DOCSLIB.ORG

Puype's Dream

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Puype's Dream equineline.com Pedigree 03/21/13 13:30:24 EDT Puype's Dream Dark Bay or Brown Mare; Mar 23, 1996 Hail to Reason, 58 br Roberto, 69 b Bramalea, 59 dk b/ Kris S., 77 dk b/ *Princequillo, 40 b Puype's Dream Sharp Queen, 65 b Bridgework, 55 br Foaled in Kentucky Mr. Prospector, 70 b Fappiano, 77 b Another Moment, 89 b Killaloe, 70 b For The Moment, 74 ch Moment's Prayer, 79 ch Prayer Cap, 62 b By KRIS S. (1977). Stakes winner of $53,350, Bradbury S. Among the leading sires twice, sire of 21 crops of racing age, 863 foals, 748 starters, 88 stakes winners, 4 champions, 572 winners of 2057 races and earning $77,735,278 USA, including Symboli Kris S (TF 132, Horse of the year twice in Japan, $8,401,282 USA, Arima Kinen-Grand Prix twice, etc.), Hollywood Wildcat ( 119, Champion in U.S., $1,432,160, Breeders' Cup Distaff [G1], etc.). Among the leading broodmare sires in U.S., sire of dams of 92 stakes winners, including champions Zenyatta, Sweet Catomine, Caprivi, Tato Zeta, Kristin's Place, Killer Queen, and of Eishin Dover, Ladies Din, Life Is Sweet, Marketing Mix, Student Council, War Chant, Balance, Senor Swinger, Romacaca. 1st dam Another Moment, by Fappiano. 100. 4 wins at 3 and 4, $89,678, 3rd Skipat H. (RKM, $2,900). Dam of 7 foals, 5 to race, 3 winners-- FTI DEC MIX 05, $2,000, Buyer: Shenandoah Equine (in foal to Parker's Storm Cat) KEE NOV BRDG 04, $11,000, Buyer: Beth Ann Brown-Gambone (in foal to Salt Lake) KEE NOV BRDG 98, $150,000, Buyer: Russell S. Davis (in foal to Victory Speech) KEE NOV BRDG 95, $135,000, Buyer: Rollin W. Baugh, agent (in foal to Kris S.) KEE JUL YRLG 90, $185,000, Buyer: Robert E. Masterson Summer Moment (f. by Summer Squall). 82. 7 wins, 3 to 5, $82,384. Dam of-- FTK ADENA 07, $30,000, Buyer: Charles Carlton (in foal to Giacomo) KEE SEP YRLG 02, $35,000, Buyer: Dogwood Stable Tina Lena Too (f. by Giacomo). 86. 2 wins at 3, placed at 5, 2013, $79,902, 3rd Hallowed Dreams S. (EVD, $5,500). Our Moment (c. by Dehere). 88. 6 wins, 3 to 7, $83,346. FTF FEB SEL 2YO TRN 02, $12,000, Buyer: Carlos J. Morales KEE SEP YRLG 01, $70,000, Buyer: Whitehorse Stable Salty Alex (c. by Salt Lake). 78. Winner at 4, $18,830. FTI SUM 2YO HRA 07, $9,000, Buyer: Half & Half Stable FTI DEC MIX 05, $15,000, Buyer: Edward Turlington Puype's Dream (f. by Kris S.). 56. See below. KEE JAN ALL AGES 06, $20,000, Buyer: Joseph Alexander (in foal to Out of Place) 2nd dam MOMENT'S PRAYER, by For The Moment. 3 wins at 3 and 4, $39,564. Half-sister to PRAYER LEADER ($104,673, Eyes of Texas Futurity, etc.), ZONIC ($65,983, Albuquerque S., etc., sire), SILENT PRAYER (Rio Grande Kindergarten Futurity). Dam of 7 winners-- MIAMI SLICK (c. by Baldski). 7 wins, 2 to 4, $224,480, Broward H. [L] (CRC, $49,890), Hallandale H. [L] (GP, $34,200), Plantation H. [L] (CRC, $32,790), Florida Stallion/Dr. Fager S. [LR] (CRC, $30,000), 2nd Super Bowl H. [L] (GP, $12,520), Tamarac H. [L] (CRC, $10,860), Biscayne Bay S. (HIA, $4,440), 3rd A Phenomenon S. [L] (SAR, $10,530), etc. Sire. OBS SEL FLB 2YO CAL 87, $24,000, Buyer: Marion Plesa OBS SEL YRLG 86, $26,000, Buyer: Camelot Acres CIELO OTONO (f. by Conquistador Cielo). 93. 