virus (BBTV) Infection Damasco, Olivia P. Transmitted by the Banana Aphid Pentalonia nigronervosa Cocquerel 11 AGRICULTURE De la Cueva, Fe M. Variability of Sugarcane Smut Pathogen, Philippine Journal of Crop Cumagun, Christian Joseph Ustilago scitaminea Sydow in the Science, 37 (2): 38-51, August Velasco, Luis Rey I. Philippines 2012 Dalisay, Teresita U. 12 AGRICULTURE Delfin, Evelyn F. Biomass Partitioning, Yield, Nitrogen and Philippine Journal of Crop Rodriguez, Felicito M. Phosphorus Uptake of PGPR Inoculated Science, 40 (2): 59-65, August Paterno, Erlinda S. Tomato ( Lycopersicum esculentum L.) 2015 under Field Condition 13 AGRICULTURE Dulin, Jerome L. Socio-Economic Impacts of Climate Journal of Environmental Science Lalican, Nelita M. Change Support-Policies on Farming and Management, 18 (1): 61-70, Systems in a Village in Tuguegarao City, June 2015 Cagayan, Philippines Page 2 of 20 SEQ UNIT AUTHOR(S) TITLE JOURNAL 14 AGRICULTURE Espino, Rene Rafael C. Utilization of Simple Sequence Repeats Philippine Journal of Crop Markers in the Genetic Characterization of Science, 40 (3): 33-39, December Philippine Rubber Hevea brasiliensis 2015 (Wild, Ex A. Juss) Muell. Arg. Germplasm 15 AGRICULTURE Hautea, Desiree M. Genetic Diversity Analysis of Eggplant SABRAO Journal of Breeding and (Solanum melongena L.) and Related Wild Genetics, 42 (2): 183-201, 2014 Species in the Philippines using Morphological and SSR Markers 16 AGRICULTURE Hautea, Desiree M. "Tanglaw" and "Tanyag" - New NSIC- Philippine Journal of Crop Taylo, Lourdes D. Approved UPLB Eggplant ( Solanum Science, 39 (1): 67-73, April 2014 Navasero, Mario V. melongena L.) Hybrids for Commercial Cultivation in Luzon 17 AGRICULTURE Laude, Tonette P. Diallel Analysis among 16 Maize Euphytica, 200 (1): 29–44, Populations Adapted to the Northern U.S. November 2014 Corn Belt for Grain Yield and Grain Quality Traits 18 AGRICULTURE Laude, Tonette P. Genetic Diversity and Heterotic Grouping Euphytica, 204 (3): 661–677, of Tropical and Temperate Maize August 2015 Populations Adapted to the Northern U.S. Corn Belt 19 AGRICULTURE Lit, Merdelyn Caasi Intraspecific Life Cycle and Larval Instar Philippine Entomologist, 26 (1): Sapin, Gelyn D. Variations among Local Populations of 13-27, April 2012 Asian Corn Borer Ostrinia furcanalis (Guenee) (Lepidoptera:Crambidae) in the Philippines Page 3 of 20 SEQ UNIT AUTHOR(S) TITLE JOURNAL 20 AGRICULTURE Lit, Merdelyn Caasi. Behaviour of Second Instars of the Asian Philippine Entomologist, 28 (1): Sapin, Gelyn D. Corn Borer, Ostrinia furcanalis (Guenee) 57-75, April 2014 De Leus, Elisa G. (Lepidoptera:Crambidae) to Different Dacuba, Rachel H. Alternate Host Plants in the Philippines Mantala, Juanita P. Latiza, Suzette A. 21 AGRICULTURE Medina, Celia dR. Age Structure and Sex Ratio of Thrips, Agrivita, 35 (3): 227-236, October Scirtothrips dorsalis Hood (Thysanoptera : 2013 Thripidae) Associated with Mango Agroecosystem in East Java, Indonesia 22 AGRICULTURE Medina, Celia dR. Responses and Adaptation by Nephotettix Entomologia Experimentalis et virescens to Monogenic and Pyramided Applicata, 150: 179-190, 2014 Rice Lines with Grh-Resistance Genes 23 AGRICULTURE Ocampo, Virginia R. Role of New Novel Entomopathogenic International Journal of Caoili, Barbara L. Fungi Paecilomyces lilacinus to Mortality Biosciences, 7 (3): 16-23, 2015 and Infection Process of Tetranychus kanzawai (Kishida) (Tetranychidae: Acarina) 24 AGRICULTURE Pangga, Ireneo B. Climate Change Impacts on Plant Canopy European Journal of Plant Architecture: Implications for Pest and Pathology, 135 (3): 595–610, Pathogen Management March 2013 25 AGRICULTURE Pangga, Ireneo B. Implications of Bacterial Contaminated Plant Pathology, 64 (1): 43-50, Seed Lots and Endophytic Colonization by February 2015 Pseudomonas fuscovaginae on Rice Establishment 26 AGRICULTURE Pangga, Ireneo B. Pathogen Dynamics in a Crop Canopy and Plant Pathology, Special Issue: their Evolution under Changing Climate Climate Change and Plant Diseases, 60 (1): 70–81, February 2011 Page 4 of 20 SEQ UNIT AUTHOR(S) TITLE JOURNAL 27 AGRICULTURE Pangga, Ireneo B. Standardizing Resistance Screening to Euphytica, 192 (1): 1–16, July Pseudomonas fuscovaginae and Evaluation 2013 of Rice