Dissection of the Functions of the Saccharomyces Cerevisiae RAD6 Postreplicative Repair Group in Mutagenesis and UV Sensitivity

Total Page:16

File Type:pdf, Size:1020Kb

Dissection of the Functions of the Saccharomyces Cerevisiae RAD6 Postreplicative Repair Group in Mutagenesis and UV Sensitivity Copyright 2001 by the Genetics Society of America Dissection of the Functions of the Saccharomyces cerevisiae RAD6 Postreplicative Repair Group in Mutagenesis and UV Sensitivity Petr Cˇ ejka,*,† Vladimı´r Vondrejs* and Zuzana Storchova´*,† *Department of Genetics and Microbiology, Faculty of Natural Sciences, Charles University, 128 44 Prague, Czech Republic and †Institute of Medical Radiobiology, University of Zurich, 8008 Zurich, Switzerland Manuscript received May 9, 2001 Accepted for publication August 17, 2001 ABSTRACT The RAD6 postreplicative repair group participates in various processes of DNA metabolism. To elucidate the contribution of RAD6 to starvation-associated mutagenesis, which occurs in nongrowing cells cultivated under selective conditions, we analyzed the phenotype of strains expressing various alleles of the RAD6 gene and single and multiple mutants of the RAD6, RAD5, RAD18, REV3, and MMS2 genes from the RAD6 repair group. Our results show that the RAD6 repair pathway is also active in starving cells and its contribution to starvation-associated mutagenesis is similar to that of spontaneous mutagenesis. Epistatic analysis based on both spontaneous and starvation-associated mutagenesis and UV sensitivity showed that the RAD6 repair group consists of distinct repair pathways of different relative importance requiring, besides the presence of Rad6, also either Rad18 or Rad5 or both. We postulate the existence of four pathways: (1) nonmutagenic Rad5/Rad6/Rad18, (2) mutagenic Rad5/Rad6 /Rev3, (3) mutagenic Rad6/ Rad18/Rev3, and (4) Rad6/Rad18/Rad30. Furthermore, we show that the high mutation rate observed in rad6 mutants is caused by a mutator different from Rev3. From our data and data previously published, we suggest a role for Rad6 in DNA repair and mutagenesis and propose a model for the RAD6 postreplicative repair group. UTATIONS play a fundamental role in evolution One of the DNA repair pathways suggested to be in- M and contribute to aging, carcinogenesis, and ge- volved in SAM of the unicellular eukaryotic organism netic diseases. Spontaneous mutations occur during Saccharomyces cerevisiae is the RAD6 postreplicative repair DNA replication by incorrect nucleotide incorporation, pathway (Storchova´ et al. 1998). This pathway is in- followed by skipping the proofreading activity of replica- volved in the repair of UV-induced DNA lesions and tive polymerases and the activity of the mismatch repair other bulky lesions that block DNA replication and in pathway; arise as DNA repair errors; or are introduced mutagenesis. The RAD6 epistatic group can be dissected by some mutagenic system. Mutations resulting after into various repair subpathways, but they are poorly mutagenic treatment are called induced mutations and understood (Liefshitz et al. 1998; Xiao et al. 2000). appear to result from mutagenic repair (Friedberg et The pivotal gene of this group is RAD6. Its product al. 1995). In the past decade, it was shown that mutations functions in various cellular processes including DNA also occur during prolonged nonlethal starvation in repair and mutagenesis, gene silencing, protein degra- nongrowing cells in both bacteria and unicellular eu- dation, sporulation, and histone H2B ubiquitination. karyotes. These mutations are called adaptive or star- Null rad6 mutants exhibit a pleiotropic phenotype—they vation associated. Several mechanisms have been sug- possess a defect in all of the above-listed functions—that gested for adaptive mutations in bacteria (e.g., Foster contributes to their extreme sensitivity to various DNA- 2000). They are suggested to be mainly a result of incor- damaging agents, enhanced spontaneous and impaired rect DNA repair of endogenous lesions arising in starv- induced mutagenesis, lower growth rate, decreased via- ing cells (e.g., Bridges 1996); however, the existence bility under stress conditions, and so on (Lawrence 1994). of such lesions has not yet been substantiated. The abil- The protein Rad6 consists of 172 amino acid residues, ity of cells to generate mutations in even a quiescent from which the last 23 form an almost entirely acidic state appears to be a general phenomenon, at least C-terminal tail (Morrison et al. 1988). It is a ubiquitin- among unicellular organisms. However, we do not un- conjugating enzyme (E2) catalyzing the ubiquitination derstand the exact mechanism of starvation-associated of proteins in cooperation with other proteins. Rad6 mutagenesis (SAM) and we do not know its contribution ubiquitinates either by forming a Lys-48 polyubiquitin to survival and evolution of microorganisms. chain, which serves as a signal for proteosomal degrada- tion of the ubiquitylated proteins (Dohmen et al. 1991; Watkins et al. 1993), or by monoubiquitination, which Corresponding author: Zuzana Storchova´, Institute of Medical Radiobi- ology, University of Zurich, August