Thursday. —AFP(SeePage14) participate inthefirstprime-timepresidentialdebatehostedbyFOXNewsandFacebookatQuickenLoansArena on CLEVELAND: Republicanpresidentialcandidates(fromleft)WisconsinGovScottWalker,DonaldTrumpandJebBush may reach1m Kuwaiti pavilion Visitors toExpo’s Tareq saidtheresponse fromothercompetitors hadgenerally the waitingroomwhereswimmers gatherbeforetheirraces, a goodageforit,”shetoldGerman media. allowed tostartinthe1992Barcelona OlympicsandIthink14is because theminimumagelimit atthetimewas14.“I when shewasjust13.But was notallowedtocompete in theearly1990s,qualifiedfor the 1991worldchampionships former worldchampionFranziskavanAlmisick,achildprodigy “She’s tiny,butgoodonhertohaveago.Blessher.”Germany’s Fran Halsall,saidshedidn’t“knowwhattomakeofit”,adding: championship drewamixedresponse.Britishfreestylesprinter said thatwaslikelytobereviewedinthefuture. rently haveanyminimumagelimitsforcompetitorsbutsources in Bahrain,andsotheychoseme,”shesaid.FINAdoesnotcur- to havesomelimitedrepresentation.“Iamthefastestswimmer was allowedtocompetebecauseofaruleallowingeachnation qualifying timestocompeteattheworldchampionships,she “I wanttobeablelearnthetechniquesandhowtheyswim.” leading qualifiers.“Iamsohappytobehere,”shetoldreporters. pool inatimeof41.13seconds,almost16secondsbehindthe distant lastamongthe64competitors,reachingendof 50-metre butterfly.Hopelesslyoutofherdepth,shefinisheda championships whenshecompetedintheheatsofwomen’s became theyoungestevercompetitortoraceatworld did setanunlikelynewrecordyesterday.Just10yearsold,Tareq the worldswimmingchampionshipsbutpint-sizedBahraini KAZAN, Russia:
Bahraini kidmakesasplash SUBSCRIPTION So small,herfeetcouldn’treach thefloorfromseatsin Tareq’s participationinthesport’smostprestigiousglobal Although Tareqdidn’tcomeanywhereneartheminimum 2 150 Fils Alzain Tareqwon’tbewinninganymedalsat AUDY UUT8 05 HWA 3 46A No: SATURDAY, 1436 AH SHAWWAL AUGUST 8,2015 23, Trump hogslimelight at Republicandebate Mogul drawsboosfromcrowd,rivals’rebukes Championships yesterday.—AFP terfly swimmingeventatthe2015FINAWorld swims inthepreliminaryheatsofwomen’s50mbut- KAZAN: Ten-year-oldathletefromBahrainAlzainTareq after 16years ‘Daily Show’ Stewart quits 24 that Ithink.”—Reuters I candoitwhenamolder.When Iamaged15or16cando for thefuture.“It’shardmeto beattheworldrecordnowbut to bethelastonethere,”shesaid, addingthatshehasbigplans Olympics. “Iwanttoparticipatein theOlympicsbutIdon’twant championships, shecouldbeeligible toswimatnextyear’sRio the 50mfreestyle,andbecause shecompetedattheworld my name,”shesaid. swim here,buttheyhavealwaysaskedmynameandhowold ‘been positive.“Afewofthemhavebeensurprisedtoseeme Tareq, whosaidshestartedtoswim in2009,isalsoentered seven candidatesonstagefortheearly forum.—Agencies European nightmare,”saidLouisiana GovernorBobbyJindal,oneof Clinton, they’reworkinghardtochange theAmericandreaminto a Republicanpresidency.“Under PresidentObamaandSecretary and stressedtheywouldshredanuclear dealwithIranondayoneof gration policy;pledgedtotoethe conservativelineonsocialissues; Obama’s handlingoftheIslamicStategroup;vowedtougherimmi- Obama, ClintonandTrump.Theyofferedwitheringattackson sought tomakeanimpressiononvoters-andmanyaimedat whelmingly male,saidtoamixtureofboosandapplause. the wayyouhavetreatedme,”Trump,whosebaseofsupportisover- very nicetoyoualthoughIcouldprobablymaybenotbebasedon the audience.“HonestlyMegyn,ifyoudon’tlikeit,I’msorry.I’vebeen He accusedKellyofnottreatinghimwell,drawingmoreboosfrom and “slobs”.Trumpdismissedthequestionas“politicalcorrectness”. he hadmadeaboutwomen,includingcallingthem“fatpigs”,“dogs” with Kellywhenshepressedhimaboutpastderogatorycomments Mexican governmentandanassortmentofothertargets.Hetangled Fox NewsmoderatorMegynKelly,comedianRosieO’Donnell,the the progressive,secularprogressivemovement.” only African-Americancandidateinthefield.“Sheisepitomeof would beadreamcometrue,”saidneurosurgeonBenCarson,the Democratic nominee.“IfHillaryisthecandidate,whichIdoubt,that focused theirireonformersecretaryofstateClinton,thelikely Republicans wintheWhiteHouse. “divisive” languageandwarningsuchverbalsnipingwillnothelp United Statesdidsoasan“actoflove”.BushaccusedTrumpusing his earlierremarkthatimmigrantsbreakingthelawtocome policies. “I’mgoingtohaveearnthis,”Bushsaid.Healsostoodby dents. Butheinsistedoncemorethatishisownmanwith likely higherforhimin2016,beingthesonandbrotheroftwopresi- mistake.” event. “Forpeoplewhowanttojusttunehimout,they’remakinga try,” admittedhisrival,OhioGovernorJohnKasich,duringthemain same levelofattention.