DOCSLIB.ORG

Mco1175545256.Pdf (2.73

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Mco1175545256.Pdf (2.73 Health Science Campus FINAL APPROVAL OF DISSERTATION Doctor of Philosophy in Biomedical Sciences Genetic Dissection of Hypertension Related Renal Disease Using the Dahl Salt-Sensitive Rat Submitted by: Michael R. Garrett In partial fulfillment of the requirements for the degree of Doctor of Philosophy in Biomedical Sciences Examination Committee Major Advisor: Joseph Shapiro, M.D. Academic Advisory Committee: David Allison, M.D., Ph.D. Richard J. Roman, Ph.D. En-Bing Lin, Ph.D. Deepak Malhotra, M.D., Ph.D. Senior Associate Dean College of Graduate Studies Michael S. Bisesi, Ph.D. Date of Defense: September 7, 2006 Genetic Dissection of Hypertension-Related Renal Disease Using the Dahl Salt-Sensitive Rat Michael R. Garrett University of Toledo 2006 ii DEDICATION I dedicate this thesis to my wife, Jean and my two sons, Noah and Parker. This work is not solely a personal achievement but a testament of their love, support, encouragement, and understanding. Thank you. iii ACKNOWLEDGEMENTS I wish to thank the many people who have helped me not only learn about research, but also more importantly what it means to be a scientist. In particular, I wish to acknowledge John P. Rapp, D.V.M., Ph.D. for his guidance, support and encouragement. I would like to thank my major advisor, Joseph Shapiro, M.D., for giving me the opportunity to work under his supervision and my other graduate committee members, David Allison, M.D., Ph.D., Deepak Malhotra, M.D., Ph.D., Richard Roman, Ph.D., and En-Bing Lin, Ph.D. for their time and support. I appreciate the guidance and encouragement provided by Sonia Najjar, Ph.D., Director of the Molecular Basis of Disease (MBD) program. I especially wish to thank Shane Yerga-Woolwine for his contributions to my work. His involvement in taking blood pressure measurements and genotyping is sincerely appreciated. I thank Tracy Radecki for her help in phenotyping congenic strains and Kris Farms for her help in maintaining the rat colony. I thank Howard Dene, Ph.D. for his involvement with blood pressure measurements and statistical calculations. The expertise of William Gunning, Ph.D. in light and electron microscopy is appreciated. Finally, I wish to thank Bina Joe, Ph.D. and Yasser Saad, Ph.D. for their helpful discussions and interest in my work. iv TABLE OF CONTENTS Dedication………………………………………………………………………………ii Acknowledgments……………………………………………………………………...iii Table of Contents………………………………………………………………………iv Introduction……………………………………………………………………………..1 Literature………………………………………………………………………………..4 Manuscript 1: Time-Course Genetic Analysis of Albuminuria in Dahl Salt-Sensitive Rats on Low Salt Diet………………………………………………….56 Manuscript 2: Genetic Linkage of Urinary Albumin Excretion in Dahl Salt-Sensitive Rats: Influence of Dietary Salt and Confirmation using Congenic Strains……………………………………………………….96 Manuscript 3 Dissection of a Genetic Locus Influencing Renal Function in the Rat and its Concordance with Kidney Disease Loci on Human Chromosome 1q21…………………………………………………….132 Summary………………………………………………………………………………193 Bibliography…………………………………………………………………………..198 Abstract………………………………………………………………………………..234 1 INTRODUCTION Chronic kidney disease (CKD) is an important healthcare problem with increasing incidence and prevalence worldwide (United States Renal Data System 2005). Chronic kidney disease is characterized by a gradual decline in kidney function and can culminate in end stage renal disease (ESRD) requiring expensive treatments of dialysis and renal transplantation (USRDS 2005). Most CKD cases are not associated with primary renal disease, but with systemic conditions like diabetes and hypertension. In fact, diabetes and hypertension account for about two-thirds of patients that progress to ESRD. Additionally, age, gender, race/ethnicity, and socioeconomic factors play a role in the onset and progression of the disease (Agodoa et al. 2005; Norris and Agodoa 2005). Analysis involving familial aggregation studies, comparison of incidence between different racial and ethnic populations, and linkage analysis have provided strong evidence that CKD is, in part, genetically determined (Bowden 2003). Genetic analysis of congenital and familial forms of kidney disease has led to the identification of genes required for proper functioning of the glomerular filtration barrier (Chow et al. 2005). While these studies have provided insight into mechanisms of proteinuria and glomerulosclerosis, they have not helped to explain common causes