Germplasm at Seedling and Adult Plant Growth Stages 28 AGRICULTURE Ponaya, Ariane Comparative Genomics Identifies the New Phytologist, 206 (4): Cumagun, Christian Joseph Magnaporthe oryzae Avirulence Effector 1463–1475, June 2015 AvrPi9 that Triggers Pi9-Mediated Blast Resistance in Rice 29 AGRICULTURE Raros, Leonila Corpuz First Report of Malaconothridae (Acari, Acarina, 23 (1): 63-68, 2015 Oribatida) from the Philippines, with Description of a New Species of the Genus Malaconothrus 30 AGRICULTURE Rayos, Antonio A. Comparative Conception Rate of Philippine Journal of Veterinary Artificially Inseminated Dairy Cattle After Medicine, 52 (2): 107-112, 2015 Natural and Induced Estrus 31 AGRICULTURE Relevante, Cherry A. Control of Fusarium Wilt in Bittergourd Archives of Phytopathology and Cumagun, Christian Joseph and Bottlegourd by Biofumigation using Plant Protection, 46 (6): 747-753, Mustard var. Monteverde 2013 32 AGRICULTURE Rubico, Edsel C. Comparison of Wing Interference Patterns Philippine Entomologist, 29 (2): Yap, Sheryl A. of the Males of Armored Scale Insect 114-122, October 2015 Adorada, Jessamyn Species (Hemiptera: Sternorrhyncha: Diaspididae) from Coconut and their Undergrowth Plants in Selected Areas of Laguna and Quezon, Philippines 33 AGRICULTURE Sanchez, Jerwin L. Identification of Bemisia tabaci Philippine Entomologist, 29 (2): Caoili, Barbara L. (Gennadius) (Hemiptera: Aleyrodidae) 136-156, October 2015 Biotypes Using the Molecular Marker, Cytochrome c oxidase I (COI) Gene Page 5 of 20 SEQ UNIT AUTHOR(S) TITLE JOURNAL 34 AGRICULTURE Sanchez, Pearl B. Particulate and Dissolved Forms of N, P Journal of Environmental Sciences and Organic C Transported from Major and Management, 17 (1): 38-49, Land Uses in the Pagsanjan-Lumban June 2014 Catchment to Laguna de Bay, Philippines 35 AGRICULTURE Sta. Cruz, Pompe C. Agronomic Indices, Growth, Yield- Field Crops Research, 177: 15–25, Contributing Traits, and Yield of Dry- June 2015 Seeded Rice under Varying Herbicides 36 AGRICULTURE Sta. Cruz, Pompe C. Ecological Significance of Rice ( Oryza Journal of Pest Science, 88 (2): sativa ) Planting Density and Nitrogen 427–438, June 2015 Rates in Managing the Growth and Competitive Ability of Itchgrass (Rottboellia cochinchinensis ) in Direct- Seeded Rice Systems 37 AGRICULTURE Sta. Cruz, Pompe C. Effect of Nitrogen Application, Rice Weed Science, 63 (2): 448-460, Planting Density, and Water Regime on the April-June 2015 Morphological Plasticity and Biomass Partitioning of Chinese Sprangletop (Leptochloa chinensis ) 38 AGRICULTURE Sta. Cruz, Pompe C. Growth Analysis and Biomass Partitioning Crop Protection, 74: 92–102, of Cyperus iria in Response to
Load more

Recommended publications
  • Two New Species of the Genus Callimetopus Blanchard, 1853 (Coleoptera: Cerambycidae)
    Acta Biol. Univ. Daugavp. 15 (2) 2015 ISSN 1407 - 8953 TWO NEW SPECIES OF THE GENUS CALLIMETOPUS BLANCHARD, 1853 (COLEOPTERA: CERAMBYCIDAE) Arvīds Barševskis Barševskis A. 2015. Two new species of the genus Callimetopus Blanchard, 1853 (Coleoptera: Cerambycidae). Acta Biol. Univ. Daugavp., 15 (2): 411 – 417. Two new species of the genus Callimetopus Blanchard, 1853 (Coleoptera: Cerambycidae) are described and illustrated: C. danilevskyi sp. n. (Philippines, Luzon) and C. lazarevi sp. n. (Philippines, Mindanao). New faunistic data for C. ornatus Schultze, 1934 is given. The genus now inludes 36 described species, which are distributed in the Philippine archipelago, Moluccan archipelago, Indonesia and Malaysia. Key words: Coleoptera, Cerambycidae, Callimetopus, fauna, new species, taxonomy, Philippines Arvīds Barševskis. Daugavpils University, Institute of Life Sciences and Technology, Coleopterological Research Center, Vienības Str. 13, Daugavpils, LV-5401, Latvia; e-mail: [email protected] INTRODUCTION Adorada (2012) published determination key to the 19 species of the Philippine Callimetopus and Members of the genus Callimetopus Blanchard, described six new species from the Philippines: 1853 (Coleoptera: Cerambycidae, Lamiinae, C. acerdentibus dela Cruz & Adorada, 2012 and Pteropliini) are distributed in the Oriental region C. niveuseta dela Cruz & Adorada, 2012 from and represented by 34 species: 29 species are Luzon Island, C. stanleyi dela Cruz & Adorada, known from the Philippine archipelago, 3 species 2012 from Mindanao Island, C. mindorensis dela from the Moluccan archipelago and 2 species Cruz & Adorada, 2012 from Mindoro Island, from Malaysian and Indonesian islands. C. cretumus dela Cruz & Adorada, 2012 and C. pectoralis dela Cruz & Adorada, 2012 from the Breuning (1962) published key for 25 species Philippines without exact locality.