Forel Str. 7, 8008 Zurich, Switzer- is not a signal for degradation and is known, for exam- land. E-mail: [email protected] ple, for histones (Robzyk et al. 2000). The protein was Genetics 159: 953–963 (November 2001) 954 P. Cˇ ejka, V. Vondrejs and Z. Storchova´ shown to interact tightly with either Ubr1 for ubiquitin- nonessential DNA polymerase has the capability to by- mediated N-end rule protein degradation (Watkins et pass thymine dimers and other replication-blocking le- al. 1993) or Rad18 for the DNA repair functions (Bailly sions at the cost of an increased mutation frequency et al. 1997a,b). (translesion synthesis; Nelson et al. 1996; Baynton et According to mutational analysis, the functions of the al. 1999). The role of the Rad6/Rad18 heterodimer in Rad6 protein can be attributed to its distinct domains. this process is not very clear, but it was suggested that The first nine amino acids are required for interaction it allows the recruitment of pol␨ to the stalled replication with Ubr1 and thus for N-end rule-mediated protein fork (Bailly et al. 1997b). degradation (Watkins et al. 1993). They are probably On the basis of recent epistatic studies, RAD30 belongs also involved in error-free repair (Broomfield et al. to neither of the two above-mentioned subpathways and 1998). The amino acids 142–149 and, less importantly, probably represents a third subpathway (Xiao et al. residues 10–22 are responsible for the interaction with 2000). It encodes translesion polymerase ␩ that exhibits Rad18 and thus for the DNA repair functions of Rad6 low fidelity and tolerance to DNA damage (Washing- (Bailly et al. 1997a,b). Cysteine at position 88 is re- ton et al. 1999). The significance of this pathway in quired for binding of a ubiquitin molecule (Sung et al. DNA repair remains unclear. 1990). The acidic C-terminal tail is involved in ubiquiti- We have shown previously that the rad6-1 mutation nation of histone H2B, sporulation, meiotic functions, significantly enhanced SAM (Storchova´ et al. 1998). and, less importantly, in nonspecific interaction with To clarify the role of Rad6 in SAM in more detail, we Ubr1 (Sung et al. 1988; Robzyk et al. 2000; Ulrich and constructed a rad6 null mutant and complemented the Jentsch 2000). mutation by various rad6 alleles carried on plasmids. As mentioned above, Rad6 interacts with Rad18, the The analysis showed that, in particular, Rad6 DNA re- product of another member of the RAD6 group. This pair function is responsible for maintaining the low level interaction is necessary for Rad6 DNA repair functions, of SAM in the wild-type strain. We therefore analyzed because Rad18, unlike Rad6, shows an affinity to ssDNA the effect of deletion of various RAD6 repair group and appears to target Rad6 toward damaged DNA genes on spontaneous and starvation-associated muta- (Bailly et al. 1994). The Rad6/Rad18 complex has genesis and sensitivity to UV light to elucidate the role been assumed to be required for all recognized subpath- of the error-free and error-prone subpathways in SAM. ways within the RAD6 group (see below), although rad18 Our experimental system allowed us to compare the mutants do not show a DNA repair deficiency as strong relative importance of various RAD6 group genes in as rad6 mutants. SAM and spontaneous mutagenesis. The analysis of rev3, Epistasis studies have identified three subpathways rad5, rad18, and mms2 single and multiple mutants al- within this group up to now. An error-free pathway lowed us to propose a model for RAD6-mediated sub- acting by a yet-unknown mechanism involves Rad5, pathways acting in repair and mutagenic processes. Mms2, Ubc13, Pol30, and pol␦ (Xiao et al. 1999, 2000). One of the members, Rad5, has DNA helicase and zinc- MATERIALS AND METHODS binding domains, shows affinity to ssDNA, and tran- siently interacts with the ubiquitin-conjugating protein General methods: For nonselective growth, YPD medium complex Mms2/Ubc13 (Johnson et al. 1994; Ulrich consisting of 2% glucose, 1% bactopeptone, and 0.5% yeast and Jentsch 2000). The products of MMS2 and UBC13 extract was used (all Difco, Detroit). For selection of clones with replacement of the gene of interest by kanMX4 cassette, have both been shown to be members of the RAD6 YPD with G418 (400 ␮g/ml; GIBCO BRL, Paisley, Scotland) epistasis group and involved in error-free repair and was used. Synthetic dropout (SD) medium (0.75% yeast nitro- form a tight heterodimer possessing the ability to conju- gen base without amino acids, 2% glucose, and dropout solu- gate a polyubiquitin chain in vitro via an unusual Lys- tion; Difco) was used for selective growth when the essential 63 (Hofmann and Pickart 1999). In vitro studies also supplement for selection was omitted. All the media were solidified in 2% agar (Difco). Yeast genetics methods were showed interaction of Rad5 and Rad18. It was suggested used essentially as described (Ausubel et al. 1994). All yeast that the two similar ubiquitin-conjugating enzymes Rad6 strains were propagated under aerobic conditions at 30Њ. and Mms2/Ubc13 form complexes with either Rad18 Yeast strains: The yeast strains used in this study for analysis or Rad5, respectively.