3 wins in 6 starts at 2, $75,106, Debutante Breeders' Cup S. [L] (BM, $36,550), Mt. Rainier S. (YM, $17,201), 2nd Burlingame S. (BM, $7,000), 3rd Joan Alhadeff Lassies S. (YM, $8,505). Dam of-- KEE SEP YRLG 94, $49,000, Buyer: Halvorson Bloodstock Cielo Dulce (f. by Cahill Road). 102. 3 wins at 5, $80,335. Dam of-- SWEET SAGA (f. by Slew's Saga). 89. Winner at 2, placed at 3, 2012, $43,294, Barbara Shinpoch S. (EMD, $24,750). Sweetest Smile (f. by Dehere). 80. Winner at 3, $13,370. Dam of-- KEE JAN ALL AGES 12, $85,000, Buyer: Twin Hopes Farm (in foal to Curlin) Copyright © 2013 The Jockey Club Information Systems, Inc. Page 1 of 4 equineline.com Pedigree 03/21/13 13:30:24 EDT Puype's Dream Dark Bay or Brown Mare; Mar 23, 1996 KEE JAN ALL AGES 06, $200,000, Buyer: W.S. Farrish (in foal to Bernstein) KEE APR 2YO KY 00, $95,000 (RNA) KEE SEP YRLG 99, $80,000, Buyer: Janet Hinebaugh GRAYDAR (c. by Unbridled's Song). 120. 3 wins in 4 starts at 3 and 4, 2013, $361,560, Donn H. [G1] (GP, $300,000). FTF FEB SEL 2YO TRN 11, $260,000, Buyer: Randy Gullatt KEE SEP YRLG 10, $85,000 (RNA) Union Course (g. by Dixie Union). 97. 3 wins, 2 to 4, $124,314, 2nd Flash S. [G3] (BEL, $21,420), 3rd Saratoga Special S. [G2] (SAR, $15,000). FTF FEB SEL 2YO TRN 05, $140,000 (RNA) KEE SEP YRLG 04, $100,000, Buyer: Sabine Stable Star of David (c. by Bernstein). 101. 3 wins, 2 to 5, $107,377(USA), 3rd Summer S. [G3] (WO, $33,000(CAN)), Iroquois S. [G3] (CD, $10,776). KEE SEP YRLG 07, $220,000, Buyer: Zayat Stables Another Moment (f. by Fappiano). 100. Black type placed winner, see above. Bubbles Darlene (f. by Fappiano). 2 wins at 3, $13,487. Dam of-- KEE NOV BRDG 94, $175,000, Buyer: Russell S. Davis (in foal to Storm Cat) KEE JAN ALL AGES 91, $21,000, Buyer: Michael D. Riordan (in foal to Storm Cat) FTN YRLG SAR 87, $160,000, Buyer: HUGHES, B. G., AGENT ELRAFA AH (f. by Storm Cat). TF 105. 3 wins at 2 and 3 in ENG, $82,936 (USA), Bedford Lodge Hotel Bentinck S., Wharf Dragon S., 2nd Van Geest Criterion S. [G3], Oak Tree S., Bonusphoto Victress S., etc. Dam of-- FTN YRLG SAR 92, $110,000, Buyer: Shadwell Estate Co. KEE NOV BRDG 91, $35,000 (RNA) MUJAHID (c. by Danzig). TF 125p. 3 wins at 2 in ENG, $317,177 (USA), Hwt. colt at 2 on European Free Hand., Hwt. colt at 2 on English Free Hand., Saudi Arabian Airlines Dewhurst S. [G1], 2nd James Seymour S., 3rd Sagitta Two Thousand Guineas [G1], Weatherbys Earl of Sefton S. [G3]. Sire. Hazimah (f. by Gone West). TF 74. Placed at 2 and 3 in ENG, $3,714 (USA). Dam of-- KEE NOV BRDG 10, $1,200, Buyer: Angel Contreras (in foal to Daaher) ELGHAYOOR (f. by Ghostzapper). 98. 2 wins in 4 starts at 3, 2013, $129,800, Cicada S. [L] (AQU, $60,000), Dearly Precious S. (AQU, $45,000). Really Darlene (f. by Sky Mesa). Unraced. Dam of-- DEA DEC MIX 09, $44,538, Buyer: Ozygit Ozba (in foal to Astronomer Royal) KEE SEP YRLG 06, $110,000, Buyer: Ken Condon =Madiba (TUR) (c. by Astronomer Royal). 2 wins at 2, 2012 in TUR, $15,602 (USA), 3rd Queen Elizabeth II International Cup. Girchoop (f. by Storm Cat). Unraced. Dam of-- KEE JAN ALL AGES 04, $85,000, Buyer: Michael I. Yovankin, agent (in foal to Rahy) KEE NOV BRDG 03, $65,000, Buyer: Clark O. Brewster (in foal to Rahy) KEE NOV BRDG 02, $95,000 (RNA) KEE JAN ALL AGES 02, $75,000, Buyer: Montgomery, Walden, and Walden (in foal to Elnadim) KEE SEP YRLG 96, $240,000, Buyer: Shadwell Estate Co. Adhaaba (f. by Dayjur). TF 76p. Unplaced in 1 start in ENG. Dam of-- TAT DEC 07, $40,188, Buyer: Serdal Adali TADEM 2003, $5,776, Buyer: Grovewood Stud =El Conquerador (TUR) (c. by Okawango). Winner at 2, 2012 in TUR, $62,306 (USA), 2nd Tay Deneme, TYAY ve S. DER. Epee (g. by Sword Dance (IRE)). 