of kidney disease. A number of genetic analyses have been performed to identify genes involved in diabetes and hypertension related ESRD (Bowden et al. 2004; DeWan et al. 2001; Freedman et al. 2003, 2004). Hundreds of these studies have utilized the candidate gene approach, while only a handful have utilized the more systemic whole genome scan approach to identify genes involved in kidney disease (Bowden 2003). These genome scans have identified 2 many genomic regions linked to ESRD, but none have culminated in gene identification. One reason is that the linkage analysis in humans suffer from several limitations that inherently make the process of gene identification difficult (Schork 1997). While some problems can be overcome with proper experimental design, an alternative approach is to utilize animal models of CKD (Jacob and Kwitek 2002). The rat provides a particularly fertile model to study disease and there are many well-defined inbred rat strains currently being used to study the genetics of CKD (Korstanje and DiPetrillo 2004). In particular, the Dahl salt-sensitive rat (S) was selectively bred as a model to study the genetics of salt-sensitive hypertension (Dahl et al. 1962; Rapp and Dene 1985). The S rat also has a unique early onset and marked propensity to develop proteinuria, glomerulosclerosis and progressive renal damage (Hampton et al. 1989; Sterzel et al. 1988). In contrast, the spontaneously hypertensive rat (SHR) is exactly opposite with regard to renal pathology. SHR have minimal proteinuria and a pronounced resistance to development of renal lesions in spite of their hypertension (Feld et al. 1977; Karlsen et al. 1997). In order to understand the genetic causes of ESRD, the focus of this work is to define the genetic components responsible for the development of the rapidly progressing renal pathology in the S rat. The assumption (as with all models of human disease) is that knowledge gained using an animal model will foster understanding and treatment of human disease. The aim of manuscript 1 was to conduct a genetic analysis of renal and cardiovascular traits using the S and SHR. Linkage analysis identified quantitative trait loci (QTL) on multiple chromosomes (1, 2, 6, 8, 9, 10, 11, 13, and 19) for urinary protein 3 excretion (UPE) and/or urinary albumin excretion (UAE) with variable time-course patterns. Manuscript 2 sought to perform a second linkage analysis to determine if QTL for UPE and/or UAE would be influenced by salt-loading either by altering the time-course pattern of known QTL or by identifying QTL that were not detected on low-salt. A second aim was to perform congenic strain analysis for several UPE and/or UAE QTL to confirm the linkage analysis (on rat chromosomes 2 6, 9, 11, and 13) and to demonstrate the magnitude of the effect of each QTL once isolated on the S background. The objective of manuscript 3 was to characterize the chromosome 2 congenic strain [S.SHR(2)] by conducting a time-course analysis and establishing onset and progression of renal disease in comparison to both parental strains. A comprehensive approach was employed that examined several renal parameters, histology, electron microscopy, gene expression analysis, and gene pathway analysis to characterize the strain. A second aim was to employ recombinant progeny testing (RPT) to reduce the QTL to a small genomic region to aid in gene identification. 4 LITERATURE Physiology of Kidney Disease Overview of Normal Kidney Physiology The kidney is an important organ involved in eliminating waste products produced by metabolism, such as urea (from protein), uric acid (from nucleic acid), and creatinine (from muscle creatine). Just as important, the kidney plays a role in regulating water and electrolyte balance, acid-base balance (pH), and the secretion of hormones that participate in the regulation of systemic and renal hemodynamics, red blood cell production, and mineral metabolism (Berne 2004). The kidney's ability to perform many of its functions depends on the three fundamental roles: (1) filtration, (2) reabsorption, and (3) secretion. Figure 1 shows a schematic drawing of the functional unit of the kidney, the nephron. Each nephron is composed of a renal corpuscle and a tubule extending from the renal corpuscle. The renal corpuscle contains a compact group of interconnected capillary loops, called the glomerulus and is surrounded by a hollow capsule known as the Bowman’s capsule. The glomerulus filters out large solutes from the blood (cells, proteins, and other large molecules), delivering water and small solutes (glucose, salt, amino acids, and urea) to the renal tubule and ultimately producing urine. The renal tubule consists of different 5 segments, the proximal tubule, the loop of Henle, and the distal tubule, each of which performs unique functions involved in reabsorption and secretion. Figure 1. Nephron Structure A simple diagram of a nephron illustrating its major structural components. The nephron is composed of a renal corpuscle, including the glomerulus and Bowman’s capsule and a
