Circulating Microrna-122 Is Associated with the Risk of New-Onset Metabolic Syndrome and Type-2-Diabetes Online Appendix
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
Investigation of the Underlying Hub Genes and Molexular Pathogensis in Gastric Cancer by Integrated Bioinformatic Analyses
bioRxiv preprint doi: https://doi.org/10.1101/2020.12.20.423656; this version posted December 22, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Investigation of the underlying hub genes and molexular pathogensis in gastric cancer by integrated bioinformatic analyses Basavaraj Vastrad1, Chanabasayya Vastrad*2 1. Department of Biochemistry, Basaveshwar College of Pharmacy, Gadag, Karnataka 582103, India. 2. Biostatistics and Bioinformatics, Chanabasava Nilaya, Bharthinagar, Dharwad 580001, Karanataka, India. * Chanabasayya Vastrad [email protected] Ph: +919480073398 Chanabasava Nilaya, Bharthinagar, Dharwad 580001 , Karanataka, India bioRxiv preprint doi: https://doi.org/10.1101/2020.12.20.423656; this version posted December 22, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract The high mortality rate of gastric cancer (GC) is in part due to the absence of initial disclosure of its biomarkers. The recognition of important genes associated in GC is therefore recommended to advance clinical prognosis, diagnosis and and treatment outcomes. The current investigation used the microarray dataset GSE113255 RNA seq data from the Gene Expression Omnibus database to diagnose differentially expressed genes (DEGs). Pathway and gene ontology enrichment analyses were performed, and a proteinprotein interaction network, modules, target genes - miRNA regulatory network and target genes - TF regulatory network were constructed and analyzed. Finally, validation of hub genes was performed. The 1008 DEGs identified consisted of 505 up regulated genes and 503 down regulated genes. -
A Chemical Proteomic Approach to Investigate Rab Prenylation in Living Systems
A chemical proteomic approach to investigate Rab prenylation in living systems By Alexandra Fay Helen Berry A thesis submitted to Imperial College London in candidature for the degree of Doctor of Philosophy of Imperial College. Department of Chemistry Imperial College London Exhibition Road London SW7 2AZ August 2012 Declaration of Originality I, Alexandra Fay Helen Berry, hereby declare that this thesis, and all the work presented in it, is my own and that it has been generated by me as the result of my own original research, unless otherwise stated. 2 Abstract Protein prenylation is an important post-translational modification that occurs in all eukaryotes; defects in the prenylation machinery can lead to toxicity or pathogenesis. Prenylation is the modification of a protein with a farnesyl or geranylgeranyl isoprenoid, and it facilitates protein- membrane and protein-protein interactions. Proteins of the Ras superfamily of small GTPases are almost all prenylated and of these the Rab family of proteins forms the largest group. Rab proteins are geranylgeranylated with up to two geranylgeranyl groups by the enzyme Rab geranylgeranyltransferase (RGGT). Prenylation of Rabs allows them to locate to the correct intracellular membranes and carry out their roles in vesicle trafficking. Traditional methods for probing prenylation involve the use of tritiated geranylgeranyl pyrophosphate which is hazardous, has lengthy detection times, and is insufficiently sensitive. The work described in this thesis developed systems for labelling Rabs and other geranylgeranylated proteins using a technique known as tagging-by-substrate, enabling rapid analysis of defective Rab prenylation in cells and tissues. An azide analogue of the geranylgeranyl pyrophosphate substrate of RGGT (AzGGpp) was applied for in vitro prenylation of Rabs by recombinant enzyme. -
Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase -
The Role of Stress-Derived Vesicles in the Bystander Effect and Cancer Related Cachexia
THE ROLE OF STRESS-DERIVED VESICLES IN THE BYSTANDER EFFECT AND CANCER RELATED CACHEXIA Thesis is submitted in partial fulfilment of the requirements of the award of Doctor of Philosophy FINDLAY REDVERS BEWICKE-COPLEY Department of Biological and Medical Sciences Degree awarded by Oxford Brookes University First submitted for examination: January 2018 ACKNOWLEDGEMENTS Thank you to Oxford Brookes for providing funding for my research, and especially to Professor Nigel Groome whose research and generosity has allowed so many to complete their PhDs. I would also like to say thank you to the Cancer and Polio trust for providing some of the funding for my PhD I would like to thank my Supervisors Dave and Ryan for their support throughout my PhD and for only occasionally saddling me with unrelated projects. Without your guidance and support I would have curled up into a ball in the corner of the office and gently sobbed to myself for the last 5 years. Thanks to Priya for her tireless work ensuring the lab functions correctly and supporting all other members of the lab. I’d also like to thank past members of the lab, Laura Jacobs and Laura Mulcahy for their support throughout both my MSc and my PhD. Sunny Vijen for chatting with me whilst he smoked and making me leave lunch early, so he could have another smoke before going back to work. Thank you to Robbie Crickley for all the lunch time chats. To Lia I would like to say χασμουριέμαι! Thanks to Bianca for all her help getting to know the world of immunocytochemistry. -
And Pancreatic Cancer: from the Role of Evs to the Interference with EV-Mediated Reciprocal Communication
biomedicines Review Extracellular Vesicles (EVs) and Pancreatic Cancer: From the Role of EVs to the Interference with EV-Mediated Reciprocal Communication 1, 1, 1 1 1 Sokviseth Moeng y, Seung Wan Son y, Jong Sun Lee , Han Yeoung Lee , Tae Hee Kim , Soo Young Choi 1, Hyo Jeong Kuh 2 and Jong Kook Park 1,* 1 Department of Biomedical Science and Research Institute for Bioscience & Biotechnology, Hallym University, Chunchon 24252, Korea; [email protected] (S.M.); [email protected] (S.W.S.); [email protected] (J.S.L.); [email protected] (H.Y.L.); [email protected] (T.H.K.); [email protected] (S.Y.C.) 2 Department of Medical Life Sciences, College of Medicine, The Catholic University of Korea, Seoul 06591, Korea; [email protected] * Correspondence: [email protected]; Tel.: +82-33-248-2114 These authors contributed equally. y Received: 29 June 2020; Accepted: 1 August 2020; Published: 3 August 2020 Abstract: Pancreatic cancer is malignant and the seventh leading cause of cancer-related deaths worldwide. However, chemotherapy and radiotherapy are—at most—moderately effective, indicating the need for new and different kinds of therapies to manage this disease. It has been proposed that the biologic properties