95. 9 wins, 2 to 8, $123,704. OBS SEL 2YO CAL 00, $95,000 (RNA) Dacra (c. by Dixieland Band). 94. 2 wins at 3, $41,500. KEE SEP YRLG 95, $90,000 (RNA) Tortugas Queen (f. by Cox's Ridge). 93. 3 wins, 2 to 4, $30,102. KEE SEP YRLG 91, $60,000, Buyer: G.D. Ranch Sky Moment (f. by Conquistador Cielo). 69. Placed at 2, $10,450. KEE SEP YRLG 96, $57,000, Buyer: Glen C. Warren Copyright © 2013 The Jockey Club Information Systems, Inc. Page 2 of 4 equineline.com Pedigree 03/21/13 13:30:24 EDT Puype's Dream Dark Bay or Brown Mare; Mar 23, 1996 Flambeau (f. by Dixieland Band). Unraced. Dam of-- OBS WNT MIX 07, $10,000 (RNA) KEE NOV BRDG 03, $20,000, Buyer: Questroyal Stable (in foal to Stormy Atlantic) OBS FALL MIX 02, $14,000, Buyer: Amy Bondon-Peltz (in foal to Line In The Sand) OBS WNT MIX 96, $20,000 (RNA) KEE SEP YRLG 93, $47,000 (RNA) Fortuesque (f. by Fortunate Prospect). 85. 5 wins at 2 and 3, $116,915, 3rd Florida Stallion Susan's Girl S. -R (CRC, $13,750). Dam of-- KEE JAN ALL AGES 08, $23,000, Buyer: Hidden Lake Farm (in foal to Forest Danger) KEE NOV BRDG 01, $34,000, Buyer: Jim E. Nelson (in foal to Yankee Victor) KEE NOV BRDG 00, $95,000, Buyer: Doug Cauthen, agent (in foal to Cozzene) MUSKET MAN (c. by Yonaguska). 119. 6 wins, 2 to 4, $1,236,820, Illinois Derby [G2] (HAW, $285,000), Tampa Bay Derby [G3] (TAM, $180,000), Pasco S.
Load more

Recommended publications
  • 138904 02 Classic.Pdf
    breeders’ cup CLASSIC BREEDERs’ Cup CLASSIC (GR. I) 30th Running Santa Anita Park $5,000,000 Guaranteed FOR THREE-YEAR-OLDS & UPWARD ONE MILE AND ONE-QUARTER Northern Hemisphere Three-Year-Olds, 122 lbs.; Older, 126 lbs.; Southern Hemisphere Three-Year-Olds, 117 lbs.; Older, 126 lbs. All Fillies and Mares allowed 3 lbs. Guaranteed $5 million purse including travel awards, of which 55% of all monies to the owner of the winner, 18% to second, 10% to third, 6% to fourth and 3% to fifth; plus travel awards to starters not based in California. The maximum number of starters for the Breeders’ Cup Classic will be limited to fourteen (14). If more than fourteen (14) horses pre-enter, selection will be determined by a combination of Breeders’ Cup Challenge winners, Graded Stakes Dirt points and the Breeders’ Cup Racing Secretaries and Directors panel. Please refer to the 2013 Breeders’ Cup World Championships Horsemen’s Information Guide (available upon request) for more information. Nominated Horses Breeders’ Cup Racing Office Pre-Entry Fee: 1% of purse Santa Anita Park Entry Fee: 1% of purse 285 W. Huntington Dr. Arcadia, CA 91007 Phone: (859) 514-9422 To Be Run Saturday, November 2, 2013 Fax: (859) 514-9432 Pre-Entries Close Monday, October 21, 2013 E-mail: [email protected] Pre-entries for the Breeders' Cup Classic (G1) Horse Owner Trainer Declaration of War Mrs. John Magnier, Michael Tabor, Derrick Smith & Joseph Allen Aidan P. O'Brien B.c.4 War Front - Tempo West by Rahy - Bred in Kentucky by Joseph Allen Flat Out Preston Stables, LLC William I.