Recommended publications
  • Ubiquitination Is Not Omnipresent in Myeloid Leukemia Ramesh C
    Editorials Ubiquitination is not omnipresent in myeloid leukemia Ramesh C. Nayak1 and Jose A. Cancelas1,2 1Division of Experimental Hematology and Cancer Biology, Cincinnati Children’s Hospital Medical Center and 2Hoxworth Blood Center, University of Cincinnati Academic Health Center, Cincinnati, OH, USA E-mail: JOSE A. CANCELAS - [email protected] / [email protected] doi:10.3324/haematol.2019.224162 hronic myelogenous leukemia (CML) is a clonal tination of target proteins through their cognate E3 ubiq- biphasic hematopoietic disorder most frequently uitin ligases belonging to three different families (RING, Ccaused by the expression of the BCR-ABL fusion HERCT, RING-between-RING or RBR type E3).7 protein. The expression of BCR-ABL fusion protein with The ubiquitin conjugating enzymes including UBE2N constitutive and elevated tyrosine kinase activity is suffi- (UBC13) and UBE2C are over-expressed in a myriad of cient to induce transformation of hematopoietic stem tumors such as breast, pancreas, colon, prostate, lym- cells (HSC) and the development of CML.1 Despite the phoma, and ovarian carcinomas.8 Higher expression of introduction of tyrosine kinase inhibitors (TKI), the dis- UBE2A is associated with poor prognosis of hepatocellu- ease may progress from a manageable chronic phase to a lar cancer.9 In leukemia, bone marrow (BM) cells from clinically challenging blast crisis phase with a poor prog- pediatric acute lymphoblastic patients show higher levels nosis,2 in which myeloid or lymphoid blasts fail to differ- of UBE2Q2
    [Show full text]
  • Proteomic Analysis of the Rad18 Interaction Network in DT40 – a Chicken B Cell Line
    Proteomic analysis of the Rad18 interaction network in DT40 – a chicken B cell line Thesis submitted for the degree of Doctor of Natural Sciences at the Faculty of Biology, Ludwig-Maximilians-University Munich 15th January, 2009 Submitted by Sushmita Gowri Sreekumar Chennai, India Completed at the Helmholtz Zentrum München German Research Center for Environmental Health Institute of Clinical Molecular Biology and Tumor Genetics, Munich Examiners: PD Dr. Berit Jungnickel Prof. Heinrich Leonhardt Prof. Friederike Eckardt-Schupp Prof. Harry MacWilliams Date of Examination: 16th June 2009 To my Parents, Sister, Brother & Rajesh Table of Contents 1. SUMMARY ........................................................................................................................ 1 2. INTRODUCTION ............................................................................................................. 2 2.1. MECHANISMS OF DNA REPAIR ......................................................................................... 3 2.2. ADAPTIVE GENETIC ALTERATIONS – AN ADVANTAGE ....................................................... 5 2.3. THE PRIMARY IG DIVERSIFICATION DURING EARLY B CELL DEVELOPMENT ...................... 6 2.4. THE SECONDARY IG DIVERSIFICATION PROCESSES IN THE GERMINAL CENTER .................. 7 2.4.1. Processing of AID induced DNA lesions during adaptive immunity .................. 9 2.5. TARGETING OF SOMATIC HYPERMUTATION TO THE IG LOCI ............................................ 10 2.6. ROLE OF THE RAD6 PATHWAY IN IG DIVERSIFICATION
    [Show full text]
  • UBE2B (HR6B) [Untagged] E2 – Ubiquitin Conjugating Enzyme