    [Show full text]
  • To the Knowledge of Long-Horned Beetles (Coleoptera: Cerambycidae) of the Oriental Region
    Acta Biol. Univ. Daugavp. 19 (2) 2019 ISSN 1407 - 8953 TO THE KNOWLEDGE OF LONG-HORNED BEETLES (COLEOPTERA: CERAMBYCIDAE) OF THE ORIENTAL REGION. PART 2. Arvīds Barševskis Barševskis A. 2019. To the knowledge of long-horned beetles (Coleoptera: Cerambycidae) of the Oriental Region. Part 2. Acta Biol. Univ. Daugavp., 19 (2): 287 – 295. New distributional records are presented for 85 little-known species of long-horned beetles (Coleoptera: Cerambycidae) of the Oriental Region. Findings of five species presents the first faunistic data after the original description: Callimetopus bumbierisi Barševskis, 2018, C. juliae Barševskis, 2016, C. miroshnikovi Barševskis, 2016, Pseudodoliops elegans apoensis Barševskis, 2019, Synixais willietorresi Barševskis, 2018. Three species are recorded for the first time from certain area: Anaestathes biplagiatus Gahan, 1901 from Vietnam, Tetraophthalmus dimidiatus (Gory, 1844) from Sumatra (Indonesia), and Grammoecus polygrammus Thomson, 1864 for Siberut (Indonesia). Key words: Fauna, distribution, Coleoptera, Cerambycidae, rare species. Arvīds Barševskis. Daugavpils University, Institute of Life Sciences and Technology, Coleopterological Research Center, Vienības Str. 13, Daugavpils, LV-5401, Latvia, E-mail: [email protected] INTRODUCTION of 11 species which were provided for the first time after their original descriptions. Additional The present study is the second part of a series of faunistic data about longhorned beetles of the articles, which providing the faunistic data about Oriental Region which are deposited in DUBC long-horned beetles (Coleoptera: Cerambycidae) were published recently by Barševskis (2019) of the Oriental Region. There is little published and Dunskis & Barševskis (2019). records for many species of this family, and often these data are only available from the original This article contains faunistic data for 85 species descriptions or some catalogues.
    [Show full text]
  • 2 the Insect-Pest Situation in Agroforestry
    Insect Pests in Agrof orestry Working Paper No. 70 report of a GTZ Fellowship M.P. Singh Rathore Senior Visiting Fellow INTERNATIONAL CENTRE FOR RESEARCH IN AGROFORESTRY Nairobi, Kenya Contents Acknowledgements iv Abstract v 1 Introduction 1 1.1 Sources of information 1 2 The insect-pest situation in agroforestry 3 2.1 Vegetational diversity 4 2.2 Taxonomic alliance 6 2.3 Non-taxonomic alliance 6 2.4 The host range of pests 8 2.5 Biological control potential 8 2.6 Microclimate 10 2.7 Masking effect 11 2.8 Barrier effects 12 2.9 Field configuration and design 12 2.10 Exotic plants and pests 13 2.11 Domestication of plants 15 2.12 Tree-crop competition and nutrition 15 2.13 Management practices 16 3 Strategies for pest management in agroforestry 17 3.1 Choice of species 17 3.2 Microclimate 17 3.3 Field configuration and design 17 3.4 Introduction of barriers .18 3.5 Odoriferous plants 18 3.6 Trap plants 18 3.7 Management practices 18 4 Insects associated with multipurpose trees and shrubs 19 4.1 Literature retrieval 19 4.2 Field observations 19 4.3 Primary sources of information used to compile lists of insects associated with multipurpose trees and shrubs 21 5 Directions for future research 22 6 Conclusion 26 References 27 Appendices 1 Insects associated with multipurpose trees and shrubs—compilation from the literature 35 2 Insects associated with multipurpose trees and shrubs—summary of field observations 67 Acknowledgements The investigations reported in this document were fully funded by the Deutsche Gesellschaft fur Technische Zusammenarbeit (GTZ, German Agency for Technical Cooperation) through sponsorship of a Senior Visiting Fellowship, for which the author is grateful.