    [Show full text]
  • INTERNATIONAL STATISTICS and TECHNICAL INFORMATION INTERNATIONAL STUD BOOK COMMITTEE LIST of APPROVED STUD BOOKS (65)
    INTERNATIONAL STATISTICS and TECHNICAL INFORMATION INTERNATIONAL STUD BOOK COMMITTEE LIST OF APPROVED STUD BOOKS (65) Argentina Kenya Australia Kingdom of Saudi Arabia Austria Korea Azerbaijan Malaysia Bahrain Mexico Barbados Morocco Belgium and Luxembourg Netherlands Brazil New Zealand Bulgaria Norway Chile Panama China Paraguay Colombia Peru Philippines Costa Rica Poland Croatia Portugal Cyprus Qatar Czech Republic Romania Denmark Russia (new Volume1) Dominican Republic Serbia Ecuador Slovak Republic Finland Slovenia France South Africa Germany Spain Great Britain and Ireland Sweden (A-Register) Greece Switzerland Guatemala Thailand Hungary Trinidad and Tobago India Tunisia Israel Turkey Italy United Arab Emirates Jamaica U.S.A, Canada and Puerto Rico Japan Uruguay Kazakhstan Venezuela 5-1 2007 STATISTICAL INFORMATION No. of Black-type 2007 No. of No. of No. of Graded races (incl. Country Part foals starters flat races races graded) Argentina I 7,538 11,123 6,101 155 218 Australia I 18,255 31,419 19,382 259 538 Austria III 50 303 98 NA NA Brazil I 3,079 6,114 4,472 103 173 Canada I 2,632 7,482 5,057 37 227 Chile I 1,870 4,009 4,949 63 95 Colombia III 142 323 490 NA NA Czech Republic III 312 1,621 348 NA NA Dominican Republic III 67 n/a 945 NA NA Ecuador III 55 182 281 NA NA France I 5,384 8,726 4,156 107 234 Germany I 1,224 2,908 1,670 48 107 Great Britain I 5,839 11,323 5,659 141 295 Hong Kong II NA 1,154 726 6 31 India II 1,490 3,896 3,362 NA 89 Ireland I 12,633 3,458 958 57 107 Italy I 2,220 5,438 4.589 27 95 Jamaica III 369 925 841 NA NA Japan I 7,516 24,143 17,476 59 217 Korea III 1,225 2,999 1,697 NA NA Macau II NA 768 737 NA 12 Mauritius III NA 350 243 NA NA Mexico III 420 1,569 n/a NA NA Netherlands III 16 187 79 NA NA New Zealand I 4,338 5,489 2,734 78 147 Panama II 143 722 1235 33 35 Peru I 488 1,300 1,882 34 54 Poland III 458 468 279 NA NA Puerto Rico II 677 1,633 1,875 NA 58 Qatar III 16 84 52 NA NA Kingdom of Saudi Arabia III 744 1,363 422 NA NA 5-2 2007 STATISTICAL INFORMATION No.