“DonaldTrump’shittinganerveinthiscoun- apart fromapackedfieldofhopefulsfuriouslytryingtogarnerthe Trump’s unapologetic,off-scriptstyleoffendssomebuthassethim trading barbsinaseparateforumaheadoftheprime-timeevent. Fox Newssplitthedebateintotwoparts,withbottom-tierhopefuls moderators, andsaidhehadnotimefor“politicalcorrectness”. top DemocratHillaryClinton,clashedwithSenatorRandPauland had givenmoneytomostofthecandidatesonstageaswell over TrumphadcalledUSleadersandpoliticians“stupid,”claimedhe months aheadofthefirstprimaryvotes.Bytimeeventwas bearer forthe2016racetosucceedPresidentBarackObama,onlysix loud boosandjeersfromarambunctiouscrowd. make thepledgeatthistime,”improbablefrontrunnersaid,to president asanindependentifhelosesthepartyprimary.“Iwillnot pledge thathewouldbacktheRepublicannomineeandnotrunfor himself apartwhenhewastheonlycandidateonstagetorefuse rivals whotrailhiminthepolls,realestatemogulimmediatelyset tas inthefirstmajordebateof2016campaign.Flankedbynine worst ofhimselfThursdayasopponentsstrainedtooffermoregravi- billionaire leadingtheRepublicanprimaryrace,offeredbestand CLEVELAND: freestyle atworlds go 1-2in100m Campbell sisters 48 Candidates atboththemaineventandondebateundercard During acombustibleperformance,TrumpfiredoffinsultsatPaul, The candidates,eachlookingforabreakoutmoment,also Former FloridagovernorJebBushacknowledgedthatthebaris With 17majorRepublicancandidatesincontention,broadcaster It wasanextraordinarystarttotheparty’squestchooseaflag Bombastic, comical,provocative:DonaldTrump,the 16603 Max Min 48º 32º LOCAL SATURDAY, AUGUST 8, 2015
CAIRO: (From left) Sudanese President Omar Al-Bashir, His Highness the Amir of Kuwait Sheikh Sabah Al-Ahmad Members of the Kuwaiti delegation, including Minister of Cabinet Affairs Al-Sabah, Egyptian President Abdelfatah Al-Sisi, French President Francois Hollande and King Abdullah II of Sheikh Mohammad Al-Abdullah Al-Sabah (right) are seen in attendance. Jordan attend a ceremony to inaugurate the new Suez Canal in Cairo Thursday. — Amiri Diwan photos Amir departs Egypt, heads to Mongolia
CAIRO: His Highness the Amir Sheikh Sabah Al-Ahmad Al- will facilitate the international shipping movement through Jaber Al-Sabah left Egypt Thursday afternoon after taking part the waterway. The project testifies to the ability of the in the new Suez Canal inauguration ceremony. His Highness Egyptian people to attain the desired development, con- the Amir headed to Mongolia in a private visit. tribute to the international trade and shipping, diversify the His Highness the Amir sent a cable to Egyptian President sources of national income and assert the status of sisterly Abdelfatah Al-Sisi to congratulate him on the inauguration of Egypt regionally and internationally, he went on. the new Suez Canal. This great project, notched in a record His Highness the Amir expressed the best wishes to Egypt time thanks to the contributions of the Egyptian people, is a and thanked the Egyptian president on the hospitality offered source of pride for all Arabs, according to a readout of the to the Kuwaiti official delegation to the inauguration ceremo- cable. His Highness the Amir added that this historic achieve- ny of the project. The delegation was led by His Highness the His Highness the Amir Sheikh Sabah Al-Ahmad Al-Sabah ment on large-scale regional and international praise since it Amir. — KUNA waves as he prepares to leave Cairo, heading to Mongolia. Kuwaiti pavilion visitors may reach 1 million: General Consul Expo Milano pavilion receives 750,000th visitor
MILAN: Kuwait’s General Consul in Milan Abdulnasser Boukhaddour and the pavilion’s staff has warmly received and honored the visitor the extraordinary mix of culture and tradition as well as the contem- has expressed satisfaction for the high turnout of visitors to the and his daughter on this occasion. They were also offered a special porary and scientific aspects which form the foundation of Kuwaiti Kuwaiti pavilion at Expo Milan 2015 exhibition saying the figure may tour with a guide from the staff to the pavilion, Ansari stated. The culture. The basic design of the Pavilion resembles the sails of a swell to one million in weeks. In a statement to KUNA, the General exhibition comprises up to 55 display sites representing 144 coun- dhow, a traditional wooden boat which is still in use today in the Consulate quoted him as expressing deep pleasure after