    UBE2B (HR6B) [untagged] E2 – Ubiquitin Conjugating Enzyme Alternate Names: HHR6B, HR6B, RAD6B, Ubiquitin carrier protein B, Ubiquitin protein ligase B Cat. No. 62-0004-100 Quantity: 100 µg Lot. No. 1456 Storage: -70˚C FOR RESEARCH USE ONLY NOT FOR USE IN HUMANS CERTIFICATE OF ANALYSIS Page 1 of 2 Background Physical Characteristics The enzymes of the ubiquitylation Species: human Protein Sequence: pathway play a pivotal role in a num- GPLGSSTPARRRLMRDFKRLQEDPPVGVS ber of cellular processes including Source: E. coli expression GAPSENNIMQWNAVIFGPEGTPFEDGT regulated and targeted proteasomal FKLVIEFSEEYPNKPPTVRFLSKMFHPNVY degradation of substrate proteins. Quantity: 100 μg ADGSICLDILQNRWSPTYDVSSILTSIQSLL DEPNPNSPANSQAAQLYQENKREYEKRV Three classes of enzymes are in- Concentration: 1 mg/ml SAIVEQSWNDS volved in the process of ubiquitylation; activating enzymes (E1s), conjugating Formulation: 50 mM HEPES pH 7.5, enzymes (E2s) and protein ligases 150 mM sodium chloride, 2 mM The residues underlined remain after cleavage and removal of the purification tag. (E3s). UBE2B is a member of the E2 dithiothreitol, 10% glycerol UBE2B (regular text): Start bold italics (amino acid residues ubiquitin-conjugating enzyme family 2-152) and cloning of the human gene was Molecular Weight: ~17 kDa Accession number: NP_003328 first described by Koken et al. (1991). UBE2B shares 70% identity with its Purity: >98% by InstantBlue™ SDS-PAGE yeast homologue but lacks the acidic Stability/Storage: 12 months at -70˚C; C-terminal domain. The ring finger aliquot as required proteins RAD5 and RAD18 interact with UBE2B and other members of the RAD6 pathway (Notenboom et al., Quality Assurance 2007; Ulrich and Jentsch, 2000). In complex UBE2B and RAD18 trigger Purity: Protein Identification: replication fork stalling at DNA dam- 4-12% gradient SDS-PAGE Confirmed by mass spectrometry InstantBlue™ staining age sites during the post replicative Lane 1: MW markers E2-Ubiquitin Thioester Loading Assay: repair process (Tsuji et al., 2008).
    [Show full text]
  • DNA Replication Stress Response Involving PLK1, CDC6, POLQ
    DNA replication stress response involving PLK1, CDC6, POLQ, RAD51 and CLASPIN upregulation prognoses the outcome of early/mid-stage non-small cell lung cancer patients C. Allera-Moreau, I. Rouquette, B. Lepage, N. Oumouhou, M. Walschaerts, E. Leconte, V. Schilling, K. Gordien, L. Brouchet, Mb Delisle, et al. To cite this version: C. Allera-Moreau, I. Rouquette, B. Lepage, N. Oumouhou, M. Walschaerts, et al.. DNA replica- tion stress response involving PLK1, CDC6, POLQ, RAD51 and CLASPIN upregulation prognoses the outcome of early/mid-stage non-small cell lung cancer patients. Oncogenesis, Nature Publishing Group: Open Access Journals - Option C, 2012, 1, pp.e30. 10.1038/oncsis.2012.29. hal-00817701 HAL Id: hal-00817701 https://hal.archives-ouvertes.fr/hal-00817701 Submitted on 9 Jun 2021 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Distributed under a Creative Commons Attribution - NonCommercial - NoDerivatives| 4.0 International License Citation: Oncogenesis (2012) 1, e30; doi:10.1038/oncsis.2012.29 & 2012 Macmillan Publishers Limited All rights reserved 2157-9024/12 www.nature.com/oncsis ORIGINAL ARTICLE DNA replication stress response involving PLK1, CDC6, POLQ, RAD51 and CLASPIN upregulation prognoses the outcome of early/mid-stage non-small cell lung cancer patients C Allera-Moreau1,2,7, I Rouquette2,7, B Lepage3, N Oumouhou3, M Walschaerts4, E Leconte5, V Schilling1, K Gordien2, L Brouchet2, MB Delisle1,2, J Mazieres1,2, JS Hoffmann1, P Pasero6 and C Cazaux1 Lung cancer is the leading cause of cancer deaths worldwide.