    [Show full text]
  • LUCIFER SAM[USA] (Standing at Sans Craintes Stud, Coimbatore, Tamilnadu)
    LUCIFER SAM[USA] (Standing at Sans Craintes Stud, Coimbatore, Tamilnadu) Northern Dancer Nearctic Storm Bird Natalma South Ocean New Providence Storm Cat Shining Sun Secretariat Bold Ruler Terlingua Somethingroyal Crimson Saint Crimson Satan LUCIFER SAM[USA] Bolero Rose (b - 2005) Raise a Native Native Dancer Mr. Prospector Raise You Gold Digger Nashua Rafina Sequence Halo Hail to Reason Coup de Folie Cosmah Raise the Standard Hoist the Flag Natalma Lucifer Sam[USA] won 1 race at 2 (1400 m.), $ 47,179 and placed incl. 2nd in Tattersalls Millions Acomb Stakes, Gr.3, etc. Retired to stud in 2009. Sire from 3 crops of 43 named foals, 39 starters, 18 winners, 2 black- type performers, 35 wins, Rs. 1,53,39,544 viz. Lucy Diamond (2 wins, Rs. 16,64,635 and placed incl. 2nd in Smt Teegala Sulochana Reddy Memorial Byerly Turk Million, Gr.3, VIF Stud Godolphin Barb Million, Gr.3, 3rd in Deccan Bookmakers Fillies' Championship Stakes, Gr.3, etc), Lucia (1 win, Rs. 12,58,963 and placed incl. 3rd in Bangalore 1000 Guineas, Gr.2), ANCILLARY (4 wins, Rs. 15,31,000), SPINNING CHAKRAM (4 wins, Rs. 11,07,407), VIGOROUS (3 wins, Rs. 13,19,830), JAMAICAN (3 wins, Rs. 11,93,200), GRAND APPLAUSE (3 wins, Rs. 8,26,625), JACKIE OH (3 wins, Rs. 7,97,305), SMOKEY SID (2 wins, Rs. 7,61,905), PLATINUM PEARL, DOFANTASY, IMPRESSION, LUC DIVINE, DIVINE RULER, BATTLE EMPRESS, ALL IN, SAM HOUSTON and CHRISTMAS CAKE. His fourth crop is in training. This is his fifth crop.
    [Show full text]
  • 'Group' Effort at Keeneland
    THURSDAY, NOVEMBER 7, 2013 732-747-8060 $ TDN Home Page Click Here ‘GROUP’ EFFORT AT KEENELAND AIt=s been well spread out with all of today=s The Keeneland November sale continued to churn out $1-million horses sold to different interests, which is strong results during the second day of selling very good and the top of the market is very strong,@ Wednesday in Lexington. Yesterday=s session saw said Russell. AThe top end of the market is very strong 129 horses sell for $44,277,000. The session average at the moment and was up 10.6% to $343,233 and the median rose 10% people are willing to to $220,000. Cumulatively, 242 horses have grossed spend for quality $86,532,000, compared to 209 head selling for offerings and we had $61,505,000 at this same point a year ago. The two- those top-quality day average is up 21.5% to $357,570, while the offerings. Actually median soared 37.5% to $220,000. The buy-back rate there are several for the two-day old auction stands at 20%, down from people who are very 31% in 2012. unhappy that they The star of Wednesday=s show was 2012 champion were the underbidders female sprinter Groupie Doll (Bowman=s Band), who and who haven=t commanded a final $3.1-million bid from Whisper Hill actually bought Farm=s Mandy Pope. She was the second highest priced anything. It=s because broodmare in Book 1, following Tuesday=s $4-million it=s the criteria they are price tag for Awesome Maria (Maria=s Mon).
    [Show full text]
  • 2021 Source Book Owner-Trainer-Jockey Biographies Stakes Winning Jockeys & Trainers Biographical Sketches 2021
    2021 SOURCE BOOK OWNER-TRAINER-JOCKEY BIOGRAPHIES STAKES WINNING JOCKEYS & TRAINERS BIOGRAPHICAL SKETCHES 2021 Hit the Road and jockey Umberto Rispoli have their photo taken in the “winner’s circle” following their victory in the 2020 Opening Day Runhappy Oceanside Stakes. Del Mar conducted racing despite the world-wide pandemic, but it did so without fans and also minus a winner’s circle in line with social distance guidelines. Owners ...................................3 Trainers .................................28 Jockeys ..................................61 u Del Mar thanks Equibase for their statistical aid in compiling this publication. Owners’ Del Mar statistics are for that owner, or owner group, only. No partnerships are considered, except where specifically noted. On the cover: The strange scenario of a land full of masks played out throughout the year at Del Mar and our photographers – Benoit and Associates – captured the community of horsemen going along with the program, one by one. Photos by Benoit & Associates Owner Profiles • Del Mar 2021 Del Mar Thoroughbred Club Owner Proles — 2021 O W trust, turned his dealership over to his son and daughter Nick Alexander N and headed north to the Central California wine and E Born: September 13, 1942 horse country of the Santa Ynez Valley. R Santa Monica, California • There he purchased his 280-acre ranch – Horse Haven S Reside: Santa Ynez and Del Mar, – in the town of Santa Ynez and went all in as a rancher California specializing in racehorses. These days he notes that the ranch is home to approximately 100 horses, including Silks: White, blue yoke, orange 30 broodmares, 25 to 30 racehorses and dozens of and white “MM” on juveniles, yearlings and foals/weanlings.