number of tries. The Kuwaiti team has worked hard to decorate the pavilion, Arabian Gulf. With its design, the Kuwaiti pavilion references one of people showing up at the corner reached 750,000 on Thursday. which highlights various national issues, namely the Kuwaitis’ suc- the greatest challenges Kuwait faces due to its geographical loca- Such a high turn-up, three months after launch of the event, boosts cess in developing Kuwait into a modern state with all services, as tion, its climate, and its vegetation - water. The second part of the expectations that the figure may reach one million in coming weeks, well as their success in resolving the water scarcity problem. pavilion, toward the back, consists of a greenhouse in which numer- he said, affirming that the pavilion has proven very much lucrative ous hydroponically cultivated plants which serve as shade can be for many people visiting the exhibition ground. Inhabitable discovered. Expo-Milan is a major international exhibition that has Information Ministry’s Undersecretary and Head of Kuwait’s The Kuwaiti pavilion, themed ‘Challenge of Nature,’ shows how been held every five years since the 19th century. Covering 272 Delegation to Expo Milano 2015 Faisal Al-Mutalaqim had received the Kuwaitis made the desert inhabitable, and continue to do so, Acres, the event expects an estimated 29 million visitors from May 1 visitor number 750,000 for the Kuwaiti pavilion on Thursday. In using education, technology, science and renewable energy to to October 31, 2015. More than 140 participating countries are statements to KUNA, Head of the pavilion Mazen Al-Ansari identified establish a modern, vibrant and growing community which can showcasing the best of their technology, which will offer answers to the 750,000th visitor as Italian man named Edoardo who was contribute to global development and to feeding the world. questions revolving around health, safety and better food nourish- accompanied by his daughter Asia. He pointed out that Mutalaqim The aim of the Kuwaiti pavilion at the Expo Milano is to present ment. — KUNA
MILAN: Information Ministry’s Undersecretary and Head of Kuwait’s Delegation to Expo Head of the Kuwaiti pavilion Mazen Al-Ansari hands a memorial plaque to Italian motorcyclist Milano 2015 Faisal Al-Mutalaqim awards the 750,000th visitor to Kuwait’s pavilion. — KUNA Marco Melandri. LOCAL SATURDAY, AUGUST 8, 2015
The car break-in and theft suspect pictured in One of the vehicle that the suspect targeted. A detective checking workers’ IDs at a domestic worker’s office. this handout photo. Car thief arrested, search on for accomplice
By Hanan Al-Saadoun Domestic helpers The Residency Affairs Department busted eight domestic KUWAIT: Criminal detectives arrested a man responsible for workers recruitment offices in violation of residency and visa multiple car break-in and theft cases reported across Kuwait. regulations during a crackdown carried out recently in cooper- The suspect, an Ethiopian national, was ambushed in his resi- ation with the Criminal Evidence General Department. A num- dence after he was identified and monitored, the Interior ber of absconding workers were arrested during the opera- Ministry said in a statement. The man admitted responsibility tion. for crimes in which he would follow bank clients who with- draw cash from ATM machines until they leave their vehicles. He would then break into the vehicle and steal the cash left inside. A total of ten cases were found to have been filed Security campaigns against the man. Meanwhile, investigations are ongoing in Mubarak Al-Kabeer officers carried out security cam- search for the suspect’s accomplice, who reportedly helped paigns around the governorate recently which resulted him transfer the stolen money outside the country. in the arrest of 347 fugitives, 220 persons reported absconding, 180 visa violators as well as 30 persons with possession of drugs and alcoholic drinks. Forty vehicles Abortion Jahra police arrested a couple yesterday on accusations of were also impounded during the operations. conducting an abortion to get rid of a baby that was con- ceived out of wedlock. Patrol officers had reportedly Farwaniya fire approached a man who was walking suspiciously near Kabad A fire broke out in a 400 square meters basement of a 4-sto- Road. The man, an Asian national, suffered a nervous break- ry building in Farwaniya Thursday night. Firefighters from down as soon as police stopped him, prompting