Load more

Recommended publications
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet
    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
    [Show full text]
  • Post-Mortem Whole-Exome Analysis in a Large Sudden Infant Death Syndrome Cohort with a Focus on Cardiovascular and Metabolic Genetic Diseases
    European Journal of Human Genetics (2017) 25, 404–409 & 2017 Macmillan Publishers Limited, part of Springer Nature. All rights reserved 1018-4813/17 www.nature.com/ejhg ARTICLE Post-mortem whole-exome analysis in a large sudden infant death syndrome cohort with a focus on cardiovascular and metabolic genetic diseases Jacqueline Neubauer*,1, Maria Rita Lecca2, Giancarlo Russo2, Christine Bartsch3, Argelia Medeiros-Domingo4, Wolfgang Berger5,6,7 and Cordula Haas1 Sudden infant death syndrome (SIDS) is described as the sudden and unexplained death of an apparently healthy infant younger than one year of age. Genetic studies indicate that up to 35% of SIDS cases might be explained by familial or genetic diseases such as cardiomyopathies, ion channelopathies or metabolic disorders that remained undetected during conventional forensic autopsy procedures. Post-mortem genetic testing by using massive parallel sequencing (MPS) approaches represents an efficient and rapid tool to further investigate unexplained death cases and might help to elucidate pathogenic genetic variants and mechanisms in cases without a conclusive cause of death. In this study, we performed whole-exome sequencing (WES) in 161 European SIDS infants with focus on 192 genes associated with cardiovascular and metabolic diseases. Potentially causative variants were detected in 20% of the SIDS cases. The majority of infants had variants with likely functional effects in genes associated with channelopathies (9%), followed by cardiomyopathies (7%) and metabolic diseases (1%). Although lethal arrhythmia represents the most plausible and likely cause of death, the majority of SIDS cases still remains elusive and might be explained by a multifactorial etiology, triggered by a combination of different genetic and environmental risk factors.
    [Show full text]
  • Versican V2 Assembles the Extracellular Matrix Surrounding the Nodes of Ranvier in the CNS
    The Journal of Neuroscience, June 17, 2009 • 29(24):7731–7742 • 7731 Cellular/Molecular Versican V2 Assembles the Extracellular Matrix Surrounding the Nodes of Ranvier in the CNS María T. Dours-Zimmermann,1 Konrad Maurer,2 Uwe Rauch,3 Wilhelm Stoffel,4 Reinhard Fa¨ssler,5 and Dieter R. Zimmermann1 Institutes of 1Surgical Pathology and 2Anesthesiology, University Hospital Zurich, CH-8091 Zurich, Switzerland, 3Vascular Wall Biology, Department of Experimental Medical Science, University of Lund, S-221 00 Lund, Sweden, 4Center for Biochemistry, Medical Faculty, University of Cologne, D-50931 Cologne, Germany, and 5Department of Molecular Medicine, Max Planck Institute of Biochemistry, D-82152 Martinsried, Germany The CNS-restricted versican splice-variant V2 is a large chondroitin sulfate proteoglycan incorporated in the extracellular matrix sur- rounding myelinated fibers and particularly accumulating at nodes of Ranvier. In vitro, it is a potent inhibitor of axonal growth and therefore considered to participate in the reduction of structural plasticity connected to myelination. To study the role of versican V2 during postnatal development, we designed a novel isoform-specific gene inactivation approach circumventing early embryonic lethality of the complete knock-out and preventing compensation by the remaining versican splice variants. These mice are viable and fertile; however, they display major molecular alterations at the nodes of Ranvier. While the clustering of nodal sodium channels and paranodal structures appear in versican V2-deficient mice unaffected, the formation of the extracellular matrix surrounding the nodes is largely impaired. The conjoint loss of tenascin-R and phosphacan from the perinodal matrix provide strong evidence that versican V2, possibly controlled by a nodal receptor, organizes the extracellular matrix assembly in vivo.