    [Show full text]
  • Supplementary Materials
    Supplementary materials Supplementary Table S1: MGNC compound library Ingredien Molecule Caco- Mol ID MW AlogP OB (%) BBB DL FASA- HL t Name Name 2 shengdi MOL012254 campesterol 400.8 7.63 37.58 1.34 0.98 0.7 0.21 20.2 shengdi MOL000519 coniferin 314.4 3.16 31.11 0.42 -0.2 0.3 0.27 74.6 beta- shengdi MOL000359 414.8 8.08 36.91 1.32 0.99 0.8 0.23 20.2 sitosterol pachymic shengdi MOL000289 528.9 6.54 33.63 0.1 -0.6 0.8 0 9.27 acid Poricoic acid shengdi MOL000291 484.7 5.64 30.52 -0.08 -0.9 0.8 0 8.67 B Chrysanthem shengdi MOL004492 585 8.24 38.72 0.51 -1 0.6 0.3 17.5 axanthin 20- shengdi MOL011455 Hexadecano 418.6 1.91 32.7 -0.24 -0.4 0.7 0.29 104 ylingenol huanglian MOL001454 berberine 336.4 3.45 36.86 1.24 0.57 0.8 0.19 6.57 huanglian MOL013352 Obacunone 454.6 2.68 43.29 0.01 -0.4 0.8 0.31 -13 huanglian MOL002894 berberrubine 322.4 3.2 35.74 1.07 0.17 0.7 0.24 6.46 huanglian MOL002897 epiberberine 336.4 3.45 43.09 1.17 0.4 0.8 0.19 6.1 huanglian MOL002903 (R)-Canadine 339.4 3.4 55.37 1.04 0.57 0.8 0.2 6.41 huanglian MOL002904 Berlambine 351.4 2.49 36.68 0.97 0.17 0.8 0.28 7.33 Corchorosid huanglian MOL002907 404.6 1.34 105 -0.91 -1.3 0.8 0.29 6.68 e A_qt Magnogrand huanglian MOL000622 266.4 1.18 63.71 0.02 -0.2 0.2 0.3 3.17 iolide huanglian MOL000762 Palmidin A 510.5 4.52 35.36 -0.38 -1.5 0.7 0.39 33.2 huanglian MOL000785 palmatine 352.4 3.65 64.6 1.33 0.37 0.7 0.13 2.25 huanglian MOL000098 quercetin 302.3 1.5 46.43 0.05 -0.8 0.3 0.38 14.4 huanglian MOL001458 coptisine 320.3 3.25 30.67 1.21 0.32 0.9 0.26 9.33 huanglian MOL002668 Worenine
    [Show full text]
  • Dysfunction of Human Rad18 Results in Defective Postreplication Repair and Hypersensitivity to Multiple Mutagens
    Dysfunction of human Rad18 results in defective postreplication repair and hypersensitivity to multiple mutagens Satoshi Tateishi*, Yoshiyuki Sakuraba†, Sadaharu Masuyama*, Hirokazu Inoue†, and Masaru Yamaizumi*‡ *Institute of Molecular Embryology and Genetics, Kumamoto University School of Medicine, Kumamoto 862-0976, Japan; and †Department of Regulation Biology, Faculty of Science, Saitama University, Urawa 338-8570, Japan Communicated by Philip C. Hanawalt, Stanford University, Stanford, CA, April 7, 2000 (received for review January 25, 2000) Postreplication repair functions in gap-filling of a daughter strand CCATACTCAACTATCC-3Ј, which amplify a 622-bp fragment on replication of damaged DNA. The yeast Saccharomyces cerevi- in the 3Ј untranslated region of hRAD18. Human hHR6A and siae Rad18 protein plays a pivotal role in the process together with hHR6B cDNA were obtained by PCR using a cDNA library the Rad6 protein. Here, we have cloned a human homologue of prepared from normal human fibroblasts. RAD18, hRAD18. It maps on chromosome 3p24–25, where dele- tions are often found in lung, breast, ovary, and testis cancers. In Cell Culture and Transfection. Cells were cultured in DMEM vivo, hRad18 protein binds to hHR6 protein through a conserved supplemented with 10% FCS, 100 units͞ml penicillin G, and 100 ␮ ͞ ring-finger motif. Stable transformants with hRad18 mutated in g ml streptomycin in a humidified 5% CO2 incubator. Mori-SV this motif become sensitive to UV, methyl methanesulfonate, and is a normal human skin fibroblast immortalized with simian virus mitomycin C, and are defective in the replication of UV-damaged 40. Mutant hRAD18 cDNAs were produced with a Quick- DNA. Thus, hRAD18 is a functional homologue of RAD18.