the officers three separate fire centers tackled the blaze which started to transfer him to the Sulaibiya investigations office. There, in a carpentry inside the basement. No injuries were report- the man admitted that he had just helped his girlfriend con- ed as firefighters managed to evacuate the buildingís resi- duct an abortion and then buried the fetus in an open square dents unharmed before tackling the blaze. An investigation in Kabad. Detectives headed to the location and found the was opened to determine the circumstances that led to the dead fetus covered in a blanket that was put in a plastic bag fire. and then buried underground. Further investigations allowed Jahra detectives to arrest the man’s girlfriend, an Asian woman, who admitted during investigations that she bought Sexual services an abortion injection from a person who claimed to be a Hawally police arrested three homosexual men who physician. She also said that the doctor helped her boyfriend offered sexual services at a gym in the area. They were tak- bury the fetus. The two were taken to the Jahra prosecution en to the proper authorities for legal procedures. Workers are seen during police crackdowns on domestic department for further legal procedures recruitment offices in these handout photos.
Firefighters tackle a blaze in the basement of a Farwaniya building Thursday night. LOCAL SATURDAY, AUGUST 8, 2015
KUWAIT: Acting Undersecretary of the Interior Ministry Major General Mahmoud Al-Dousary met recently with Commissioned Minister at the Iraqi Embassy Sameer Putrus, as well as charge d’affaires at the Jordanian Embassy Shaker Al-Amoush and discussed with them issues of mutual concern. KRCS distributes aid to Bahrain suspends pro-opposition newspaper 1,400 Syrian families DUBAI: Bahrain has announced the “temporary” suspension of a newspaper close to the Shiite opposition, drawing con- demnation from a human rights group which said Manama BEIRUT: Kuwait Red Crescent Society (KRCS) distributed was seeking to crush dissent. “The Information Affairs humanitarian aid to 1,400 displaced Syrian families in Sidon, Authority has temporarily suspended Al-Wasat newspaper southern Lebanon and Mount Akroum area in Akkar region, until further notice,” the Bahrain News Agency reported late northern Lebanon, as part of its humanitarian campaign to Thursday. alleviate suffering of the civil conflict-traumatized Syrian “This is due to its violation of the law and repeated dissemi- refugees, the KRCS announced. nation of information that affects national unity and the king- KRCS handed out food packages and cleaning supplies to dom’s relationship with other countries,” it added. Bahrain has 400 Syrian families in Mount Akroum and 1000 families in seen frequent unrest since the minority Sunni rulers of the Sidon, Dr Musaad Al-Enezi, KRCS’ delegate to Lebanon, said in small Gulf kingdom crushed a Shiite-led uprising for reform a press statement on Thursday. KRCS will continue with its four years ago. At the height of the 2011 uprising, Al-Wasat humanitarian campaign to aid Syrian refugees in Lebanon and was suspended by authorities, and its chief editor Mansoor Al- neighboring countries, expressing his hope that the Kuwaiti Jamri was tried and fined for allegedly publishing false infor- aid help ease the refugees’ suffering, Enezi added. —KUNA mation. It was later allowed to reopen. —AFP
KUWAIT: The Kuwait Dive Team recommended in a recent study that local authorities carry out scientific tests for the ‘Um Al-Aish’ coral reefs, as well as other key coral reef sites in Kuwaiti waters such as the ‘Um Deera’ reefs in Kubbar Island. The team, which is affiliated to the Environmental Voluntary Foundation, said in a recent report that observations of slow coral growth have been made at the sites mentioned above. LOCAL SATURDAY, AUGUST 8, 2015 Oman mediator credentials on show in French release in Yemen