    [Show full text]
  • Bntomojauna ZEITSCHRIFT FÜR ENTOMOLOGIE
    © Entomofauna Ansfelden/Austria; download unter www.biologiezentrum.at Bntomojauna ZEITSCHRIFT FÜR ENTOMOLOGIE Band 11, Heft 18 ISSN 0250-4413 Ansfelden, 10.September 1990 Über Cerambyciden aus Südost-Asien VIII (Coleoptera, Cerambycidae und Disteniidae) Karl-Ernst Hüdepohl Abstract s Megopis suturalis FISHER,19355i tranferred from sub- genus Aegosoma SERVILLE, 1832, to subgenus Aegolipton GRESSITT,1940; the male is described. Relations between genera Peribasis THOMSON,1864, Pericycos BREUNING, 1944, and Hotarionomus THOMSON, 1857, are discussed; Pericycos guttatus (HELLER,1898) is transferred to Peribasis THOM- SON, 1864• 8 taxa are described as new in subfamily Lami- inae: Doliops gertrudis sp. nov. (Apomecynini); Callime- topus longior sp.nov., Abryna (Faustabryna) lumawigi sp. nov., Latabryna gen.nov. arnaudi sp.nov. (all in Ptero- pliini); Anerpa steinkeae sp.nov. (Morimopsini); Pericy- cos sulawensis sp.nov. (Agniini); Glenea (s.str.) apice- purpurata sp.nov. and Glenea (Punctoglenea) francisi sp. nov. (Saperdini). 1 taxon is described as new in family Disteniidae: Cyrtonops metallicus sp.nov. Zusammenfassung Megopis suturalis FISHER,1935, wird von Subgenus Aego- 285 © Entomofauna Ansfelden/Austria; download unter www.biologiezentrum.at soma SERVILLE,l832, zu Subgenus AegoHpton GRESSITT, 1940, gestellt; das 6 wird beschrieben. Beziehungen zwischen den Genera Peribasis THOMSON, 1864, Pericycos BREUNING, 1944, und Hotarionomus THOMSON, 1857, werden erörtert; Pericycos guttatus (HELLER,1898) wird zu Peribasis THOM- SON, 1864, gestellt. In der Subfailie Lamiinae werden 8 Arten neu beschrieben: Doliops gertrudis sp.nov. (Apome- cynini); Callimetopus longior sp. nov., Abryna (Faust - abryna) lumawigi sp .nov., Latdbryna gen. nov. tumawigi sp. nov. (alle in Pteropliini); Anerpa steinkeae sp.nov.(Mo- rimopsini); Pericycos sulawensis sp.nov. (Agniini); Gle- nea (s.str.) apicepurpurata sp.nov.
    [Show full text]
  • Two New Species of the Genus Callimetopus Blanchard, 1911 (Coleoptera: Cerambycidae) from Palawan and Marinduque Islands (Philippines)
    Baltic J. Coleopterol. 18(2) 2018 ISSN 1407 - 8619 Two new species of the genus Callimetopus Blanchard, 1911 (Coleoptera: Cerambycidae) from Palawan and Marinduque islands (Philippines) Arvīds Barševskis Barševskis A. 2018. Two new species of the genus Callimetopus Blanchard, 1853 (Coleoptera: Cerambycidae) from Palawan and Marinduque islands (Philippines). Baltic J. Coleopterol., 18(2): 291 – 296. Two new species of long-horned beetles of the genus Callimetopus Blanchard, 1853 from the Philippines are described and illustrated: C. bumbierisi sp. n. (Palawan) and C. marinduquensis sp. n. (Marinduque). The genus Callimetopus is now represented by 49 species. Key words: taxonomy, new species, long-horned beetles, Callimetopus, Lamiinae, Pteropliini, Philippines Arvīds Barševskis. Daugavpils University, Institute of Life Sciences and Technology, Coleopterological Research Center, Vienības Str. 13, Daugavpils, LV-5401, Latvia; email: [email protected] INTRODUCTION The genus Callimetopus distributed in the Ori- ental region and represented by 49 species: 44 The genus Callimetopus belongs to the sub- species are known from the Philippine archi- family Lamiinae and tribe Pteropliini. It is one of pelago, two species - from the Moluccan archi- the more complicated tribe of Cerambycidae. pelago, one species from the Moluccan archi- Many genera of Pteropliini are still poorly stud- pelago and peninsular Malaysia, one species ied and they need taxonomic revisions. In recent from Borneo and one species from Sulawesi and years, Callimetopus has been intensively stud- peninsular Malaysia. ied. Many new species has been described by several authors: Vives (2012, 2015, 2017), dela During the study of the material on the genus Cruz & Adorada (2012) and Barševskis (2015a, Callimetopus Blanchard, 1853 (Coleoptera: 2015b, 2015c, 2016a, 2016b, 2018a).
