DevelopingDeveloping andand UsingUsing SpecialSpecial PurposePurpose HiddenHidden MarkovMarkov ModelModel DatabasesDatabases
Martin Gollery Associate Director of Bioinformatics University of Nevada, Reno [email protected] TodayToday’’ss TutorialTutorial
• Instructor: Martin Gollery • Associate Director of Bioinformatics, University of Nevada, Reno • Consultant to several organizations • Formerly with TimeLogic • Developed several HMM databases HiddenHidden MarkovMarkov ModelsModels
• What HMM’s are • Which HMM programs are commonly used • What HMM databases are available • Why you would use one DB over another • Integrated Resources- InterPro and more • How you can build your own HMM DB • Problems with building your own • Live demonstration HiddenHidden MarkovMarkov ModelsModels-- WhatWhat areare they,they, anyway?anyway?
• Statistical description of a protein family's consensus sequence • Conserved regions receive highest scores • Can be seen as a Finite State Machine RepresentationRepresentation ofof FamilyFamily MembersMembers • yciH KDGII • ZyciH KDGVI • VCA0570 KDGDI • HI1225 KNGII • sll0546 KEDCV
C D E G I K N V 1 1.0 2 0.6 0.2 0.2 3 0.2 0.8 4 0.2 0.2 0.4 0.2 5 0.8 0.2 RepresentationRepresentation ofof gapsgaps inin FamilyFamily MembersMembers
• yciH KDGII • ZyciH KDGVI • VCA0570 KDGDI • HI1225 KNGII • sll0546 KED-V
C D E G I K N V - 1 1.0 2 0.6 0.2 0.2 3 0.2 0.8 4 0.2 0.4 0.2 0.2 5 0.8 0.2 ForFor MaximumMaximum sensitivitysensitivity--
C D E G I K N V - 1 1.0 2 0.6 0.2 0.2 3 0.2 0.8 4 0.2 0.4 0.2 0.2 5 0.8 0.2
No residue at any position should have a zero probability, even if it was not seen in the training data. StartStart withwith anan MSAMSA……
• CLUSTAL W (1.7) multiple sequence alignment
• yciH KDGVIEIQGDKRDLLKSLLEAKGMKVKLAGG • ZyciH KDGVIEIQGDKRDLLKSLLEAKGMKVKLAGG • VCA0570 KDGDIEIQGDVRDQLKTLLESKGHKVKLAGG • HI1225 KNGIIEIQGEKRDLLKQLLEQKGFKVKLSGG • sll0546 KEDCVEIQGDQREKILAYLLKQGYKAKISGG • PA4840 KDGVVEIQGEHVELLIDELLKRGFKAKKSGG • AF0914 KNGVIELQGNHVNRVKELLIKKGFNPERIKT • *:. :*:**: : : * :* : : HiddenHidden MarkovMarkov ModelsModels
• HMMER2.0 • NAME example2 • DESC Small example for demonstration purposes • LENG 31 • ALPH Amino • COM hmmbuild example2 example2.aln • NSEQ 7 • DATE Wed Jan 08 13:33:06 2003 • HMM A C D E F G H I K … • 1 -3217 -3413 -3082 -2664 -4291 -3257 -2104 -4231 3883… • 2 -1938 -3859 2747 1592 -4024 -1857 -1206 -3953 -1455… • 3 -2160 -3144 1834 -953 -4284 3247 -2013 -4362 -2365… • 4 -1255 2750 436 -2789 -1273 -2972 -2049 1510 -2543… • 5 -2035 -1558 -4660 -4320 -2085 -4409 -4229 3081 -4224… • 6 -3264 -3765 -1447 3822 -4535 -2948 -2636 -4814 -2810… • 7 -2423 -1951 -4843 -4395 -1156 -4544 -3680 3291 -4151… • 8 -3220 -3396 -2530 -2667 -3851 -3171 -2735 -4442 -2277… • 9 -3196 -3194 -3915 -4259 -4867 3789 -4005 -5414 -4591… • 10 -1923 -3837 2743 2134 -4005 -1854 -1196 -3929 -1434… • 11 -999 -2164 -952 -353 -2483 -1909 3321 -2139 1730… • 12 -1629 -1909 -2827 -2102 -2279 -2588 -1442 -1012 -488… EmissionEmission ProbabilitiesProbabilities
• What is the likelihood that sequence X was emitted by HMM Y? • Likelihood is calculated by adding the probability of each residue at each position, and each of the transition probabilities Plan7Plan7 fromfrom OuterOuter SpaceSpace (Well, from St. Louis, anyway!) HMMHMM’’ss vsvs BLASTBLAST
• Position specific scoring vs. general matrix •Example: – dDGVIvIddDKRDLLKSLiEAKkMKVKLAGG – KDGVIEIQGDKRDLLKSLLEAKGMKVKLAGG has 80% BLAST similarity, but misses highly conserved regions
• Scoring emphasizes important locations • Clearer score cutoffs • However, it is MUCH slower! HMMHMM programsprograms
• HMMer -Sean Eddy, Wash U • SAM - Haussler, UCSC • Wise tools - Birney, EBI • SledgeHMMer - Subramaniam, SDSC • Meta-MEME - Noble & Bailey • PSI-BLAST - NCBI • SPSpfam - Southwest Parallel Software • Ldhmmer - Logical Depth • DeCypherHMM - TimeLogic WhatWhat exactlyexactly dodo youyou want?want?