DUBAI: The release of a French hostage held in only GCC country not to have joined the Saudi-led Three years later, Muscat mediated the release Yemen with the help of Oman has once again high- coalition air war on Iran-backed Shiite rebels in of an Iranian woman, Shahrazad Mir Gholikhan, lighted the tiny sultanate’s unique role as a discreet Yemen, although it maintains good ties with jailed by the United States for allegedly smuggling Gulf mediator. France announced late Thursday that regional powerhouse Saudi Arabia. Oman is also arms. It has also hosted talks between US officials Isabelle Prime, who worked on a World Bank-funded the only Arab country, besides Syria, to have a and Yemen’s Shiite Huthi rebels to find a solution project in Yemen, had been freed by her abductors good relationship with Shiite Iran. Experts say to a deadly conflict that has killed around 4,000 after nearly six months in captivity. Prime was in Oman has kept its role by staying out of the Sunni- people since March, according to UN estimates. As Oman on her way home by dawn yesterday. The Shiite divide that has scarred Middle East politics the informal talks got underway in early June, Omani foreign ministry said her release was the ever since the 2003 US-led invasion of Iraq. news emerged that American journalist Casey result of efforts by the sultanate “in coordination Morever, most of Oman’s population adheres to Coombs, who was believed held by the Huthis in with certain Yemeni parties”. “The search was under- the Ibadi branch of Islam that pre-dates the Sunni- Yemen, had arrived in Oman. “We are grateful to taken on the instructions of Sultan Qaboos at the Shiite divide, while the rest are Sunnis. the government of Oman and personally to Sultan request of French authorities,” a ministry spokesman Qaboos for assisting with the safe passage of a US said. History of diplomacy citizen to Oman,” State Department spokeswoman In a statement announcing the release, the Oman’s discreet diplomacy has gone to work on Marie Harf said at the time. French presidency expressed “gratitude” to those many levels. In November 2014, Oman hosted Iran, Oman has contacts with both the exiled Yemeni helping to secure her freedom, namely Sultan the United States and the European Union for government and the Houthi rebels who overran Qaboos. Prime, 30, became the latest French citizen nuclear talks. Later that month, Iran struck an much of the impoverished Arabian Peninsula abducted in Yemen to transit Oman on the way interim deal with world powers, paving the way to country. A Yemeni security official noted that dur- home, after three aid workers kidnapped by Al- the historic agreement they sealed on July 14. ing Yemen’s 1994 civil war, Oman gave refuge to Qaeda militants resurfaced in Muscat in November After the 2014 talks in Muscat, US Secretary of southern separatist leaders while keeping good 2011. Muscat has been repeatedly sought by State John Kerry thanked Oman for its “critical role ties with the government based in northern Western nations to act as a mediator in resolving in getting these talks off the ground in the first Yemen. Gulf affairs specialist Olivier Da Lage said thorny issues - from the kidnapping of Americans place”. Oman has also mediated between Tehran one of Oman’s golden rules in foreign policy is to and Europeans to the Iran nuclear deal. and Washington on prisoners, including the “never break ties” with any country or any faction. A member of the six-nation Gulf Cooperation release of three US hikers jailed on suspicion of On Thursday, Oman-one of the rare Arab countries Council, Oman has good ties with countries outside spying after they strayed across the border in to maintain ties with Damascus-hosted Foreign the wealthy bloc including Iran and Yemen. It is the 2009. Minister Walid Muallem of war-strewn Syria. —AFP
MUSCAT: A handout photo made available by the Oman News Agency (ONA) on August 6, 2015 shows Omani Foreign Minister Yussef bin Alawi bin Abdulla (R) meeting with Syrian Foreign Minister Walid Muallem in the capital Muscat. —AFP Damascus, Muscat to ‘unite’ efforts to end Syria war EU to work with Saudi to counter extremism MUSCAT: Muscat and Damascus agreed to work together to end Syria’s brutal war, official media reported, as the Syrian foreign minis- IS must be defeated: UNSC ter Thursday made his first Gulf visit since the conflict erupted in 2011. Foreign Minister Walid Muallem met Oman’s chief diplomat Yussef BRUSSELS/NEW YORK: The EU yester- issues discussed by the EU High and condolences to the families of the bin Alawi to discuss “several regional and international topics of com- day condemned Thursday’s bombing Representative Federica Mogherini and victims of this heinous act and to the mon interest”, the official Omani news agency ONA said. They agreed of a mosque in Asir province of Saudi the Saudi foreign minister Adel Bin Government of Saudi Arabia. “that now is the time to unite the efforts to end this (Syrian) crisis”, Arabia and extended its deepest con- Ahmed Al-Jubair, during their