Tmub2 (NM 028076) Mouse Tagged ORF Clone

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MG204613 Tmub2 (NM_028076) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Tmub2 (NM_028076) Mouse Tagged ORF Clone Tag: TurboGFP Symbol: Tmub2 Synonyms: 2010008E23Rik Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MG204613 representing NM_028076 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGATTTCACGTCTTCTTCAAAACAACCTTATGAGCGTGGACCCAGTCAGCAGCCAGGCCATGGAGCTCT CTGATGTCACCCTCATTGAGGGTGTGGGTAACGAGGTGATGGTGGTAGCAGGCGTGGTGGCGCTGACTCT AGCCCTGGTCCTAGCCTGGCTCTCCACCTATGTAGCAGACAGTGGTAACAACCAGCTGCTGGGCACCATT GTGTCAGCAGGTGACACGTCTGTTCACCACCTGGGCCATGTGGACCAGCTGGTAAACCAAGGCACTCCAG AGCCAACCGAACACCCCCATCCATCAGGGGGCAATGATGACAAGGCTGAAGAGACCAGTGACAGTGGGGG AGACGCCACTGGAGAACCTGGAGCTAGGGGAGAGATGGAGCCCAGCCTGGAGCATCTCCTGGACATCCAA GGCCTGCCTAAAAGGCAAGCAGGCCTGGGGAGCAGTCGCCCAGAAGCCCCGCTGGGGTTAGATGATGGCT CCTGCCTCTCTCCCAGCCCCAGCCTCATCAATGTTCGCCTCAAGTTCCTCAATGACACCGAGGAGCTAGC TGTGGCCAGGCCAGAGGACACTGTGGGTACCCTAAAAAGCAAATACTTCCCTGGACAAGAGAGCCAAATG AAGTTGATCTACCAGGGTCGGCTGCTGCAGGACCCAGCACGCACACTGAGTTCCCTGAACATTACCAACA ACTGCGTGATCCACTGCCACCGCTCACCCCCAGGGGCAGCAGTTTCTGGCCCCTCAGCCTCCTTGACCCC AACCACTGAGCAATCTAGCCTTGGTGTCAACGTGGGCAGCCTCATGGTGCCTGTGTTTGTGGTGCTCTTG GGTGTGGTCTGGTACTTCCGTATCAATTACCGCCAGTTCTTCACTGGACCTGCCACTATCTCCTTGGTTG GAGTCACAGTCTTCTTCAGCATCCTGGTATTTGGGATGTATGGAAGA ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 Tmub2 (NM_028076) Mouse Tagged ORF Clone – MG204613 Protein Sequence: >MG204613 representing NM_028076 Red=Cloning site Green=Tags(s) MISRLLQNNLMSVDPVSSQAMELSDVTLIEGVGNEVMVVAGVVALTLALVLAWLSTYVADSGNNQLLGTI VSAGDTSVHHLGHVDQLVNQGTPEPTEHPHPSGGNDDKAEETSDSGGDATGEPGARGEMEPSLEHLLDIQ GLPKRQAGLGSSRPEAPLGLDDGSCLSPSPSLINVRLKFLNDTEELAVARPEDTVGTLKSKYFPGQESQM KLIYQGRLLQDPARTLSSLNITNNCVIHCHRSPPGAAVSGPSASLTPTTEQSSLGVNVGSLMVPVFVVLL GVVWYFRINYRQFFTGPATISLVGVTVFFSILVFGMYGR TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI Cloning Scheme: Plasmid Map: ACCN: NM_028076 ORF Size: 957 bp This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 Tmub2 (NM_028076) Mouse Tagged ORF Clone – MG204613 OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_028076.1, NP_082352.1 RefSeq Size: 2097 bp RefSeq ORF: 960 bp Locus ID: 72053 UniProt ID: Q3V209 Gene Summary: This gene encodes a predicted multi-pass membrane protein that features a C-terminal ubiquitin-related domain. This gene may be expressed in cone photoreceptors in the retina. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.