    [Show full text]
  • Seq2pathway Vignette
    seq2pathway Vignette Bin Wang, Xinan Holly Yang, Arjun Kinstlick May 19, 2021 Contents 1 Abstract 1 2 Package Installation 2 3 runseq2pathway 2 4 Two main functions 3 4.1 seq2gene . .3 4.1.1 seq2gene flowchart . .3 4.1.2 runseq2gene inputs/parameters . .5 4.1.3 runseq2gene outputs . .8 4.2 gene2pathway . 10 4.2.1 gene2pathway flowchart . 11 4.2.2 gene2pathway test inputs/parameters . 11 4.2.3 gene2pathway test outputs . 12 5 Examples 13 5.1 ChIP-seq data analysis . 13 5.1.1 Map ChIP-seq enriched peaks to genes using runseq2gene .................... 13 5.1.2 Discover enriched GO terms using gene2pathway_test with gene scores . 15 5.1.3 Discover enriched GO terms using Fisher's Exact test without gene scores . 17 5.1.4 Add description for genes . 20 5.2 RNA-seq data analysis . 20 6 R environment session 23 1 Abstract Seq2pathway is a novel computational tool to analyze functional gene-sets (including signaling pathways) using variable next-generation sequencing data[1]. Integral to this tool are the \seq2gene" and \gene2pathway" components in series that infer a quantitative pathway-level profile for each sample. The seq2gene function assigns phenotype-associated significance of genomic regions to gene-level scores, where the significance could be p-values of SNPs or point mutations, protein-binding affinity, or transcriptional expression level. The seq2gene function has the feasibility to assign non-exon regions to a range of neighboring genes besides the nearest one, thus facilitating the study of functional non-coding elements[2]. Then the gene2pathway summarizes gene-level measurements to pathway-level scores, comparing the quantity of significance for gene members within a pathway with those outside a pathway.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Cardiomyopathy
    UNIVERSITY OF MINNESOTA PHYSICIANS OUTREACH LABS Submit this form along with the appropriate MOLECULAR DIAGNOSTICS (612) 273-8445 Molecular requisition (Molecular Diagnostics or DATE: TIME COLLECTED: PCU/CLINIC: Molecular NGS Oncology). AM PM PATIENT IDENTIFICATION DIAGNOSIS (Dx) / DIAGNOSIS CODES (ICD-9) - OUTPATIENTS ONLY SPECIMEN TYPE: o Blood (1) (2) (3) (4) PLEASE COLLECT 5-10CC IN ACD-A OR EDTA TUBE ORDERING PHYSICIAN NAME AND PHONE NUMBER: Tests can be ordered as a full panel, or by individual gene(s). Please contact the genetic counselor with any questions at 612-624-8948 or by pager at 612-899-3291. _______________________________________________ Test Ordered- EPIC: Next generation sequencing(Next Gen) Sunquest: NGS Brugada syndrome DMD Aortopathy Full panel DNAJC19 SCN5A DSP Full panel GPD1L Cardiomyopathy, familial MYH11 CACNA1C hypertrophic ACTA2 SCN1B Full panel MYLK KCNE3 ANKRD1 FBN2 SCN3B JPH2 SLC2A10 HCN4 PRKAG2 COL5A2 MYH7 COL5A1 MYL2 COL3A1 Cardiomyopathy ACTC1 CBS Cardiomyopathy, dilated CSRP3 SMAD3 Full panel TNNC1 TGFBR1 LDB3 MYH6 TGFBR2 LMNA VCL FBN1 ACTN2 MYOZ2 Arrhythmogenic right ventricular DSG2 PLN dysplasia NEXN CALR3 TNNT2 TNNT2 NEXN Full panel RBM20 TPM1 TGFB3 SCN5A MYBPC3 DSG2 MYH6 TNNI3 DSC2 TNNI3 MYL3 JUP TTN TTN RYR2 BAG3 MYLK2 TMEM43 DES Cardiomyopathy, familial DSP CRYAB EYA4 restrictive PKP2 Full panel Atrial fibrillation LAMA4 MYPN TNNI3 SGCD MYPN TNNT2 Full panel CSRP3 SCN5A MYBPC3 GJA5 TCAP ABCC9 ABCC9 SCN1B PLN SCN2B ACTC1 KCNQ1 MYH7 KCNE2 TMPO NPPA VCL NPPA TPM1 KCNA5 TNNC1 KCNJ2 GATAD1 4/1/2014
    [Show full text]
  • Minding the Calcium Store: Ryanodine Receptor Activation As a Convergent Mechanism of PCB Toxicity