    [Show full text]
  • ITBOA 2014 Fall All Age TB Sale Sunday, October 12 ~ 1 P.M
    ITBOA 2014 Fall All Age TB Sale Sunday, October 12 ~ 1 P.M. Iowa State Fairgrounds ~ Des Moines, IA Horses may be viewed Saturday, October 11th from 1 - 4 P.M. and on Sunday, October 12th starting at 10 A.M. One Prairie Meadows Drive Altoona, IA 50009 1-800-577-1097 / 515-957-3002 [email protected] www.iowathoroughbred.com 2014 OFFICERS AND DIRECTORS Deb Leech...................................President Dick Cosaert...........................Vice-President Sharon Vail…….............Secretary/Treasurer Pam Ellison Carmen McShane Suzanne Evans Sandra Rasmussen Ed Holland Steve Renftle Tyler Ingle Pam Schutz Todd Lieber Ray Shattuck Brandi Jo Fett.......Executive Director Mike Baker……...Auctioneer Scott Pope……….....Announcer IMPORTANT NOTICES INSPECTIONS OF HORSE: Be sure to examine horses and read the conditions of sale prior to bidding. THERE IS NO IMPLIED WARRANTY made by the sales company or consignors as to the merchantability or fitness for particular purpose of any animal offered for sale in this auction. VETERINARY ASSISTANCE is at bidder’s expense. Examine horses before bidding. ANNOUNCEMENTS: To avoid making costly errors, please pay close attention to all announcements made from the auction stand, especially concerning horses on which you intend to bid. STAKES ENGAGEMENTS: Unless announced, all eligibility payments due after the date of sale are the responsibility of the buyer, who should promptly notify the proper racing associations of the new ownership in order to receive direct billing. THE IOWA- BRED YEARLINGS IN THIS SALE HAVE NOT BEEN NOMINATED (unless otherwise stated) TO THE ITBOA STAKES PROGRAM. NOMINATIONS ARE DUE DECEMBER 1, 2014. CARE OF HORSES: Please be reminded that title passes at the fall of the hammer, at which time the purchaser assumes all risk and responsibility for the horse.
    [Show full text]
  • Graydar Oxbow
    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.
    [Show full text]
  • 1930S Greats Horses/Jockeys
    1930s Greats Horses/Jockeys Year Horse Gender Age Year Jockeys Rating Year Jockeys Rating 1933 Cavalcade Colt 2 1933 Arcaro, E. 1 1939 Adams, J. 2 1933 Bazaar Filly 2 1933 Bellizzi, D. 1 1939 Arcaro, E. 2 1933 Mata Hari Filly 2 1933 Coucci, S. 1 1939 Dupuy, H. 1 1933 Brokers Tip Colt 3 1933 Fisher, H. 0 1939 Fallon, L. 0 1933 Head Play Colt 3 1933 Gilbert, J. 2 1939 James, B. 3 1933 War Glory Colt 3 1933 Horvath, K. 0 1939 Longden, J. 3 1933 Barn Swallow Filly 3 1933 Humphries, L. 1 1939 Meade, D. 3 1933 Gallant Sir Colt 4 1933 Jones, R. 2 1939 Neves, R. 1 1933 Equipoise Horse 5 1933 Longden, J. 1 1939 Peters, M. 1 1933 Tambour Mare 5 1933 Meade, D. 1 1939 Richards, H. 1 1934 Balladier Colt 2 1933 Mills, H. 1 1939 Robertson, A. 1 1934 Chance Sun Colt 2 1933 Pollard, J. 1 1939 Ryan, P. 1 1934 Nellie Flag Filly 2 1933 Porter, E. 2 1939 Seabo, G. 1 1934 Cavalcade Colt 3 1933 Robertson, A. 1 1939 Smith, F. A. 2 1934 Discovery Colt 3 1933 Saunders, W. 1 1939 Smith, G. 1 1934 Bazaar Filly 3 1933 Simmons, H. 1 1939 Stout, J. 1 1934 Mata Hari Filly 3 1933 Smith, J. 1 1939 Taylor, W. L. 1 1934 Advising Anna Filly 4 1933 Westrope, J. 4 1939 Wall, N. 1 1934 Faireno Horse 5 1933 Woolf, G. 1 1939 Westrope, J. 1 1934 Equipoise Horse 6 1933 Workman, R.