    [Show full text]
  • Borneo Cerambycidae
    Catalog and Bibliography of Longhorned Beetles from Borneo (Coleoptera: Cerambycidae) Daniel J. Heffern - Electronic Version, 2005.1 Abstract The genus-group and species-group names for Cerambycidae occuring in Borneo are summarized. All genus-group names, including synonyms and subgenera, are given with their type species. All species-group names and synonyms, specify their original genus. For each species and subspecies from Borneo, their extralimital distributions are included, if applicable. Citations are presented for each name. References for identification keys and illustrations are cited, if available. Complete bibliographies for all cited references are given. There are no proposed changes to nomenclature. Comments about biogeography and taxonomic problems are given. Species that are excluded from the Bornean fauna are listed. An index is included for all genus-group names. Table of Contents Introduction . 2 Biogeographical Relationships . 2 Taxonomy and Literature Discussion . 3 Acknowledgements . 5 List of Subfamilies and Tribes from Borneo . 6 List of Genera and Species from Borneo . 8 Excluded Records . .. 68 Important Nomenclatural Definitions . .. 68 Catalog Notes . .. 69 Bibliography . .. 72 Bibliographical Comments . .. 95 Index of Generic Level Names . .. 97 Checklist and Bibliography of Longhorned Beetles from Borneo Introduction This catalog and bibliography covers the original nomenclature for the longhorned beetles of Borneo. Longhorned beetles include the family Cerambycidae, although some taxonomists treat certain subfamilies as families. In this catalog, the work of Lawrence and Newton (1995) is followed which recognizes thirteen subfamilies in the world: Oxypeltinae, Disteniinae, Philinae, Anoplodermatinae, Parandrinae, Prioninae, Spondylidinae, Vesperinae, Apatophyseinae, Necydalinae, Lepturinae, Cerambycinae and Lamiinae. There has been, and certainly will always be disagreement on the number and relationships of these subfamilies.
    [Show full text]
  • Distribution and Feeding Hosts of Mango Twig Borers in Mango Growing Provinces in Luzon, Philippines
    J. Basic. Appl. Sci. Res. , 7(10)32-38, 2017 ISSN 2090-4304 Journal of Basic and Applied © 2017, TextRoad Publication Scientific Research www.textroad.com Distribution and Feeding Hosts of Mango Twig Borers in Mango Growing Provinces in Luzon, Philippines Leticia Adoro, Florida Dmingo and Elizabeth N. Farin Research, Extension and Training Ramon Magsaysay Technological University, Iba, Zambales, Philippines Received: July 3, 2017 Accepted: September 11, 2017 ABSTRACT The study was conducted to determine the distribution and occurrence of mango twig borers and also identified their feeding hosts. Results indicate that mango twig borers were found in many mango trees in almost all Luzon provinces such as Zambales, Tarlac, Nueva Ecija, Pampanga, Bulacan, Bataan, Ilocos Sur, Ilocos Norte, Pangasinan, Nueva Vizcaya, Batangas and Laguna, except in Isabela, Cagayan, and Camarines Sur. Occurrence of mango twig borers ranged from 20% to 100%. Callimetopus albata species was found only in Laguna, Rizal and Quezon. The two species were not only damaging mango trees but other plants.Twenty nine plant species were identified as alternate feeding hosts of C. capito. Twenty nine feeding hosts of C capito were identified in the different mango growing areas in Luzon. Most were trees found in Zambales (14) followed by Pangasinan (7), Nueva Viscaya (12) and Laguna (2). Only one was identified from Abra. KEYWORDS : Occurrence, Distribution, Mango twig borers, Luzon, Philippines INTRODUCTION The Philippines is one of the top producers of mango with “Carabao” as its most important cultivar (PCARRD, 2006). The “Manila Super Mango” is one of the dollar earner commodities in the Philippines, however, a declining trend in the production of mango has been observed in the past few years due to damage caused by insect pests and diseases.