    Pharmacology & Therapeutics 125 (2010) 260–285 Contents lists available at ScienceDirect Pharmacology & Therapeutics journal homepage: www.elsevier.com/locate/pharmthera Associate Editor: Carey Pope Minding the calcium store: Ryanodine receptor activation as a convergent mechanism of PCB toxicity Isaac N. Pessah ⁎, Gennady Cherednichenko, Pamela J. Lein Department of Molecular Biosciences, School of Veterinary Medicine, University of California, Davis, CA 95616, USA article info abstract Keywords: Chronic low-level polychlorinated biphenyl (PCB) exposures remain a significant public health concern since Ryanodine receptor (RyR) results from epidemiological studies indicate that PCB burden is associated with immune system Calcium-induced calcium release dysfunction, cardiovascular disease, and impairment of the developing nervous system. Of these various Calcium regulation adverse health effects, developmental neurotoxicity has emerged as a particularly vulnerable endpoint in Polychlorinated biphenyls PCB toxicity. Arguably the most pervasive biological effects of PCBs could be mediated by their ability to alter Triclosan fi 2+ Bastadins the spatial and temporal delity of Ca signals through one or more receptor-mediated processes. This Polybrominated diphenylethers review will focus on our current knowledge of the structure and function of ryanodine receptors (RyRs) in Developmental neurotoxicity muscle and nerve cells and how PCBs and related non-coplanar structures alter these functions. The Activity dependent plasticity molecular and cellular mechanisms by which non-coplanar PCBs and related structures alter local and global Ca2+ signaling properties and the possible short and long-term consequences of these perturbations on neurodevelopment and neurodegeneration are reviewed. © 2009 Elsevier Inc. All rights reserved. Contents 1. Introduction ............................................... 260 2. Ryanodine receptor macromolecular complexes: significance to polychlorinated biphenyl-mediated Ca2+ dysregulation .
    [Show full text]
  • Next Generation Sequencing for Molecular Confirmation of Hereditary
    Arch Cardiol Mex. 2015;85(1):68---72 www.elsevier.com.mx SPECIAL ARTICLE Next generation sequencing for molecular confirmation of hereditary sudden cardiac death syndromes a,∗ b b b Manlio F. Márquez , David Cruz-Robles , Selene Ines-Real , Gilberto Vargas-Alarcón , a Manuel Cárdenas a Departamento de Electrofisiología, Instituto Nacional de Cardiología Ignacio Chávez, México, D.F., Mexico b Departamento de Biología Molecular, Instituto Nacional de Cardiología Ignacio Chávez, México, D.F., Mexico Received 26 March 2014; accepted 8 December 2014 KEYWORDS Abstract Hereditary sudden cardiac death syndromes comprise a wide range of diseases result- Arrhythmias; ing from alteration in cardiac ion channels. Genes involved in these syndromes represent diverse Hereditary sudden mutations that cause the altered encoding of the diverse proteins constituting these channels, cardiac death thus affecting directly the currents of the corresponding ions. In the present article we will syndromes; briefly review how to arrive to a clinical diagnosis and we will present the results of molecular Right ventricle genetic studies made in Mexican subjects attending the SCD Syndromes Clinic of the National arrhythmogenic Institute of Cardiology of Mexico City. cardiomyopathy; © 2014 Instituto Nacional de Cardiología Ignacio Chávez. Published by Masson Doyma México Brugada syndrome S.A. All rights reserved. PALABRAS CLAVE Confirmación diagnóstica molecular mediante secuenciación masiva de nueva Arritmias; generación (‘‘next generation sequencing’’) en síndromes hereditarios de muerte Síndromes súbita cardíaca hereditarios de Resumen Los síndromes hereditarios de muerte súbita cardíaca comprenden una amplia gama muerte súbita; Displasia de enfermedades resultantes de la alteración en los canales iónicos cardíacos. Los genes implicados en estos síndromes presentan mutaciones que causan alteraciones de las diversas Arritmogénica del proteínas que constituyen estos canales y que, por lo tanto, afectan directamente a las difer- ventriculo derecho; entes corrientes iónicas.