of pancreatic cancer cells are finely tuned by the dynamic microenvironment, which includes extracellular matrix, cancer-associated cells, and diverse immune cells. Accumulating evidence has demonstrated that extracellular vesicles (EVs) play an essential role in communication between heterogeneous subpopulations of cells by transmitting multiplex biomolecules. EV-mediated cell–cell communication ultimately contributes to several aspects of pancreatic cancer, such as growth, angiogenesis, metastasis and therapeutic resistance. -
HBA2 Antibody Cat
HBA2 Antibody Cat. No.: 23-575 HBA2 Antibody Immunohistochemistry of paraffin-embedded mouse Immunohistochemistry of paraffin-embedded mouse heart using HBA2 antibody (23-575) at dilution of 1:100 brain using HBA2 antibody (23-575) at dilution of 1:100 (40x lens). (40x lens). Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Mouse, Rat Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of IMMUNOGEN: human HBA2 (NP_000508.1). TESTED APPLICATIONS: IHC, WB WB: ,1:500 - 1:2000 APPLICATIONS: IHC: ,1:50 - 1:100 POSITIVE CONTROL: 1) Mouse liver September 30, 2021 1 https://www.prosci-inc.com/hba2-antibody-23-575.html PREDICTED MOLECULAR Observed: 13kDa WEIGHT: Properties PURIFICATION: Affinity purification CLONALITY: Polyclonal ISOTYPE: IgG CONJUGATE: Unconjugated PHYSICAL STATE: Liquid BUFFER: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. STORAGE CONDITIONS: Store at -20˚C. Avoid freeze / thaw cycles. Additional Info OFFICIAL SYMBOL: HBA2 ALTERNATE NAMES: Hemoglobin subunit alpha, Alpha-globinHBH GENE ID: 3040 USER NOTE: Optimal dilutions for each application to be determined by the researcher. Background and References The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, BACKGROUND: which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. -
Diagnosis of Metastatic Melanoma and Monitoring Indicators of Immunosuppression Through Blood Leukocyte Microarray Analysis
(19) TZZ __T (11) EP 2 579 174 A1 (12) EUROPEAN PATENT APPLICATION (43) Date of publication: (51) Int Cl.: 10.04.2013 Bulletin 2013/15 G06F 19/00 (2011.01) (21) Application number: 12196231.0 (22) Date of filing: 03.11.2007 (84) Designated Contracting States: • Banchereau, Jacques F. AT BE BG CH CY CZ DE DK EE ES FI FR GB GR Montclair, NJ 07042 (US) HU IE IS IT LI LT LU LV MC MT NL PL PT RO SE • Chaussabel, Damien SI SK TR Bainbridge Island, WA 98110 (US) (30) Priority: 03.11.2006 US 856406 P (74) Representative: Sonn & Partner Patentanwälte Riemergasse 14 (62) Document number(s) of the earlier application(s) in 1010 Wien (AT) accordance with Art. 76 EPC: 07871360.9 / 2 080 140 Remarks: This application was filed on 10-12-2012 as a (71) Applicant: Baylor Research Institute divisional application to the application mentioned Dallas, TX 75204 (US) under INID code 62. (72) Inventors: • Palucka, Anna Karolina Dallas, TX 75204 (US) (54) Diagnosis of metastatic melanoma and monitoring indicators of immunosuppression through blood leukocyte microarray analysis (57) The present invention includes compositions, or more expression vectors from the expression of one systems and methods for the early detection and con- or more genes. sistent determination of metastatic melanoma and/or im- munosuppression using microarrays by calculating one EP 2 579 174 A1 Printed by Jouve, 75001 PARIS (FR) EP 2 579 174 A1 Description TECHNICAL FIELD OF THE INVENTION 5 [0001] The presentinvention relates in generalto the field of diagnostic for monitoring indicatorsof metastatic melanoma and/or immunosuppression, and more particularly, to a system, method and apparatus for the diagnosis, prognosis and tracking of metastatic melanoma and monitoring indicators of immunosuppression associated with transplant recipients (e.g., liver). -
Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation
BASIC RESEARCH www.jasn.org Human Induced Pluripotent Stem Cell–Derived Podocytes Mature into Vascularized Glomeruli upon Experimental Transplantation † Sazia Sharmin,* Atsuhiro Taguchi,* Yusuke Kaku,* Yasuhiro Yoshimura,* Tomoko Ohmori,* ‡ † ‡ Tetsushi Sakuma, Masashi Mukoyama, Takashi Yamamoto, Hidetake Kurihara,§ and | Ryuichi Nishinakamura* *Department of Kidney Development, Institute of Molecular Embryology and Genetics, and †Department of Nephrology, Faculty of Life Sciences, Kumamoto University, Kumamoto, Japan; ‡Department of Mathematical and Life Sciences, Graduate School of Science, Hiroshima University, Hiroshima, Japan; §Division of Anatomy, Juntendo University School of Medicine, Tokyo, Japan; and |Japan Science and Technology Agency, CREST, Kumamoto, Japan ABSTRACT Glomerular podocytes express proteins, such as nephrin, that constitute the slit diaphragm, thereby contributing to the filtration process in the kidney. Glomerular development has been analyzed mainly in mice, whereas analysis of human kidney development has been minimal because of limited access to embryonic kidneys. We previously reported the induction of three-dimensional primordial glomeruli from human induced pluripotent stem (iPS) cells. Here, using transcription activator–like effector nuclease-mediated homologous recombination, we generated human iPS cell lines that express green fluorescent protein (GFP) in the NPHS1 locus, which encodes nephrin, and we show that GFP expression facilitated accurate visualization of nephrin-positive podocyte formation in -
Supplementary Table 1
Supplementary Table 1. 492 genes are unique to 0 h post-heat timepoint. The name, p-value, fold change, location and family of each gene are indicated. Genes were filtered for an absolute value log2 ration 1.5 and a significance value of p ≤ 0.05. Symbol p-value Log Gene Name Location Family Ratio ABCA13 1.87E-02 3.292 ATP-binding cassette, sub-family unknown transporter A (ABC1), member 13 ABCB1 1.93E-02 −1.819 ATP-binding cassette, sub-family Plasma transporter B (MDR/TAP), member 1 Membrane ABCC3 2.83E-02 2.016 ATP-binding cassette, sub-family Plasma transporter C (CFTR/MRP), member 3 Membrane ABHD6 7.79E-03 −2.717 abhydrolase domain containing 6 Cytoplasm enzyme ACAT1 4.10E-02 3.009 acetyl-CoA acetyltransferase 1 Cytoplasm enzyme ACBD4 2.66E-03 1.722 acyl-CoA binding domain unknown other containing 4 ACSL5 1.86E-02 −2.876 acyl-CoA synthetase long-chain Cytoplasm enzyme family member 5 ADAM23 3.33E-02 −3.008 ADAM metallopeptidase domain Plasma peptidase 23 Membrane ADAM29 5.58E-03 3.463 ADAM metallopeptidase domain Plasma peptidase 29 Membrane ADAMTS17 2.67E-04 3.051 ADAM metallopeptidase with Extracellular other thrombospondin type 1 motif, 17 Space ADCYAP1R1 1.20E-02 1.848 adenylate cyclase activating Plasma G-protein polypeptide 1 (pituitary) receptor Membrane coupled type I receptor ADH6 (includes 4.02E-02 −1.845 alcohol dehydrogenase 6 (class Cytoplasm enzyme EG:130) V) AHSA2 1.54E-04 −1.6 AHA1, activator of heat shock unknown other 90kDa protein ATPase homolog 2 (yeast) AK5 3.32E-02 1.658 adenylate kinase 5 Cytoplasm kinase AK7 -