recent according to Syria’s state news agency SANA. “The two sides agreed to dolences to the families who have lost meeting in Riyadh. Barbarism continue cooperation and coordination to achieve the shared goals of their loved ones and its sympathy to all Meanwhile, members of the UN Furthermore, the Council empha- their peoples and governments,” it said. the injured victims. Security Council stressed after the “ter- sized in their statement that such con- Syrian daily Al-Watan daily, close to the regime in Damascus, point- The suicide bomb attack resulted in rorist attack” against Saudi Arabia, that tinued acts of barbarism perpetrated ed out that Muscat had not cut diplomatic and political ties with the death of several members of the the Islamic State (IS) must be defeated by IS “do not intimidate them, but President Bashar al-Assad’s government, unlike other Arab countries in Kingdom’s emergency forces perform- and that the intolerance, violence and rather stiffen their resolve that there the Gulf. It was Muallem’s “first visit to an Arab state in nearly four ing afternoon prayers in the mosque. hatred it espouses must be stamped has to be a common effort amongst years, at the official invitation of his Omani counterpart”, the paper “The EU reiterates its commitment to out. Governments and institutions, includ- reported in announcing the visit. continue working with the Kingdom of In a statement issued late on ing those in the region most affected, Al-Watan also wrote of a possible meeting in Muscat, a traditional Saudi Arabia, together with EU Member Thursday, the UNSC condemned in the to counter IS, groups that have mediator in the region, between top diplomats from Syria, Iran and States, to strengthen common efforts strongest terms the attack claimed by pledged allegiance to IS, Ansar Al- Saudi Arabia. Iran, along with Russia, is a key backer of Assad, while in countering violent extremism in all IS at a mosque in the headquarters of Shari’a entities, and all other individu- Saudi Arabia is a prominent supporter of the opposition and rebels its forms,” an EU spokesperson for for- the Special Emergency Security Forces als, groups, undertakings and entities fighting to topple his regime. On Wednesday, Muallem was in Tehran, eign affairs told journalists. in Asir region of Saudi Arabia, resulting associated with Al-Qaeda, as the where he met with Iranian President Hassan Rouhani. The Syrian min- The spokesperson, speaking on con- in at least the death of 15 people and Council resolved in United Nations ister also met with Mikhail Bogdanov, Russia’s deputy foreign minister dition of anonymity, noted that the ter- many other injured. The 15 member Security Council resolutions 2170 and and special representative to the Middle East. —AFP rorist threat was precisely one of the body expressed their deep sympathy 2199.” —KUNA
SATURDAY, August 8, 2015 Islamic State abducts Jewish extremism: New Secular blogger hacked dozens of Christians 8 fears over old problem 9 to death in Bangladesh 11
This combination of pictures shows (left to right) Suud Mujassabi, Imad Busadia, Shauki Esshaush, Ali Rouibah and Abdullah Assnusi, arrested on suspicion of people trafficking. Three Libyans and two Algerians were arrested yesterday accused of multiple homicide and human trafficking in connection with the presumed death by drowning of more than 200 migrants after a ship capsized in the Mediterranean. — AFP ‘Africans slashed, Arabs thrashed’ by traffickers Italy arrests five men accused of multiple murders
PALERMO: Knife-wielding traffickers sealed migrants in the hull get out in time would have drowned almost immediately,” it said. While noting that most incidents occurred before the of a boat which sank off Libya, condemning them to drown after According to the testimonies gathered from those brought to European Border Agency’s Triton Operation began covering slashing or thrashing them depending on their ethnicity, accord- safety on Italian soil Thursday-some still hoping to find relatives international waters, the IOM said the risks of new shipwrecks ing to survivor testimony reported yesterday. Italy has arrested who disappeared as the boat sank-there were a significant num- remained. “This incident shows that as long as there are no safe five men accused of multiple murders and human trafficking fol- ber of Syrians on board, many travelling with young children. Save alternatives for migrants, criminal gangs will continue to pack lowing Wednesday’s