    [Show full text]
  • NEW for 2021 25.000€ LF - Limited to 140 Mares
    SATURDAY, 5TH DECEMBER 2020 NEW YEAR NEW OPPORTUNITY JANUARY EBN MON. 11 - THURS. 14 EUROPEAN BLOODSTOCK NEWS FOR MORE INFORMATION: TEL: +44 (0) 1638 666512 • FAX: +44 (0) 1638 666516 • [email protected] • WWW.BLOODSTOCKNEWS.EU TODAY’S HEADLINES ARQANA EBN Sales Talk Click here to is brought to contact IRT, or you by IRT visit www.irt.com WELL-BRED MARES APLENTY AT DECEMBER SALE The four-day Arqana December Breeding Stock Sale was given the go-ahead by the Calvados Prefecture and the four sessions of selling will start at 10:00am from today. Indianapolis (Galileo) topped proceedings at the Goffs UK On the same terms as last month’s Autumn Sale, access to the December Horses in Training Sale at Doncaster yesterday establishment will be exclusively reserved for professionals when purchased for £52,000. Full story on page 8. involved in the sale: consignors and their staff, buyers, vets, © Goffs UK transporters and Arqana staff. Past graduates of the sale include Lady Gorgeous, dam of this autumn’s Gr.1 Fillies’ Mile winner Pretty Gorgeous. They were IN TODAY’S ISSUE... both sold at the 2018 renewal, while Gr.1 Cheveley Park Stakes Best of British p26 winner Alcohol Free’s dam Plying was bought by BBA Ireland in 2013 and, two years earlier, Queen Of Carthage, dam of the Gr.1 Godolphin Flying Start Blog p27 Phoenix Stakes winner Lucky Vega, had been purchased by Spotlight on Adlerflug p28 Hugo Merry Bloodstock. Hello You! Hello Youmzain, the champion sprinter By leading sire and emerging sire of sires Kodiac Out of a Shamardal mare
    [Show full text]
  • HEADLINE NEWS • 10/11/09 • PAGE 2 of 16
    Biomechanics & Cardio Scores HEADLINE for Yearlings, 2YOs, Racehorses, Mares & Stallions NEWS BreezeFigs™ at the Two-Year-Old Sales For information about TDN, DATATRACK call 732-747-8060. www.biodatatrack.com www.thoroughbreddailynews.com SUNDAY, OCTOBER 11, 2009 Bob Fierro • Jay Kilgore • Frank Mitchell YATTA, YATTA, YATTA PROMISE REALIZED Perfection embodied. Unlike her last appearance in Sometimes horses improve with racing and that the GI Clement L. Hirsch S. at Del Mar, Jerry and Ann seems to be the case with Chasing Dreams Racing=s Moss=s Zenyatta (Street Cry {Ire}) left her adoring fans Noble=s Promise (Cuvee), who won for the third time in with very few anxious moments, taking an inside path the span of 35 days, defeating a deep field in the on the turn before shifting out and GI Dixiana Breeders= mowing them down late to take the Futurity at Keeneland GI Lady=s Secret S. for the second yesterday. Second in a consecutive season. Now, let the 4 1/2-furlong test here barrage begin. Will it be the Apr. 23, the bay re- GI Breeders Cup Ladies Classic, in = = turned from a spell to which she has little to prove? Or the graduate sprinting GI Breeders= Cup Classic, in which over the Ellis turf she has nearly nothing to lose? Sept. 5 and added a AThat will have to be a decision be- tween the Mosses and my wife, comfortable victory in Dottie,@ said trainer John Shirreffs. the Dixon Memorial AWe=ll have to look at the relative Juvenile on the Noble’s Promise Horsephotos Undefeated Zenyatta strength of the fields, see who=s Presque Isle Tapeta Benoit going to run, and make the call.@ Sept.