    [Show full text]
  • Entomologische Arbeiten Aus Dem Museum G. Frey
    download Biodiversity Heritage Library, http://www.biodiversitylibrary.org/ Ent. Arb. Mus. Frey 13, 1962 371 Bestimmungstabelle der Lamiiden-Triben nebst Revision der Pteropliini der asiatischen Region (Col. Cerambycidae) Von S. Breuning, Paris I. Teil Pteropliini Thoms. Pteropliini Thomson, 1860, Ess. Class. Cer. 43, 73. 5 pp. Niphonini Pascoe, 1864, Trans, ent. Soc. Lond., (3) III, pp. 7, 56. Niphonini + Atossini + Pteropliini Lacordaire, 1872, Gen. Col., IX, pp. 414, 496, 519, 595. Metagnomini Aurivillius, 1924, Ark. f. Zool., XVII, A/12, p. 13. Niphonini Gressitt, 1939, Lingn. Sc. Journ., XVIII, p. 49; 1951, Longic., II, pp. 326, 452. Das erste Fühlerglied ohne Narbe (sehr selten mit einer offenen, nicht vortretenden Narbe), niemals sehr lang und schmal (wenn dann mit seit- licher Längskante). Mittelhüfthöhlen offen. Metasternum meist von normaler Länge, selten kurz. Mittelschienen ohne Dorsalfurche und ohne mittleren Dorsalhöcker. Klauen divergent (Tafel, Fig. 11). Typ: Pteroplius Serv. Die Pteropliini gehören zu den Tribussen mit divergenten Klauen (Fig. 10), welche untereinander durch folgende Merkmale getrennt werden können: 1. Metasternum merklich verkürzt (Fig. 1) 2. - Metasternum nicht merklich verkürzt (Fig. 2) 7. 2. Mittelschienen mit Dorsalfurche 3. - Mittelschienen ohne Dorsalfurche (Fig. 3) 4. 3. Mittelschienen mit leichter Dorsalfurche (Fig. 4), das dritte Füh- lerglied höchstens ein wenig länger als das vierte, die Mittelhüft- höhlen stets offen Dorcadionini Thoms. - Mittelschienen preapikal stark ausgeschnitten (Fig. 5) oder das dritte Fühlerglied viel länger als das vierte oder die Mittelhüft- höhlen geschlossen Apomecynini Lac. part. 4. Mittelhüfthöhlen geschlossen (Fig. 7) Gyaritini Breun, part. - Mittelhüfthöhlen offen (Fig. 6) 5. 5. Halsschild mit hohen Scheibenhöckern oder großer Mittelbeule Phantasini Hunt & Breun.
    [Show full text]
  • A Catalogue of the Genus Callimetopus Blanchard, 1853
    +XPDQLW\VSDFHInternational almanac92/1R $FDWDORJXHRIWKHJHQXVCallimetopus%ODQFKDUG &ROHRSWHUD&HUDPE\FLGDH RIWKHZRUOGIDXQD $%DUãHYVNLV 'DXJDYSLOV8QLYHUVLW\ ,QVWLWXWHRI/LIH6FLHQFHVDQG7HFKQRORJ\ &ROHRSWHURORJLFDO5HVHDUFK&HQWHU 9LHQƯEDVVWU'DXJDYSLOV/9/DWYLD HPDLODUYLGVEDUVHYVNLV#GXOY .H\ZRUGV&ROHRSWHUD&HUDPE\FLGDHCallimetopusIDXQDFDWDORJXHWD[RQRP\ 2ULHQWDOUHJLRQ $EVWUDFW 7KH FDWDORJXH RI WKH JHQXV Callimetopus %ODQFKDUG &ROHRSWHUD &HUDPE\FLGDH RI WKH ZRUOG IDXQD ZKLFK EDVHG RQ WKH OLWHUDWXUH GDWD DQG PRVW LPSRUWDQW RQOLQH GDWDEDVHV LV SURYLGHG ,W FRQWDLQV GDWD RQ VSHFLHV ZKLFK DUH GLVWULEXWHGLQWKH3KLOLSSLQHV,QGRQHVLDDQG0DOD\VLD(DFKVSHFLHVLVUHSUHVHQWHG E\V\QRQ\PVOLWHUDWXUHPRVWVLJQLILFDQGGDWDEDVHVDQGGDWDRQWKHGLVWULEXWLRQDQG GHSRVLWRULHVRIWKHW\SHPDWHULDO ,1752'8&7,21 7KH JHQXV Callimetopus %ODQFKDUG &ROHRSWHUD &HUDPE\FLGDH EHORQJV WR WKH WULEH 3WHURSOLLQL RI WKH VXEIDPLO\ /DPLLQDH 0HPEHUV RI WKLV JHQXV DUH GLVWULEXWHG LQ WKH 2ULHQWDO UHJLRQ DQG UHSUHVHQWHG E\ IRUW\ RQH VSHFLHV 7KLUW\ VL[ VSHFLHVDUH NQRZQ IURP WKH 3KLOLSSLQHV VL[ IURP ,QGRQHVLD DQG WZR IURP 0DOD\VLD )RU WKH 3KLOLSSLQH DUFKLSHODJR WKH ODUJHVW QXPEHU RI VSHFLHV DUH NQRZQ IURP /X]RQ ,VODQG WZHQW\ VSHFLHV DQG IURP 0LQGDQDR ,VODQG QLQH VSHFLHV IRXU VSHFLHV DUH NQRZQ IRU 3DQD\ ,VODQG WKUHH VSHFLHV IRU 6DPDU ,VODQG WZR VSHFLHV RQ HDFK IRU /H\WH 1HJURV DQG 6LEX\DQ LVODQGV DQG RQH VSHFLHV RQ HDFK IRU %DVLODQ 'LQDJDW 0LQGRUR 3DODZDQ DQG 6LDUJDR LVODQGV 7ZR VSHFLHV IURP WKH 3KLOLSSLQHV KDYH EHHQ GHVFULEHG ZLWKRXW H[DFW LQGLFDWLRQRIWKHW\SHORFDOLW\,Q,QGRQHVLDWKUHHVSHFLHVRIWKHJHQXV DUH NQRZQ IURP 0ROXFFDV DUFKLSHODJR WZR VSHFLHV IURP 6XODZHVL &HOHEHV ,VODQGDQGRQHVSHFLHVIURP6XPDWUDDQG%RUQHR,VODQGV UHVSHFWLYHO\ 7ZR VSHFLHV DUH NQRZQ IURP SHQLQVXODU SDUW RI 0DOD\VLD 7KH GLVWULEXWLRQ RI VHYHUDO VSHFLHV LV VWLOO LQVXIILFLHQWO\ LQYHVWLJDWHG DQG SHUKDSV WKH\ DUH PRUH ZLGHO\ GLVWULEXWHG LQ WKH $%DUãHYVNLV 2ULHQWDOUHJLRQ %UHXQLQJ SXEOLVKHG NH\ IRU VSHFLHV RI WKH JHQXV Callimetopus 7KH NH\ LQFOXGHG C. principalis +HOOHU C.
    [Show full text]
  • Two New Species of the Genus Callimetopus Blanchard, 1853 (Coleoptera: Cerambycidae) from Luzon Island Arvīds Barševskis INTRO
    Humanity space International almanac VOL. 4, No 5, 2015: 1027-1033 Two new species of the genus Callimetopus Blanchard, 1853 (Coleoptera: Cerambycidae) from Luzon Island Arvīds Barševskis Daugavpils University Institute of Life Sciences and Technology Coleopterological Research Center Vienības str. 13, Daugavpils LV-5401 Latvia e-mail: [email protected] Key words: Coleoptera, Cerambycidae, Callimetopus, fauna, new species, taxonomy, Philippines. Abstract: Two new species of the genus Callimetopus Blanchard, 1853 (Coleoptera: Cerambycidae) from Luzon Island (The Philippines) are described and illustrated: C. anichtchenkoi sp. n. and C. shavrini sp. n. The genus now includes 38 described species. INTRODUCTION The genus Callimetopus Blanchard, 1853 (Coleoptera: Cerambycidae) is a long-horned beetle not well studied genus, which belongs to the species rich subfamily Lamiinae and tribe Pteropliini. Last revision, which includes 25 species of this genus and the key, was published by Breuning (1962). The key in Breuning (1962) included four species (C. principalis Heller, 1924, C. superbus Breuning, 1947, C. pulchellus Schultze, 1922 and C. gloriosus Schultze, 1922), which later were transferred by Vives (2005) to the genus Acronia Westwood, 1863. In next years after Breuning (1962) 15 taxa of Callimetopus were described: C. paracasta Breuning, 1965, C. mindanaoensis Breuning, 1980, C. siargoanus mindanaonis Breuning, 1980, C. vivesi Breuning, 1981, C. longior Hüdepohl, 1990, C. samarensis Vives, 2012, C. acerdentibus dela Cruz & Adorada, 2012, C. niveuseta dela Cruz & Adorada, 2012, C. stanleyi dela Cruz & Adorada, 2012, C. mindorensis dela Cruz & Adorada, 2012, C. cretumus dela Cruz & Adorada, 2012, C. pectoralis dela Cruz & Adorada, 2012, C. bilineatus Vives, 2015, C. danilevskyi Barševskis, 2015, C.