shipwreck, which left more than 200 peo- the Children said three of the 25 bodies recovered from the sea people into unseaworthy vessels and we can expect more ple feared drowned. Two Libyans, two Algerians and a Tunisian were “very young” children. “This latest maritime tragedy proves tragedies,” Soda said. He called for “a wider and more holistic were held by police after survivors of the disaster were brought that, while extremely laudable, the search and rescue operations approach to the issue of irregular migration” to help understand to Sicily, as testimony emerged as to how the suspects had beat- at sea cannot be the sole European response to this humanitarian “the underlying causes of the most significant movement of peo- en and stabbed passengers during the perilous crossing. disaster,” IOM Italy Chief of Mission Federico Soda said. ple since the end of World War II.”— AFP The alleged traffickers, aged between 21 and 24 years old, were accused by witnesses of “branding with their knives the heads of those who did not obey orders, particularly Africans, while those of Arab origin were thrashed with belts,” police said in a statement. The overcrowded vessel was believed to have had more than 600 migrants onboard when it began the per- ilous journey across the Mediterranean, before getting into trou- ble and overturning. Rescuers pulled 373 men, women and chil- dren from the water, and recovered 26 bodies. A search for fur- ther survivors proved fruitless. Police said “the criminals each took on a clear role”, with one in charge and the others tasked with controlling the migrants through violence. Survivors told them people from Africa had been put in the hold, and that “they could be closed in and com- pacted in the hull for three days, having paid half price for the crossing”. Passengers said they had paid between $1,200 (1,100 euros) and $1,800 (1,650 euros) for the trip from the coast of north Africa to Europe, with those who wanted a life-jacket shelling out an extra 35 to 70 Libyan Dinar (23 to 46 euros). When water began seeping in, “the migrants, on the traffickers’ orders, tried desperately to get rid of it,” the police said.
Hatch sealed shut When that failed “they did everything to try and get out to save themselves, but instead were attacked with knifes and sticks, pushed back into the hull”, at which point the traffickers “sealed the hatch, with the weight of the rest of the migrants, positioned on purpose to stop it reopening”. The International Organization for Migration (IOM) said survivors told them that “up to 250 people had been forced to sit in the hold”. The boat overturned as panicking migrants rushed to one side GEVGELIJA: A migrant man rests on a platform at the train station in Gevgelija, on the Macedonian-Greek border. Many when they saw a rescue ship approaching. “Those who could not migrants try to cross Macedonia and Serbia to enter the European Union via Hungary, a country that will finish building its anti-migrant fence on its southern border with Serbia by August 31, ahead of a previous November deadline. — AFP INTERNATIONAL SATURDAY, AUGUST 8, 2015
Authorities block colors festival in southern Iraq
BASRA: Authorities blocked a col- a massive water fight. The Baghdad group. People “without conscience young people forget the violence,” ors festival in southern Iraq, using event-which approximated a tiny or hearts or morals come to hold organizer Nabil Muslim said, com- concrete barriers to close off the version of the yearly Indian Holi mixed-sex festivals that bring them plaining of restrictions by religious park where it was to be held, an festival—drew fire from conserva- out to be joyful and the families of authorities. “Now, I am not able to AFP journalist reported. The festi- tives for the mixing of men and the martyrs see them and weep for leave my house out of fear for val in the port city of Basra would women. their children,” Shahmani said. But myself,” said Muslim, who is 21. have followed one in Baghdad in Murtada Al-Shahmani, a mem- moving beyond the tears and sor- “What was done by the authorities which grinning young people ber of the Basra provincial council, row in a country that has had little is a restriction on the personal lib- dressed in white shirts gathered couched the decision as respecting enough to celebrate was the point erties of the young people,” he and covered each other in clouds the families mourning those killed of the festival. said. “They want to return us to the of colored powder and engaged in fighting the Islamic State jihadist “We are trying to make our time of dictatorship.”— AFP