• Are you searching thousands of sequences with one or a few models? • Use hmmsearch • Searching a few sequences with thousands of models? • Use hmmpfam • Thousands of sequences vs. Thousands of models? • Use an accelerator, if you do it very often HMMHMM databasesdatabases
• PFAM •TIGRFAM • Superfamily •SMART • Panther • PRED-GPCR HMMHMM databasesdatabases atat thethe CFBCFB
•COGfam •KinFam • HydroHMMer • NVfam-pro • NVfam-arc • NVfam-fun • NVfam-pln PFAMPFAM
• From Sanger, WashU, KI, INRA • Version 17 has 7868 families • Most widely used HMM database • Good annotation team PFAMPFAM
• PFAM-A is hand curated • From high quality multiple Alignments • PFAM-B is built automatically from ProDom • Generated using the Domainer algorithm • ProDom is built from SP/TREMBL PFAMPFAM
• Pfam-ls = global alignments • Pfam-fs = local alignments, so that matches may include only part of the model • Both the –ls and –fs versions are local W.R.T. the sequence PFAMPFAM
• Note ‘type’ annotation • Labeled TP • Family • Domain • Repeat •Motif TIGRFAMsTIGRFAMs
• Available at (www.tigr.org/TIGRFAMs/) • Organized by functional role • Equivalogs: a set of homologous proteins that are conserved with respect to function since their last common ancestor • Equivalog domains: domains of conserved function TIGRFAMsTIGRFAMs
• 2453 models in release 4.1 • Complementary to PFAM, so run both • Part of the Comprehensive Microbial Resource (CMR) TIGRFAMsTIGRFAMs
TIGRfam and PFAM alignments for Pyruvate carboxylase. The thin line represents the sequence. The bars represent hit regions. SuperFamilySuperFamily • By Julian Gough, formerly MRC, now Riken GSC • www.supfam.org • Provides structural (and hence implied functional) assignments to protein sequences at the superfamily level • Built from SCOP (Structural Classification of Proteins) database, which is built from PDB • Available in HMMer, SAM, and PSI-BLAST formats SuperFamilySuperFamily
• 1447 SCOP Superfamilies • Each represented by a group of HMMs • Over 8500 models total • Table provides comparison to GO, Interpro, PFAM SMARTSMART
• Simple Modular Architecture Research Tool • Version 3.4 contains 654 HMMs • Emphasis on mobile eukaryotic domains • smart.embl-heidelberg.de • Annotated with respect to phyletic distributions, functional class, tertiary structures and functionally important residues SMARTSMART
• Use for signaling domains or extracellular domains • Normal and Genomic mode PREDPRED--GPCRGPCR
• Papasaikas et al, U of Athens • 265 HMMs in 67 GPCR families • Based on TiPs Pharmacological classification. • Filters with CAST • signatures regularly updated • Entire system redone each year PREDPRED--GPCRGPCR webserverwebserver PantherPanther • Protein ANalysis THrough Evolutionary Relationships • Family and subfamily: families are evolutionarily related proteins; subfamilies are related proteins with the same function • Molecular function: the function of the protein by itself or with directly interacting proteins at a biochemical level, e.g. a protein kinase • Biological process: the function of the protein in the context of a larger network of proteins that interact to accomplish a process at the level of the cell or organism, e.g. mitosis. • Pathway: similar to biological process, but a pathway also explicitly specifies the relationships between the interacting molecules. PantherPanther