    [Show full text]
  • Requirement of Rad18 Protein for Replication Through DNA Lesions in Mouse and Human Cells
    Requirement of Rad18 protein for replication through DNA lesions in mouse and human cells Jung-Hoon Yoon, Satya Prakash, and Louise Prakash1 Department of Biochemistry and Molecular Biology, University of Texas Medical Branch at Galveston, Galveston, TX 77555 Edited* by Jerard Hurwitz, Memorial Sloan-Kettering Cancer Center, New York, NY, and approved March 21, 2012 (received for review March 8, 2012) In yeast, the Rad6-Rad18 ubiquitin conjugating enzyme plays a translocase activity that could function directly in lesion bypass critical role in promoting replication although DNA lesions by by promoting replication fork regression and template switching translesion synthesis (TLS). In striking contrast, a number of (11). Genetic studies in yeast have provided evidence for the studies have indicated that TLS can occur in the absence of requirement of Mms2, Ubc13, and Rad5 for a template-switch- Rad18 in human and other mammalian cells, and also in chicken ing mode of lesion bypass and they have shown that both the cells. In this study, we determine the role of Rad18 in TLS that ubiquitin ligase and DNA translocase activities are essential for occurs during replication in human and mouse cells, and show that Rad5 to carry out its role in lesion bypass (6, 12). in the absence of Rad18, replication of duplex plasmids containing Mammalian cells have two RAD6 homologs, RAD6A and a cis-syn TT dimer or a (6-4) TT photoproduct is severely inhibited RAD6B, and a single RAD18 gene. Importantly, in contrast to in human cells and that mutagenesis resulting from TLS opposite the indispensability of the Rad6-Rad18 enzyme and of PCNA cyclobutane pyrimidine dimers and (6-4) photoproducts formed at ubiquitylation for TLS in yeast cells, several studies have in- the TT, TC, and CC dipyrimidine sites in the chromosomal cII gene dicated that Rad6-Rad18 and PCNA ubiquitylation may not play in UV-irradiated mouse cells is abolished.
    [Show full text]
  • UBE2A (HR6A) [GST-Tagged] E2 – Ubiquitin Conjugating Enzyme
    UBE2A (HR6A) [GST-tagged] E2 – Ubiquitin Conjugating Enzyme Alternate Names: HHR6A, HR6A, RAD6A, UBC2, EC 6.3.2.19, Ubiquitin-conjugating enzyme E2A Cat. No. 62-0001-020 Quantity: 20 µg Lot. No. 1384 Storage: -70˚C FOR RESEARCH USE ONLY NOT FOR USE IN HUMANS CERTIFICATE OF ANALYSIS Background Physical Characteristics The enzymes of the ubiquitylation pathway Species: human Protein Sequence: play a pivotal role in a number of cellular MSPILGYWKIKGLVQPTRLLLEYLEEKYEEH processes including the regulated and tar- Source: E. coli expression LYERDEGDKWRNKKFELGLEFPNLPYYIDGD geted proteosomal degradation of sub- VKLTQSMAIIRYIADKHNMLGGCPKER strate proteins. Three classes of enzymes Quantity: 20 µg AEISMLEGAVLDIRYGVSRIAYSKDFETLKVD are involved in the process of ubiquityla- FLSKLPEMLKMFEDRLCHKTYLNGDHVTHP tion; activating enzymes (E1s), conjugating Concentration: 1 mg/ml DFMLYDALDVVLYMDPMCLDAFPKLVCFK enzymes (E2s) and protein ligases (E3s). KRIEAIPQIDKYLKSSKYIAWPLQGWQATFG UBE2A is a member of the E2 conjugating Formulation: 50 mM HEPES pH 7.5, GGDHPPKSDLEVLFQGPLGSPNSRVDSTPAR enzyme family and cloning of the human 150 mM sodium chloride, 2 mM RRLMRDFKRLQEDPPAGVSGAPSENNIMVW gene was first described by Koken et al. dithiothreitol, 10% glycerol NAVIFGPEGTPFEDGTFKLTIEFTEEYPNKPPT (1991). UBE2A shares 70% identity with VRFVSKMFHPNVYADGSICLDILQNRWSPTYD its yeast homologue but lacks the acidic c- Molecular Weight: ~45 kDa VSSILTSIQSLLDEPNPNSPANSQAAQLYQENK terminal domain. The ring finger proteins REYEKRVSAIVEQSWRDC RAD5 and RAD18 interact with UBE2A and Purity: >98% by InstantBlue™ SDS-PAGE Tag (bold text): N-terminal glutathione-S-transferase (GST) other members of the RAD6 pathway (Ul- Protease cleavage site: PreScission™ (LEVLFQtGP) rich and Jentsch, 2000). Phosphorylation of Stability/Storage: 12 months at -70˚C; UBE2A (regular text): Start bold italics (amino acid UBE2A by CDK1 and 2 increases its activ- aliquot as required residues 2-152) Accession number: NP_003327 ity during the G2/M phase of the cell cycle (Sarcevic et al., 2002).