Copy Link

Recommended publications

Global-Scale Analysis of the Dynamic Transcriptional Adaptations Within Skeletal Muscle During Hypertrophic Growth
University of Kentucky UKnowledge Theses and Dissertations--Physiology Physiology 2015 GLOBAL-SCALE ANALYSIS OF THE DYNAMIC TRANSCRIPTIONAL ADAPTATIONS WITHIN SKELETAL MUSCLE DURING HYPERTROPHIC GROWTH Tyler Kirby University of Kentucky, [email protected] Right click to open a feedback form in a new tab to let us know how this document benefits ou.y Recommended Citation Kirby, Tyler, "GLOBAL-SCALE ANALYSIS OF THE DYNAMIC TRANSCRIPTIONAL ADAPTATIONS WITHIN SKELETAL MUSCLE DURING HYPERTROPHIC GROWTH" (2015). Theses and Dissertations--Physiology. 22. https://uknowledge.uky.edu/physiology_etds/22 This Doctoral Dissertation is brought to you for free and open access by the Physiology at UKnowledge. It has been accepted for inclusion in Theses and Dissertations--Physiology by an authorized administrator of UKnowledge. For more information, please contact [email protected]. STUDENT AGREEMENT: I represent that my thesis or dissertation and abstract are my original work. Proper attribution has been given to all outside sources. I understand that I am solely responsible for obtaining any needed copyright permissions. I have obtained needed written permission statement(s) from the owner(s) of each third-party copyrighted matter to be included in my work, allowing electronic distribution (if such use is not permitted by the fair use doctrine) which will be submitted to UKnowledge as Additional File. I hereby grant to The University of Kentucky and its agents the irrevocable, non-exclusive, and royalty-free license to archive and make accessible my work in whole or in part in all forms of media, now or hereafter known. I agree that the document mentioned above may be made available immediately for worldwide access unless an embargo applies.
[Show full text]
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
[Show full text]
4-6 Weeks Old Female C57BL/6 Mice Obtained from Jackson Labs Were Used for Cell Isolation
Methods Mice: 4-6 weeks old female C57BL/6 mice obtained from Jackson labs were used for cell isolation. Female Foxp3-IRES-GFP reporter mice (1), backcrossed to B6/C57 background for 10 generations, were used for the isolation of naïve CD4 and naïve CD8 cells for the RNAseq experiments. The mice were housed in pathogen-free animal facility in the La Jolla Institute for Allergy and Immunology and were used according to protocols approved by the Institutional Animal Care and use Committee. Preparation of cells: Subsets of thymocytes were isolated by cell sorting as previously described (2), after cell surface staining using CD4 (GK1.5), CD8 (53-6.7), CD3ε (145- 2C11), CD24 (M1/69) (all from Biolegend). DP cells: CD4+CD8 int/hi; CD4 SP cells: CD4CD3 hi, CD24 int/lo; CD8 SP cells: CD8 int/hi CD4 CD3 hi, CD24 int/lo (Fig S2). Peripheral subsets were isolated after pooling spleen and lymph nodes. T cells were enriched by negative isolation using Dynabeads (Dynabeads untouched mouse T cells, 11413D, Invitrogen). After surface staining for CD4 (GK1.5), CD8 (53-6.7), CD62L (MEL-14), CD25 (PC61) and CD44 (IM7), naïve CD4+CD62L hiCD25-CD44lo and naïve CD8+CD62L hiCD25-CD44lo were obtained by sorting (BD FACS Aria). Additionally, for the RNAseq experiments, CD4 and CD8 naïve cells were isolated by sorting T cells from the Foxp3- IRES-GFP mice: CD4+CD62LhiCD25–CD44lo GFP(FOXP3)– and CD8+CD62LhiCD25– CD44lo GFP(FOXP3)– (antibodies were from Biolegend). In some cases, naïve CD4 cells were cultured in vitro under Th1 or Th2 polarizing conditions (3, 4).