•(Thomas et al., Genome Research 2003; Mi et al. NAR 2005) • 6683 protein families • 31,705 functionally distinct protein subfamilies. PantherPanther
• Due to the size, searches could be slow • First, BLAST against consensus seqs • Then, search against models represented by those hits • With an accelerator, you don’t have to do that… PantherPanther
• So- how does it perform? • I took 3451 Arabidopsis proteins with no hit to PFAM, Superfamily, SMART or TIGRfam • Ran it against Panther • Found 160 significant hits! COGCOG--HMMsHMMs
• Clusters of Orthologous Groups of proteins • www.ncbi.nlm.nih.gov/cog/ • Each COG is from at least 3 lineages • Ancient conserved domain • 4873 alignments available • Alignments from NCBI, HMMs from me at [email protected] CDDCDD
• Conserved Domain Database (NCBI) • Psi-BLAST profiles are similar to HMMs • 10991 PSSMs - SMART + COG +KOG+ Pfam+CD • Runs with RPS-BLAST • Much faster searches KinFamKinFam
• Kinfam- models represent 53 different classes of PKs • Assigns Kinase Class and Group • Based on Hanks’ classification scheme • Database is small, so searches are fast KinFamKinFam
• Categorizes Kinase data • Available for download from bioinformatics.unr.edu
RANK SCORE QF TARGET|ACCESSION E_VALUE DESCRIPTION 1 852.93 1 KinFam||ptkgrp15 9.3e-256 Fibroblast GF recept 2 479.14 1 KinFam||ptkgrp14 3.1e-143 Platelet derived GF 3 423.33 1 KinFam||ptkother 1.9e-126 Other membrane-span HydroHmmerHydroHmmer
• Hydrohmmer finds LEAs, other hydrophilin classes • Small target size makes for very fast searches NVFAMsNVFAMs
• HMM’s reflect the training data • Specific training sets provide better results • So… use Archaeal data to study Archaeons, Fungal data to study Fungi, etc. • Designed for use with PFAM, not stand alone • Recent redesign, name change NVFAMsNVFAMs
• NVFAM-pro used to study E. faecalis • Demonstrated higher scores, better aligns • However, PFAM had more total hits • P.falciparum used as negative control • PFAM showed better scores, aligns as predicted • Automated design by Garrett Taylor- scripts are available! • Contact me for input, collaboration, or help to build your own WhichWhich databasedatabase toto use?use? OneOne ComparisonComparison TestTest-- (Your(Your resultsresults maymay varyvary……)) • Compare 563 I. pini sequences to COGhmm, PFAM, PFAMfrag, SMART, TIGRfam, TIGRfamfrag, Superfamily • COGs- 9 • PFAM- 22 • PFAMfrag- 57 •SMART-4 • Superfamily- 30 •TIGRfam-6 • TIGRfamfrag- 12 IntegratedIntegrated ResourcesResources
• InterProscan •MAGPIE • PANAL • Make your own! InterProInterPro • Database built from PFAM, Prints, Prosite, SuperFamily, ProDom, SMART, TIGRFAMs, PANTHER, PIRsf, Gene3D & SP/TrEMBL • Version 10.0 • Nearly 12,000 entries • http://www.ebi.ac.uk/interpro/ • InterProScan can be installed locally InterProScanInterProScan
• Splits up big jobs & reassembles them • Works with SGE, PBS, LSF • A free analysis pipeline! • Provides GO mappings • Written in PERL, so it’s easy to modify • Average 4 min. per NT sequence per CPU InterProInterPro
InterPro release 10.0 contains 11972 entries, representing 3079 domains, 8597 families, 228 repeats, 27 active sites, 21 binding sites and 20 post-translational modification sites. Overall, there are 7521179 InterPro hits from 1466570 UniProt protein sequences. A complete list is available from the ftp site.