    [Show full text]
  • Barševskis A. to the Knowledge of the Genus Callimetopus Blanchard, 1853
    Acta Biol. Univ. Daugavp. 18 (1) 2018 ISSN 1407 - 8953 TO THE KNOWLEDGE OF THE GENUS CALLIMETOPUS BLANCHARD, 1853 (COLEOPTERA: CERAMBYCIDAE) Arvīds Barševskis Barševskis A. 2018. To the knowledge of the genus Callimetopus Blanchard, 1853 (Coleoptera: Cerambycidae). Acta Biol. Univ. Daugavp., 18 (1): 95 – 104. The article contains records of 24 species of the genus Callimetopus Blanchard, 1853 (Coleoptera: Cerambycidae) of the Oriental Region. New records of eleven species are provided for the first time after their descriptions. In the world fauna Callimetopus represented by 47 species. Key words: taxonomy, new species, fauna, Coleoptera, Fhilippines, biodiversity. Arvīds Barševskis. Daugavpils University, Institute of Life Sciences and Technology, Coleopterological Research Center, Vienības Str. 13, Daugavpils, LV-5401, Latvia, Email: [email protected]. INTRODUCTION The Philippines is one of the most biodiverse countries in the world with a very high level of In recent years the genus Callimetopus Blanchard, endemism. The biodiversity of the Philippines 1853 (Coleoptera: Cerambycidae) has been is intensively studied in last years. Every year intensively studied. New species are discovered many new species of beetles have been described and described almost every year, as evidenced from the Philippines, including longhorned by many publications published by Dela Cruz beetles. During last year and current year, several & Adorada (2012), Vives (2012, 2015, 2017) authors have published articles with descriptions and Barševskis (2015a, 2015b, 2015c, 2016b, of new species: Anichtchenko (2016, 2017), 2016c, 2018). Barševskis (2016a) published „A Anichtchenko & Cabras (2018), Barševskis Catalogue of the genus Callimetopus Blanchard, (2017a, 2017b, 2018a, 2018b, 2018c), Bulirsh 1845 (Coleoptera: Cerambycidae) of the world & Anichtchenko (2018), Löbl (2018), Cabras & fauna”, which based on literature and most Barševskis (2016), Vitali (2017), Hava (2018), important data, and contains information aboaut Kuleshov (2017), Legalov (2018), Bollino & 41 species.
    [Show full text]
  • Bestimmungstabelle Der Lamiiden-Triben Nebst Revision Der Pteropliini Der Asiatischen Region (Col
    Ent. Arb. Mus. Frey 13, 1962 371 Bestimmungstabelle der Lamiiden-Triben nebst Revision der Pteropliini der asiatischen Region (Col. Cerambycidae) Von S. Breuning, Paris I. Teil Pteropliini Thoms. Pteropliini Thomson, 1860, Ess. Class. Cer. 43, 73. 5 pp. Niphonini Pascoe, 1864, Trans, ent. Soc. Lond., (3) III, pp. 7, 56. Niphonini + Atossini + Pteropliini Lacordaire, 1872, Gen. Col., IX, pp. 414, 496, 519, 595. Metagnomini Aurivillius, 1924, Ark. f. Zool., XVII, A/12, p. 13. Niphonini Gressitt, 1939, Lingn. Sc. Journ., XVIII, p. 49; 1951, Longic., II, pp. 326, 452. Das erste Fühlerglied ohne Narbe (sehr selten mit einer offenen, nicht vortretenden Narbe), niemals sehr lang und schmal (wenn dann mit seit- licher Längskante). Mittelhüfthöhlen offen. Metasternum meist von normaler Länge, selten kurz. Mittelschienen ohne Dorsalfurche und ohne mittleren Dorsalhöcker. Klauen divergent (Tafel, Fig. 11). Typ: Pteroplius Serv. Die Pteropliini gehören zu den Tribussen mit divergenten Klauen (Fig. 10), welche untereinander durch folgende Merkmale getrennt werden können: 1. Metasternum merklich verkürzt (Fig. 1) 2. - Metasternum nicht merklich verkürzt (Fig. 2) 7. 2. Mittelschienen mit Dorsalfurche 3. - Mittelschienen ohne Dorsalfurche (Fig. 3) 4. 3. Mittelschienen mit leichter Dorsalfurche (Fig. 4), das dritte Füh- lerglied höchstens ein wenig länger als das vierte, die Mittelhüft- höhlen stets offen Dorcadionini Thoms. - Mittelschienen preapikal stark ausgeschnitten (Fig. 5) oder das dritte Fühlerglied viel länger als das vierte oder die Mittelhüft- höhlen geschlossen Apomecynini Lac. part. 4. Mittelhüfthöhlen geschlossen (Fig. 7) Gyaritini Breun, part. - Mittelhüfthöhlen offen (Fig. 6) 5. 5. Halsschild mit hohen Scheibenhöckern oder großer Mittelbeule Phantasini Hunt & Breun. - Halsschild ohne derartige Höcker oder Beule 6.
    [Show full text]