    [Show full text]
  • INTERNATIONAL STATISTICS and TECHNICAL INFORMATION INTERNATIONAL STUD BOOK COMMITTEE LIST of APPROVED STUD BOOKS (67)
    INTERNATIONAL STATISTICS and TECHNICAL INFORMATION INTERNATIONAL STUD BOOK COMMITTEE LIST OF APPROVED STUD BOOKS (67) Argentina Lithuania Australia Malaysia Austria Mexico Azerbaijan Morocco Bahrain Netherlands Barbados New Zealand Belgium and Luxembourg Norway Brazil Oman Bulgaria Pakistan Chile Paraguay China Peru Colombia Philippines Croatia Poland Cyprus Portugal Czech Republic Qatar Denmark Romania Dominican Republic Russia Ecuador Saudi Arabia (Kingdom of) Finland Serbia, Bosnia and Herzegovina France Slovakia Germany Slovenia Great Britain and Ireland South Africa and Zimbabwe Greece Spain Hungary Sweden India Switzerland Iran Syria Italy Trinidad and Tobago Jamaica Tunisia Japan Turkey Kenya United Arab Emirates Korea U.S.A., Canada and Puerto Rico Kuwait Uruguay Lebanon Uzbekistan Venezuela Stud books under assessment Panama Ukraine 5-2 2020 STATISTICAL INFORMATION No. of Black-type 2020 No. of No. of No. of Graded races (incl. Country Part foals starters flat races races graded) Argentina I *4,047 8,825 2,475 82 125 Australia I 12,862 34,337 18,535 320 581 Austria III 12 39 5 N/A N/A Bahrain III 97 374 128 N/A N/A Belgium III 22 309 112 N/A N/A Brazil I 1,651 3,315 2,410 93 135 Canada I *1,350 3,841 2,227 32 99 Chile I 1,754 4,070 3,815 38 60 Czech Republic III 149 1,003 210 N/A N/A Dominican Republic III 93 203 372 N/A N/A Ecuador III 72 213 319 N/A N/A France I 4,925 8,231 3,913 104 220 Germany I 776 1,934 891 41 78 Great Britain I 4,468 10,878 5,099 138 245 Greece III 30 323 244 N/A N/A Hong Kong I N/A 1,418 828 31 34 Hungary III 116 476 260 N/A N/A India II 1,237 3,038 1,168 N/A 55 Ireland I 9,182 3,707 1,230 73 128 Italy I 503 2,863 1,982 26 77 Jamaica III 254 871 604 N/A N/A Japan I 7,475 25,225 16,542 129 232 Korea II 1,277 3,475 1,103 0 2 Macau II N/A 392 355 N/A 9 Malaysia II 0 983 586 N/A 2 Mauritius III 0 422 278 N/A N/A Mexico III 0 674 289 N/A N/A Morocco III 321 941 631 N/A N/A Netherlands III 5 40 10 N/A N/A New Zealand I 3,140 4,263 1,916 82 121 Panama II 197 950 636 N/A 31 5-3 2020 STATISTICAL INFORMATION No.
    [Show full text]
  • Irish, European & World Thoroughbred Rankings 2016
    IRISH, EUROPEAN & WORLD THOROUGHBRED RANKINGS 2016 INDEX OF CONTENTS Section 1 - Irish Thoroughbred Racehorse Rankings 2016 Overview 1 Category Champions 3 Irish Two Year Old Rankings 4 Irish Three Year Old Rankings 7 Irish Four Year Old & Upwards Rankings 12 Irish Thoroughbred Rankings by Distance Category 18 Irish Rating List 2016 – Alphabetical Listing 23 AW Rating List 32 Quality Control 32 Section 2 – Statistical Summary 2016 33 Ratings Review: All Horses 34 Ratings Review: Horses Rated 100 35 Summary of Performances: Overview 37 Summary of Performances: Pattern Races 40 Summary of Performances: Handicap Races 44 Summary of Performances: Maiden Races 47 Section 3 – LONGINES’ World Best Racehorse Rankings 2016 48 Category Champions 50 LWBRR Listing for 2016 51 Group/Grade One Races (3-y-o’s+) Order of Merit 57 Section 4 - European Thoroughbred Racehorse Rankings 2016 58 Category Champions 60 European Two Year Old Rankings (110+) 61 European Three Year Olds Rated 114-110 62 European Four Year Old & Upwards 114-110 64 Section 5 – Appendices 66 Irish Champion Racehorses 67 European Champion Racehorses 70 World Champion Racehorses 72 World Champion Racehorses - By Distance Category 75 SECTION 1 IRISH THOROUGHBRED RACEHORSE RANKINGS 2016 IRISH THOROUGHBRED RACEHORSE RANKINGS 2016 OVERVIEW 2016 was another hugely successful and unique year for Irish Flat Racing. All five Irish Classic winners were trained in Ireland and trained by five different trainers no less. Both Adrian Keatley (JET SETTING (IRE)(120)) and Willie Mullins (WICKLOW BRAVE) (GB)(115)) achieved first time Classic success in winning the Tattersalls Irish 1,000 Guineas (G1) and the Palmerstown House Estate Irish St Leger (G1) respectively while Kevin Prendergast (AWTAAD (IRE)(118)), Dermot Weld (HARZAND (IRE)(121)) and Aidan O’Brien (SEVENTH HEAVEN (IRE)(119) completed a unique nap hand for Irish trainers in annexing the Tattersalls Irish 2000 Guineas (G1), Dubai Duty Free Irish Derby (G1) and Darley Irish Oaks (G1) respectively.
    [Show full text]