DATABASE VERSION ENTRIES SWISS-PROT 46.5 180652 PRINTS 37.0 1850 TrEMBL 29.5 1689375 Pfam 17.0 7868 PROSITE patterns 18.45 1800 PROSITE preprofiles N/A 120 ProDom 2004.1 1522 InterPro 10.0 11972 SMART 4.0 663 TIGRFAMs 4.1 2454 PIRSF 2.52 962 PANTHER 5.0 438 SUPERFAMILY 1.65 1160 Gene3D 3.0 117 GO Classification N/A 18705
ModifyingModifying InterProScanInterProScan
• Two ways to Add your own HMM database to InterProScan: • Modify PERL scripts • Concatenate your models onto PFAM • Similarly, if you are looking for a specific target, delete all the rest to speed up searches PANALPANAL
• Simultaneously searches several targets • Produces a nice graphical overview • Databases- –PFAM –SMART –TIGRFAM –Prosite –PRINTS –BLOCKS PANALPANAL MAGPIEMAGPIE
•BLOCKS • NCBI public non-redundant DNA and protein • NCBI EST databases • NCBI Conserved Domain Database (CDD) • Protein Identification Resource SuperFamilies • PFAM •ProDom • SCOP SuperFamilies • SMART •TIGRFam •ProSite MAGPIEMAGPIE
• Gives a putative description of the gene • Database search result ranking based on user defined tool precedence and score thresholds. • A single graphical summary of the various search results • Links to the database source entries MAGPIEMAGPIE
• Gene taxonomic distribution information • Reporting of similar sequences in the dataset based on hits to similar database entries • Annotated metabolic pathway diagrams • Gene Ontology (GO) term assignments MAGPIEMAGPIE
Terry Gaasterland et al. Genome Res. 2000; 10: 502-510 BuildingBuilding YourYour OwnOwn HMMHMM DatabaseDatabase • Why do it? • Greater Specificity • Represent your training set • Faster searches • Focus on the particular aspects that you want HMMsearch BLAST PFAM Yo u r Your Public Data Or Data DB
Cluster Se q u e n c e s
Discard Singletons
Bu i ld Multip le Seque nce Alig nme nts
Check Alignments HMMbuild HMMcalibrate Add Description Line
Annota te First,First, searchsearch againstagainst aa targettarget…… SelectSelect thethe hitshits forfor thethe modelmodel BuildBuild thethe MultipleMultiple SequenceSequence AlignmentAlignment RunRun HMMbuildHMMbuild toto makemake thethe modelmodel IterateIterate SearchSearch toto AddAdd moremore distantdistant MembersMembers DesignDesign Decisions:Decisions:
• Local or global models? • Which sequence weighting scheme? • What type of Prior? CalibrationCalibration
• Hmmcalibrate • Improves scoring • Compares to random data • Can be done on each model, or on the entire collection CalibrationCalibration
• Very time consuming on CPU, not on researcher • No acceleration available • Not necessary with SAM MemeMeme andand MetaMeta--MemeMeme
• Meme discovers motifs in a group of related DNA or protein sequences • Motifs contain no gaps- split in two instead MetaMeta--memememe
• Meta-meme takes meme motifs & related seqs as input • Combines motifs into HMMs • Regions between motifs are modeled imprecisely • Reduction in parameter space • Accurate models with fewer training seqs MetaMeta--memememe
• mhmm: Build a motif-based HMM from Meme motifs. • mhmms: Search a sequence database using a motif-based HMM • mhmmscan: Like mhmms, but allows long seqs and multiple matches. UsingUsing RPSRPS--BLASTBLAST
• Start with PSI-BLAST using –C • Prepare files with makemat and copymat • Compile target • Annotate • Search with RPS-BLAST IMPALAIMPALA
• Also uses profiles database • Alignments generated by Smith-Waterman instead of word hit initiated • 10-100x Slower, might be better than RPS- BLAST SPEEDSPEED
• PVM version of HMMer is available, MPI is on the way (?) • Other Solutions- use PSSM’s? • SPSpfam can speed searches 3-60X • SledgeHMMer claims 10X Speedup • Accelerators • Target Triage SPSpfamSPSpfam
• From Southwest Parallel Software • Optimized HMMer code • Up to 60X faster • Works well on cluster • Uses binary Pfam, so you can’t drop it into InterProScan • This may change soon HMMHMM AcceleratorsAccelerators
• Can provide speedup of 100’s-1000’s X • TimeLogic is the only commercial one left • HokieGene from Virginia Tech • StarBridge - No HMMs yet • Others coming soon • An open-source project is in the works- BioFPGA HMMsHMMs onon thethe WebWeb