    [Show full text]
  • Specific Complex Formation Between Yeast RAD6 and RAD 18 Proteins: a Potential Mechanism for Targeting RAD6 Ubiquitin-Conjugating Activity to DNA Damage Sites
    Downloaded from genesdev.cshlp.org on September 28, 2021 - Published by Cold Spring Harbor Laboratory Press Specific complex formation between yeast RAD6 and RAD 18 proteins: a potential mechanism for targeting RAD6 ubiquitin-conjugating activity to DNA damage sites V6ronique Bailly, 1,3 John Lamb, 1'4 Patrick Sung, 2'3 Satya Prakash, 2"3 and Louise Prakash 1'3's 1Department of Biophysics and 2Department of Biology, University of Rochester, Rochester, New York 14642 USA; 3Sealy Center for Molecular Science, University of Texas Medical Branch, Galveston, Texas 77555-1061 USA The RAD6 gene of Saccharomyces cerevisiae encodes a ubiquitin-conjugating enzyme that is required for postreplication repair of UV-damaged DNA, DNA damage induced mutagenesis, sporulation, and amino-end rule protein degradation. RAD6 interacts physically with the UBR1 gene product in carrying out the multiubiquitination of amino-end rule proteolytic substrates. In mediating postreplication repair, it has remained unclear whether RAD6 acts in a pleiotropic manner distal from the site of DNA damage or is targeted to the damage site via interaction with another repair component. Here, we show that RAD6 forms a specific complex with the product of the DNA repair gene RAD18. The biological significance of this interaction is attested by the observation that overproduction of the rad6 Ala-88 mutant protein, which lacks ubiquitin-conjugating activity but retains the ability to interact with RAD18 protein, confers a high level of UV sensitivity on wild-type PAD + cells that can be corrected by the concomitant overexpression of RAD18. We demonstrate that whereas RAD6 has no affinity for DNA, RAD18 binds single-stranded DNA.
    [Show full text]
  • Rad18 and Rnf8 Facilitate Homologous Recombination by Two Distinct Mechanisms, Promoting Rad51 Focus Formation and Suppressing T
    Oncogene (2015) 34, 4403–4411 © 2015 Macmillan Publishers Limited All rights reserved 0950-9232/15 www.nature.com/onc ORIGINAL ARTICLE Rad18 and Rnf8 facilitate homologous recombination by two distinct mechanisms, promoting Rad51 focus formation and suppressing the toxic effect of nonhomologous end joining S Kobayashi1, Y Kasaishi1, S Nakada2,5, T Takagi3, S Era1, A Motegi1, RK Chiu4, S Takeda1 and K Hirota1,3 The E2 ubiquitin conjugating enzyme Ubc13 and the E3 ubiquitin ligases Rad18 and Rnf8 promote homologous recombination (HR)-mediated double-strand break (DSB) repair by enhancing polymerization of the Rad51 recombinase at γ-ray-induced DSB sites. To analyze functional interactions between the three enzymes, we created RAD18−/−, RNF8−/−, RAD18−/−/RNF8−/− and UBC13−/− clones in chicken DT40 cells. To assess the capability of HR, we measured the cellular sensitivity to camptothecin (topoisomerase I poison) and olaparib (poly(ADP ribose)polymerase inhibitor) because these chemotherapeutic agents induce DSBs during DNA replication, which are repaired exclusively by HR. RAD18−/−, RNF8−/− and RAD18−/−/RNF8−/− clones showed very similar levels of hypersensitivity, indicating that Rad18 and Rnf8 operate in the same pathway in the promotion of HR. Although these three mutants show less prominent defects in the formation of Rad51 foci than UBC13−/−cells, they are more sensitive to camptothecin and olaparib than UBC13−/−cells. Thus, Rad18 and Rnf8 promote HR-dependent repair in a manner distinct from Ubc13. Remarkably, deletion of Ku70, a protein essential for nonhomologous end joining (NHEJ) significantly restored tolerance of RAD18−/− and RNF8−/− cells to camptothecin and olaparib without affecting Rad51 focus formation. Thus, in cellular tolerance to the chemotherapeutic agents, the two enzymes collaboratively promote DSB repair by HR by suppressing the toxic effect of NHEJ on HR rather than enhancing Rad51 focus formation.