[Show full text]
Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
[Show full text]
Supplementary Material
BMJ Publishing Group Limited (BMJ) disclaims all liability and responsibility arising from any reliance Supplemental material placed on this supplemental material which has been supplied by the author(s) J Neurol Neurosurg Psychiatry Page 1 / 45 SUPPLEMENTARY MATERIAL Appendix A1: Neuropsychological protocol. Appendix A2: Description of the four cases at the transitional stage. Table A1: Clinical status and center proportion in each batch. Table A2: Complete output from EdgeR. Table A3: List of the putative target genes. Table A4: Complete output from DIANA-miRPath v.3. Table A5: Comparison of studies investigating miRNAs from brain samples. Figure A1: Stratified nested cross-validation. Figure A2: Expression heatmap of miRNA signature. Figure A3: Bootstrapped ROC AUC scores. Figure A4: ROC AUC scores with 100 different fold splits. Figure A5: Presymptomatic subjects probability scores. Figure A6: Heatmap of the level of enrichment in KEGG pathways. Kmetzsch V, et al. J Neurol Neurosurg Psychiatry 2021; 92:485–493. doi: 10.1136/jnnp-2020-324647 BMJ Publishing Group Limited (BMJ) disclaims all liability and responsibility arising from any reliance Supplemental material placed on this supplemental material which has been supplied by the author(s) J Neurol Neurosurg Psychiatry Appendix A1. Neuropsychological protocol The PREV-DEMALS cognitive evaluation included standardized neuropsychological tests to investigate all cognitive domains, and in particular frontal lobe functions. The scores were provided previously (Bertrand et al., 2018). Briefly, global cognitive efficiency was evaluated by means of Mini-Mental State Examination (MMSE) and Mattis Dementia Rating Scale (MDRS). Frontal executive functions were assessed with Frontal Assessment Battery (FAB), forward and backward digit spans, Trail Making Test part A and B (TMT-A and TMT-B), Wisconsin Card Sorting Test (WCST), and Symbol-Digit Modalities test.
[Show full text]
Supporting Information Structure and Protein Interaction-Based Gene
Supporting Information Structure and Protein Interaction-based Gene Ontology Annotations Reveal Likely Functions of Uncharacterized Proteins on Human Chromosome 17 Chengxin Zhang, Xiaoqiong Wei, Gilbert S. Omenn, and Yang Zhang Table of Contents Text S1. SPARQL query for curating the list of uPE1 proteins from neXtProt database version 2018-01-17 ................................................................................................................................... S2 Text S1. SPARQL query for curating the initial list of unannotated proteins from neXtProt database ......................................................................................................................................... S3 Text S3. Benchmark set of 100 well annotated PE1 proteins randomly selected from chromosome 17 ............................................................................................................................. S4 Table S1. Fmax of different programs for GO prediction using UniProt and neXtProt annotation as gold standard for the benchmark set of 100 chromosome 17 PE1 proteins ............................ S5 Table S2. Fmax of “structure” component and the final consensus prediction in COFACTOR for a benchmark set of 59 proteins with experimental structure covering at least 30% of target sequence ....................................................................................................................................... S6 Table S3. COFACTOR predicted functions for 66 uPE1 protein on chromosome 17 ...............
[Show full text]
Supplementary Figures
Supplementary Figures Supplementary Figure 1 | Sampling locality, genome size estimation, and GC content. (a) Sampling locality in Amami Island (i.e., Amami Oshima, Japan) and its relative location to Okinawa are shown with coordinates (adapted from Google Maps). (b) Sperm cells collected from gravid male gonads were stained with DAPI and subjected to fluorescence-activated cell sorting (FACS) flow cytometry analysis. Sperm with known genome size from zebrafish (Danio rerio) were used as an internal standard to estimate the Lingula genome size. (c) The analysis of stepwise assembly shows that the saturation point is achieved when input sequences reach 10 Gbp from 454 and Illumina reads. (d) K-mer analysis (17-mer) using Illumina reads shows two peaks, in which the homozygous peak coverage is twice the heterozygous peak. The estimated heterozygosity rate calculating the ratio of the peaks, is 1.6%. (e) Distribution of GC content calculated from 3,830 scaffolds. (f) Comparison of GC content in selected lophotrochozoans. Error bars, standard deviation. Supplementary Figure 2 | Schematic flow of sequencing and assembly of the Lingula genome. (a) Genomic DNA from a male gonad was extracted for genome sequencing using Roche 454, Illumina, and PacBio platforms. A total of 96-Gb of data was obtained with approximately 226- fold coverage of the 425-Mb Lingula genome. (b) Ten embryonic stages from egg to larva and seven adult tissues were collected for RNA-seq and reads were assembled de novo using Trinity. (c) Transcript information from RNA-seq was used to generate hints by spliced alignment with PASA and BLAT. Gene models were predicted with trained AUGUSTUS.