• SAM http://www.cse.ucsc.edu/research/compbio/ • HMMer http://hmmer.wustl.edu/ • Several other HMMer servers… • SledgeHMMer.sdsc.edu is only unlimited webserver- most restrict you to one sequence at a time. ResourcesResources • Online Applications: • HMMer http://hmmer.wustl.edu/ • SAM-T02 http://www.soe.ucsc.edu/research/compbio/ HMM-apps/HMM-applications.html • Pfam http://pfam.wustl.edu/ • SledgeHMMer sledgehmmer.sdsc.edu • Meta-MEME http://metameme.sdsc.edu/ • PANAL http://web.ahc.umn.edu/panal/ ResourcesResources
• Commercial vendors of HMM systems • SPSpfam (www.spsoft.com) • Ldhmmer (www.logicaldepth.com) • DeCypherHMM (www.timelogic.com) ReferencesReferences
• S.Altshul, et al. Basic Local Alignment Search Tool. JMB, 215:403{410, 1990. • C. Barrett, et al. Scoring hidden Markov models. CABIOS, 13(2):191{199, 1997. • S. R. Eddy. Profile hidden markov models. Bioinformatics, 14(9):755{63, 1998. • W. N. Grundy,et al. Meta-MEME: Motif-based hidden Markov models of protein families. CABIOS, 13(4):397{406, 1997. • M. Gribskov, et al. Profile analysis: Detection of distantly related proteins. PNAS, 84:4355{4358, July 1987. • S. Henikoff and Jorja G. Henikoff. Amino acid substitution matrices from protein blocks. PNAS, 89:10915{10919, November 1992. • [HH94] Steven Henikoff and Jorja G. Henikoff. Position-based sequence weights. JMB, • 243(4):574{578, November 1994. • Jerey D. et al. Kestrel: A programmable array for sequence analysis. In Application-Specific • Array Processors, pages 25{34, Los Alamitos, CA, July 1996. IEEE Computer Society. • R. Hughey and A. Krogh. Hidden Markov models for sequence analysis: Extension and analysis of the basic method. CABIOS, 12(2):95{107, 1996. • T. Hubbard, et al. SCOP: a structural classification of proteins database. NAR, 25(1):236{9, January 1997. • L. Holm and C. Sander. Dali/fssp classification of three-dimensional • protein folds. NAR, 25:231{234, 1 Jan 1997. • K. Karplus, et al. Predicting protein structure using only sequence • information. Proteins: Structure, Function, and Genetics • K. Karplus, et al. Hidden markov models for detecting remote protein homologies. Bioinformatics, 14(10):846{856, 1998. • A. Krogh, et al, Hidden Markov models in computational biology: Applications to protein modeling. JMB, 235:1501{1531, February 1994. • Kevin Karplus, et al. Predicting protein structure using hidden Markov models. Proteins: Str, Func, and Genetics, Suppl. 1:134{139, 1997. • C. A. Orengo, et al. Cath- a hierarchic classification of protein domain structures. • Structure, 5(8):1093{108, August 1997. • J. Park, et al. Sequence comparisons using multiple sequences detect twice • as many remote homologues as pairwise methods. JMB, 284(4):1201{1210 • E.L.L Sonnhammer, et al. Pfam: A comprehensive database of protein families. Proteins, 28:405{420, 1997. • K. Sjolander, et al. Dirichlet mixtures: A method for improving detection of weak • but signicant protein sequence homology. CABIOS, 12(4):327{345, August 1996. • Reinhard Schneider and Chris Sander. The HSSP database of protein • structure-sequence alignments. NAR, 24(1):201{205, 1 Jan 1996. • Chukkapalli G., Guda, C. and Subramaniam S. SledgeHMMER: A web server for batch searching Pfam database, Nucleic Acids Res. , 32:W542-544 • Schaffer, A.A., Wolf, Y.I., Ponting, C.P. Koonin, E.V., Aravind, L., Altschul, S. F., IMPALA: Matching a Protein Sequence Against a Collection of PSI-BLAST-Constructed Position- Specific Score Matrices, Bioninformatics, • P. K. Papasaikas, P. G. Bagos, Z. I. Litou, V. J. Promponas and S. J. Hamodrakas PRED-GPCR: GPCR recognition and family classification serveNucleic Acids Research 2004 32(Web Server issue):W380-W382; doi:10.1093/nar/gkh431 • Silverstein, K.A.T., A. Kilian, J.L. Freeman, and E.F. Retzel. "PANAL: an integrated resource for Protein sequence ANALysis," Bioinformatics, 16:1157-1158, 2000 Thanks!Thanks! • Garrett Taylor, Brian Beck, Taliah Mittler, Barrett Abel, John Cushman, Lee Weber • Contact me at- [email protected] • Bioinformatics.unr.edu