    [Show full text]
  • Supplementary Table 1: Adhesion Genes Data Set
    Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
    [Show full text]
  • Non-Coding Rnas in the Cardiac Action Potential and Their Impact on Arrhythmogenic Cardiac Diseases
    Review Non-Coding RNAs in the Cardiac Action Potential and Their Impact on Arrhythmogenic Cardiac Diseases Estefania Lozano-Velasco 1,2 , Amelia Aranega 1,2 and Diego Franco 1,2,* 1 Cardiovascular Development Group, Department of Experimental Biology, University of Jaén, 23071 Jaén, Spain; [email protected] (E.L.-V.); [email protected] (A.A.) 2 Fundación Medina, 18016 Granada, Spain * Correspondence: [email protected] Abstract: Cardiac arrhythmias are prevalent among humans across all age ranges, affecting millions of people worldwide. While cardiac arrhythmias vary widely in their clinical presentation, they possess shared complex electrophysiologic properties at cellular level that have not been fully studied. Over the last decade, our current understanding of the functional roles of non-coding RNAs have progressively increased. microRNAs represent the most studied type of small ncRNAs and it has been demonstrated that miRNAs play essential roles in multiple biological contexts, including normal development and diseases. In this review, we provide a comprehensive analysis of the functional contribution of non-coding RNAs, primarily microRNAs, to the normal configuration of the cardiac action potential, as well as their association to distinct types of arrhythmogenic cardiac diseases. Keywords: cardiac arrhythmia; microRNAs; lncRNAs; cardiac action potential Citation: Lozano-Velasco, E.; Aranega, A.; Franco, D. Non-Coding RNAs in the Cardiac Action Potential 1. The Electrical Components of the Adult Heart and Their Impact on Arrhythmogenic The adult heart is a four-chambered organ that propels oxygenated blood to the entire Cardiac Diseases. Hearts 2021, 2, body. It is composed of atrial and ventricular chambers, each of them with distinct left and 307–330.
    [Show full text]
  • New Developments in Charcot–Marie–Tooth Neuropathy and Related Diseases
    CE: Alpana; WCO 300505; Total nos of Pages: 10; WCO 300505 REVIEW CURRENT OPINION New developments in Charcot–Marie–Tooth neuropathy and related diseases Davide Pareyson, Paola Saveri, and Chiara Pisciotta Purpose of review Charcot–Marie–Tooth disease (CMT) and related neuropathies represent a heterogeneous group of hereditary disorders. The present review will discuss the most recent advances in the field. Recent findings Knowledge of CMT epidemiology and frequency of the main associated genes is increasing, with an overall prevalence estimated at 10–28/100 000. In the last years, the huge number of newly uncovered genes, thanks to next-generation sequencing techniques, is challenging the current classification of CMT. During the last 18 months other genes have been associated with CMT, such as PMP2, MORC2, NEFH, MME, and DGAT2. For the most common forms of CMT, numerous promising compounds are under study in cellular and animal models, mainly targeting either the protein degradation pathway or the protein overexpression. Consequently, efforts are devoted to develop responsive outcome measures and biomarkers for this overall slowly progressive disorder, with quantitative muscle MRI resulting the most sensitive-to-change measure. Summary This is a rapidly evolving field where better understanding of pathophysiology is paving the way to develop potentially effective treatments, part of which will soon be tested in patients. Intense research is currently devoted to prepare clinical trials and develop responsive outcome measures. Keywords
    [Show full text]
  • X-Linked Diseases: Susceptible Females
    REVIEW ARTICLE X-linked diseases: susceptible females Barbara R. Migeon, MD 1 The role of X-inactivation is often ignored as a prime cause of sex data include reasons why women are often protected from the differences in disease. Yet, the way males and females express their deleterious variants carried on their X chromosome, and the factors X-linked genes has a major role in the dissimilar phenotypes that that render women susceptible in some instances. underlie many rare and common disorders, such as intellectual deficiency, epilepsy, congenital abnormalities, and diseases of the Genetics in Medicine (2020) 22:1156–1174; https://doi.org/10.1038/s41436- heart, blood, skin, muscle, and bones. Summarized here are many 020-0779-4 examples of the different presentations in males and females. Other INTRODUCTION SEX DIFFERENCES ARE DUE TO X-INACTIVATION Sex differences in human disease are usually attributed to The sex differences in the effect of X-linked pathologic variants sex specific life experiences, and sex hormones that is due to our method of X chromosome dosage compensation, influence the function of susceptible genes throughout the called X-inactivation;9 humans and most placental mammals – genome.1 5 Such factors do account for some dissimilarities. compensate for the sex difference in number of X chromosomes However, a major cause of sex-determined expression of (that is, XX females versus XY males) by transcribing only one disease has to do with differences in how males and females of the two female X chromosomes. X-inactivation silences all X transcribe their gene-rich human X chromosomes, which is chromosomes but one; therefore, both males and females have a often underappreciated as a cause of sex differences in single active X.10,11 disease.6 Males are the usual ones affected by X-linked For 46 XY males, that X is the only one they have; it always pathogenic variants.6 Females are biologically superior; a comes from their mother, as fathers contribute their Y female usually has no disease, or much less severe disease chromosome.
    [Show full text]