[Show full text]
Full-Text.Pdf
Systematic Evaluation of Genes and Genetic Variants Associated with Type 1 Diabetes Susceptibility This information is current as Ramesh Ram, Munish Mehta, Quang T. Nguyen, Irma of September 23, 2021. Larma, Bernhard O. Boehm, Flemming Pociot, Patrick Concannon and Grant Morahan J Immunol 2016; 196:3043-3053; Prepublished online 24 February 2016; doi: 10.4049/jimmunol.1502056 Downloaded from http://www.jimmunol.org/content/196/7/3043 Supplementary http://www.jimmunol.org/content/suppl/2016/02/19/jimmunol.150205 Material 6.DCSupplemental http://www.jimmunol.org/ References This article cites 44 articles, 5 of which you can access for free at: http://www.jimmunol.org/content/196/7/3043.full#ref-list-1 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision by guest on September 23, 2021 • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2016 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Systematic Evaluation of Genes and Genetic Variants Associated with Type 1 Diabetes Susceptibility Ramesh Ram,*,† Munish Mehta,*,† Quang T.
[Show full text]
Alterations of the Pro-Survival Bcl-2 Protein Interactome in Breast Cancer
bioRxiv preprint doi: https://doi.org/10.1101/695379; this version posted July 12, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. 1 Alterations of the pro-survival Bcl-2 protein interactome in 2 breast cancer at the transcriptional, mutational and 3 structural level 4 5 Simon Mathis Kønig1, Vendela Rissler1, Thilde Terkelsen1, Matteo Lambrughi1, Elena 6 Papaleo1,2 * 7 1Computational Biology Laboratory, Danish Cancer Society Research Center, 8 Strandboulevarden 49, 2100, Copenhagen 9 10 2Translational Disease Systems Biology, Faculty of Health and Medical Sciences, Novo 11 Nordisk Foundation Center for Protein Research University of Copenhagen, Copenhagen, 12 Denmark 13 14 Abstract 15 16 Apoptosis is an essential defensive mechanism against tumorigenesis. Proteins of the B-cell 17 lymphoma-2 (Bcl-2) family regulates programmed cell death by the mitochondrial apoptosis 18 pathway. In response to intracellular stresses, the apoptotic balance is governed by interactions 19 of three distinct subgroups of proteins; the activator/sensitizer BH3 (Bcl-2 homology 3)-only 20 proteins, the pro-survival, and the pro-apoptotic executioner proteins. Changes in expression 21 levels, stability, and functional impairment of pro-survival proteins can lead to an imbalance 22 in tissue homeostasis. Their overexpression or hyperactivation can result in oncogenic effects. 23 Pro-survival Bcl-2 family members carry out their function by binding the BH3 short linear 24 motif of pro-apoptotic proteins in a modular way, creating a complex network of protein- 25 protein interactions.
[Show full text]
GLP1/GLP1 Receptors
J-L HWANG and others Evolution of GLP1 and GLP1 52:3 T15–T27 Thematic Review receptor MOLECULAR EVOLUTION OF GPCRS GLP1/GLP1 receptors Correspondence Jong-Ik Hwang, Seongsik Yun, Mi Jin Moon, Cho Rong Park and Jae Young Seong should be addressed to J Y Seong Graduate School of Medicine, Korea University, Seoul 136-705, Republic of Korea Email [email protected] Abstract Glucagon-like peptide 1 (GLP1) is an intestinal incretin that regulates glucose homeostasis Key Words through stimulation of insulin secretion from pancreatic b-cells and inhibits appetite by " evolution acting on the brain. Thus, it is a promising therapeutic agent for the treatment of type 2 " exon diabetes mellitus and obesity. Studies using synteny and reconstructed ancestral " GLP1 chromosomes suggest that families for GLP1 and its receptor (GLP1R) have emerged through " GLP1R two rounds (2R) of whole genome duplication and local gene duplications before and after " G protein-coupled receptor 2R. Exon duplications have also contributed to the expansion of the peptide family " genome members. Speciﬁc changes in the amino acid sequence following exon/gene/genome " gene duplications have established distinct yet related peptide and receptor families. These " duplication speciﬁc changes also confer selective interactions between GLP1 and GLP1R. In this review, we present a possible macro (genome level)- and micro (gene/exon level)-evolution mechanisms of GLP1 and GLP1R, which allows them to acquire selective interactions between this ligand–receptor pair. This information may provide critical insight for the Journal of Molecular development of potent therapeutic agents targeting GLP1R. Endocrinology Journal of Molecular Endocrinology (2014) 52, T15–T27 Introduction Glucagon-like peptide 1 (GLP1) is a gastrointestinal 1990).