    [Show full text]
  • Pathway Entry Into the T Lymphocyte Developmental Molecular Dissection of Prethymic Progenitor
    The Journal of Immunology Molecular Dissection of Prethymic Progenitor Entry into the T Lymphocyte Developmental Pathway1 C. Chace Tydell,2 Elizabeth-Sharon David-Fung,2,3 Jonathan E. Moore, Lee Rowen,4 Tom Taghon,5 and Ellen V. Rothenberg6 Notch signaling activates T lineage differentiation from hemopoietic progenitors, but relatively few regulators that initiate this program have been identified, e.g., GATA3 and T cell factor-1 (TCF-1) (gene name Tcf7). To identify additional regulators of T cell specification, a cDNA library from mouse Pro-T cells was screened for genes that are specifically up-regulated in intrathymic T cell precursors as compared with myeloid progenitors. Over 90 genes of interest were iden- tified, and 35 of 44 tested were confirmed to be more highly expressed in T lineage precursors relative to precursors of B and/or myeloid lineage. To a remarkable extent, however, expression of these T lineage-enriched genes, including zinc finger transcription factor, helicase, and signaling adaptor genes, was also shared by stem cells (Lin؊Sca-1؉Kit؉CD27؊) and multipotent progenitors (Lin؊Sca-1؉Kit؉CD27؉), although down-regulated in other lineages. Thus, a major fraction of these early T lineage genes are a regulatory legacy from stem cells. The few genes sharply up-regulated between multipotent progenitors and Pro-T cell stages included those encoding transcription factors Bcl11b, TCF-1 (Tcf7), and HEBalt, Notch target Deltex1, Deltex3L, Fkbp5, Eva1, and Tmem131. Like GATA3 and Deltex1, Bcl11b, Fkbp5, and Eva1 were dependent on Notch/Delta signaling for induction in fetal liver precursors, but only Bcl11b and HEBalt were up-regulated between the first two stages of intrathymic T cell development (double negative 1 and double negative 2) corresponding to T lineage specification.
    [Show full text]
  • UBE2B (HR6B) [GST-Tagged] E2 – Ubiquitin Conjugating Enzyme
    UBE2B (HR6B) [GST-tagged] E2 – Ubiquitin Conjugating Enzyme Alternate Names: HHR6B, HR6B, RAD6B, Ubiquitin carrier protein B, Ubiquitin protein ligase B Cat. No. 62-0003-020 Quantity: 20 µg Lot. No. 1385 Storage: -70˚C FOR RESEARCH USE ONLY NOT FOR USE IN HUMANS CERTIFICATE OF ANALYSIS Background Physical Characteristics The enzymes of the ubiquitylation pathway Species: human Protein Sequence: play a pivotal role in a number of cellular MSPILGYWKIKGLVQPTRLLLEYLEEKYEEH processes including regulated and targeted Source: E. coli expression LYERDEGDKWRNKKFELGLEFPNLPYYIDGD proteosomal degradation of substrate pro- VKLTQSMAIIRYIADKHNMLGGCPKER teins. Three classes of enzymes are involved Quantity: 20 µg AEISMLEGAVLDIRYGVSRIAYSKDFETLKVD in the process of ubiquitylation; activat- FLSKLPEMLKMFEDRLCHKTYLNGDH ing enzymes (E1s), conjugating enzymes Concentration: 1 mg/ml VTHPDFMLYDALDVVLYMDPMCLDAFP (E2s) and protein ligases (E3s). UBE2B is a KLVCFKKRIEAIPQIDKYLKSSKYIAWPLQG member of the E2 ubiquitin-conjugating Formulation: 50 mM HEPES pH 7.5, WQATFGGGDHPPKSDLEVLFQGPLGSSTPAR enzyme family and cloning of the human 150 mM sodium chloride, 2 mM RRLMRDFKRLQEDPPVGVSGAPSENNIMQW gene was first described by Koken et al. dithiothreitol, 10% glycerol NAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPT (1991). UBE2B shares 70% identity with VRFLSKMFHPNVYADGSICLDILQNRWSPTYD its yeast homologue but lacks the acidic c- Molecular Weight: ~44 kDa VSSILTSIQSLLDEPNPNSPANSQAAQLYQENK terminal domain. The ring finger proteins REYEKRVSAIVEQSWNDS RAD5 and RAD18 interact with UBE2B and Purity: >98% by InstantBlue™ SDS-PAGE other members of the RAD6 pathway (No- Tag (bold text): N-terminal glutathione-S-transferase (GST) Protease cleavage site: PreScission™ (LEVLFQtGP) tenboom et al., 2007; Ulrich and Jentsch, Stability/Storage: 12 months at -70˚C; UBE2B (regular text): Start bold italics (amino acid 2000). In complex UBE2B and RAD18 trig- aliquot as required residues 2-152) ger replication fork stalling at DNA damage Accession number: NP_003328 sites during the post replicative repair pro- cess (Tsuji et al., 2008).
    [Show full text]