Additional File 3.Pdf
************ globins ************ >Pdu_Egb_A1a MNGITVFLILAMASASLADDCTQLDMIKVKHQWAEVYGVESNRQEFGLAVFKRFFVIHPD RSLFVNVHGDNVYSPEFQAHVARVLAGVDILISSMDQEAIFKAAQKHYADFHKSKFGEVPLVEFGTAMRDVLP KYVGLRNYDNDSWSRCYAYITSKVE >Pdu_Egb_A1b MKGLLVFLVLASVSASLASECSSLDKIKVKNQWA RIHGSPSNRKAFGTAVFKRFFEDHPDRSLFANVNGNDIYSADFQAHVQRVFGGLDILIVSLDQDDLFTAAKSH YSEFHKKLGDVPFAEFGVAFLDTLSDFLPLRDYNQDPWSRCYNYIIS >Pdu_Egb_A1c MNTVTVVLVLLG CIASAMTGDCNTLQRTKVKYQWSIVYGATDNRQAFGTLVWRDFFGLYPDRSLFSGVRGENIYSPEFRAHVVRV FAGFDILISLLDQEDILNSALAHYAAFHKQFPSIPFKEFGVVLLEALAKTIPEQFDQDAWSQCYAVIVAGVTA >Pdu_Egb_A1d_alpha MYQILSVAVLVLSCLALGTLGEEVCGPLERIKVQHQWVSVYGADHDRLKVSTL VWKDFFEHHPEERARFERVNSDNIFSGDFRAHMVRVFAGFDLLIGVLNEEEIFKSAMIHYTKMHNDLGVTTEI IKEFGKSIARVLPEFMDGKPDITAWRPCFNLIAAGVSE >Pdu_Egb_A1d_beta MYFSYFTAAASYLSVAVLVLSCLVQGILGEEVCGPLEKIKVQHQWASAYRGDHD RLKMSTLVWKDFFAHNPEERARFERVHSDDIYSGDFRAHMVRVFAGFDLLIGALNQEDIFRSAMIHYTKMHKK LGVTYEIGIEFGKSIGRVLPEFIDGKLDITAWRPCYKLIATGVDE >Pdu_Egb_A1d_gamma MYLSVAVLVLSCLALGTQGEEVCGPLEKIKVQHQWASAYRGDHDRLKMSTLVW KDFFAHHPEERARFERVHSDDIYSGDFRAHMVRVFAGFDLLIGVLNQDEIFKSAMIHYTKMHNDLGVKTEIVL EFGKSIARVLPDFIDGKPDITAWRPCFKLIAAGVSE >Pdu_Egb_A2 MNNLVILVGLLCLGLTSATKCGPL QRLKVKQQWAKAYGVGHERLELGIALWKSIFAQDPESRSIFTRVHGDDVRHPAFEAHIARVFNGFDRIISSLT DEDVLQAQLAHLKAQHIKLGISAHHFKLMRTGLSYVLPAQLGRCFDKEAWGSCWDEVIYPGIKSL >Pdu_Egb_B1 MLVLAVFVAALGLAAADQCCSIEDRNEVQALWQSIWSAENTGKRTIIGHQIFEELFDINP GTKDLFKRVNVEDTSSPEFEAHVLRVMNGLDTLIGVLDDPATGYSLITHLAEQHKAREGFKPSYFKDIGVALK RVLPQVASCFNPEAWDHCFNGFVEAITNKMNAL >Pdu_Egb_B2 MLVLVLSLAFLGSALAEDCCSAADRKTVLRDWQSVWSAEFTGRRVAIGTAIFEELFAIDA GAKDVFKNVAVDKPESAEWAAHVIRVINGLDLAINLLEDPRALKEELLHLAKQHRERDGVKAVYFDEIGRALL -
Anti-Hemoglobin Antibody (FITC) Product Number: AC15-0147-12
Anti-Hemoglobin Antibody (FITC) Product Number: AC15-0147-12 Overview Host Species: Goat Clonality: Polyclonal Purity: Hemoglobin Antibody (FITC) is affinity purified. The affinity purified antibody is then conjugated to the fluorescent dye FITC (fluorescein isothiocyanate). Conjugate: FITC Immunogen Type: Anti-hemoglobin antibody (FITC) was rasied against human hemoglobin. Physical Characteristics Amount: 0.05 mg Concentration: 1 mg/ml Volume: 0.05 ml Buffer: 10 mM Sodium Phosphate, 0.15 M NaCl, pH 7.2 with 0.05% (w/v) sodium azide. Storage: FITC conjugated antibody can be stored at 4?C for up to 18 months. For longer storage the conjugate can be stored at -20?C after adding 50% glycerol. Fluorescein conjugated antibodies should always be stored in the dark. Specificity Species Reactivity: Human Specificity: Human hemoglobin Target Information Gene ID Number(s): 3047 (human), 3039 (human), 3040 (human) Alternative Names: 3-prime alpha-globin gene; Alpha globin; alpha one globin; alpha-1 globin; Alpha-globin; Beta globin; CD113t C; CD31antibody (FITC); Erythremia, beta-globin type, included; Gamma 1 globin; Hb FAgamma; HBA 1; HBA 2; HBA; HBA_HUMAN; HBA1antibody (FITC); HBA2; HBB; Hbb-y; HBD; Hbe1; HBG 1antibody (FITC); HBG; HBG1; HBGA; HBGR; HBHantibody (FITC); Hemoglobin alpha 1; hemoglobin alpha 1 globin chain; Hemoglobinalpha chain; Hemoglobin alpha locus; Hemoglobin alpha locus 1antibody (FITC); hemoglobin alpha-1 chain; Hemoglobin beta; Hemoglobin beta chainantibody (FITC); Hemoglobin beta chain complex; Hemoglobin beta locus; Hemoglobingamma