[Show full text]
Mechanism of Microrna Mir-520G Pathogenesis in CNS-PNET
Mechanism of MicroRNA miR-520g Pathogenesis in CNS-PNET by J. H. David Shih A thesis submitted in conformity with the requirements for the degree of Master of Science Graduate Department of Laboratory Medicine and Pathobiology University of Toronto © Copyright by J. H. David Shih (2011) Mechanism of microRNA miR-520g pathogenesis in CNS-PNET J. H. David Shih Master of Science Graduate Department of Laboratory Medicine and Pathobiology University of Toronto 2011 Abstract We recently discovered a high-level amplicon spanning the chr19q13.41 microRNA cluster in CNS Primitive Neuroectodermal Tumour, which results in striking upregulation of miR-520g. Constitutive over-expression of miR-520g in untransformed human neural stem cells enhanced cell growth, restricted differentiation down the neuronal lineage, and promoted expression of neural stem/progenitor cell markers. We thus hypothesize that ectopic miR-520g expression promotes tumourigenesis in part by inhibiting cellular differentiation. Consistent with this proposition, miR-520g is silenced upon embryonic stem cell differentiation and its expression is absent from most adult tissues. Moreover, expression analysis of miR-520g overexpressing cells revealed significant dysregulation of developmental signalling pathways. Further efforts focused on elucidating mechanisms of miR-520g function led to the identification of a cell cycle inhibitor, p21, as an important candidate target. These findings collectively suggest that miR- 520g may modulate differentiation by regulating developmental signalling pathways and cell cycle exit of neural stem/progenitor cells. ii Acknowledgments I am thankful to my supervisor, Dr. Annie Huang, and my graduate committee members, Dr. Peter Dirks and Dr. Rod Bremner, whose encouragement, guidance, and support from the initial to the final stages of the project have provided a productive research environment and helped me develop an understanding of the subject.
[Show full text]
Low-Frequency Variants of the Mitochondria Respiratory Chain-Related Proteins in Rheumatoid Arthritis Patients
Journal of Human Genetics (2015) 60, 449–454 & 2015 The Japan Society of Human Genetics All rights reserved 1434-5161/15 www.nature.com/jhg ORIGINAL ARTICLE Aggregation of rare/low-frequency variants of the mitochondria respiratory chain-related proteins in rheumatoid arthritis patients Shigeki Mitsunaga1, Kazuyoshi Hosomichi2,3, Yuko Okudaira1, Hirofumi Nakaoka2, Yasuo Suzuki4, Masataka Kuwana5,6, Shinji Sato4, Yuko Kaneko6, Yasuhiko Homma7, Akira Oka8, Takashi Shiina1, Hidetoshi Inoko1 and Ituro Inoue2 Exome sequencings were conducted using 59 patients having rheumatoid arthritis (RA) and 93 controls. After stepwise ﬁltering, 107 genes showed less than 0.05 of P-values by gene-burden tests. Among 107 genes, NDUFA7 which is a subunit of the complex I in the mitochondrial respiratory chain was selected for further analysis based on previous reports. A case–control study was performed on the three single-nucleotide variants (SNVs) of NDUFA7 with 432 cases and 432 controls. An association was observed between NDUFA7 and RA with severe erosive arthritis. These results together with previous reports suggested the involvement of reactive oxygen species (ROS) in the pathogenesis of RA. In the next step, four SNVs from three genes related to the mitochondrial respiratory chain were selected, which is a major source of ROS, and conducted a case–control study. An association was observed based on a pathway-burden test comprising NDUFA7, SDHAF2, SCO1 and ATP5O: P = 1.56E-04, odds ratio = 2.16, 95% conﬁdence interval = 1.43–3.28. Previous reports suggested the involvement of ROS in the pathogenesis of RA. The aggregation of SNVs in the mitochondria respiratory chain suggests the pivotal role of those SNVs in the pathogenesis of RA with severe erosive arthritis.
[Show full text]

Tmub2 (NM 028076) Mouse Tagged ORF Clone – MG204613