Displaced Iraq Christians in frontline prayer for return
ZARTEK: Christian clerics prayed in the ruins of a monastery not far from jihadist positions in northern Iraq Thursday to mark a year since the exodus of Iraq’s Christians from nearby ancestral lands. “We want the good people to hear our prayers from this place so they hurry and liberate our areas as quickly as possible,” Yohanna Boutros Moshe, the Syrian Catholic Archbishop of Mosul said. Moshe led a small group of clerics in prayer in the hilltop ruins of a fourth-century monastery that lies in a position of Kurdish peshmerga forces. On June 9 last year, the Islamic State group launched a mas- sive offensive that forced hundreds of thousands to flee. The following day, the jihadist group seized Mosul, the country’s second city, which was home to significant commu- nity of Christians. Many were forced from their homes two months later, when IS expanded further by attacking Kurdish- held positions, including the Nineveh plain. The region stretches from Mosul towards Arbil, the capital of Iraq’s autonomous Kurdistan region, and was home to the bulk of Iraq’s Christian community, one of the world’s oldest. “It is dear to our hearts because we received it from our sons who shed their blood until they preserved this area and we are proud of them,” the archbishop said. The monastery where the symbolic prayer was held is the closest point to Qaraqosh, which was Iraq’s largest Christian QARYATAIN: An Islamic State militant holds the group’s flag as he stands on a tank they captured from town until IS seized it last August. “I feel sorrow and pain until Syrian government forces, in the town of Qaryatain southwest of Palmyra, central Syria. — AP this hour; I feel as though I am drunk and do not know until now why I was forced from my area because we did nothing wrong or attack anyone and we were peaceful with every- one,” he said. The Nineveh plain was also home to members Islamic State abducts of other Iraqi minorities, such as the Yazidis, Shabak and Kakai. Other waves of violence in recent years have already driven many Iraqi Christians into exile. There were around 1.5 million dozens of Christians in 2003 but fewer than a third remain. Low morale Last year’s violence led many of the newly displaced Hundreds of people remain missing in Syria Christians to seek to emigrate, a trend clerics in Iraq and else- where fear could be a fatal blow to Christian presence in the BEIRUT: Islamic State militants have tured the area, according to Petros, who ran two monasteries in the country. “Estimates are that 50,000 Christians... have left Iraq” captured dozens of Christian families Abdulrahman. Qaryatain is near a road area, went missing last May from the over the past year, said Benoit Faraj Camurat, who heads the after seizing a strategically located town linking the ancient city of Palmyra to the town of Qaryatain, according to the French aid group Fraternite en Irak and accompanied the in the central Syrian province of Homs, a Qalamoun Mountains, along the border Assyrian Monitor for Human Rights, a prelate. He said most had gone to Turkey, Lebanon and monitor said yesterday. The UK-based with Lebanon. Christian lobby group. The group said at Jordan, while smaller numbers had resettled in Europe and Syrian Observatory for Human Rights The hardline militant group has been least 1,400 families had fled the town to other Western countries. The peshmerga, backed by air said at least 230 people were kidnapped gaining ground in the desert areas east safer areas or took shelter in the govern- strikes from a US-led international coalition, have recaptured or detained, including dozens of and south of Homs after it took over the ment-controlled city of Homs. some land in northern Iraq. Yet the fightback has been slug- Christians, some of whom were taken ancient Roman city of Palmyra last May. Islamic State has killed members of gish in recent months and the focus of efforts to retake terri- from a church in Qaryatain, the town The Syrian army has launched a large- religious minorities and Sunni Muslims tory lost to IS has focused on Iraq’s western province of captured overnight after heavy fighting scale counteroffensive to recapture the who do not swear allegiance to its self- Anbar. with the Syrian army. city, which lies in a region where some declared “caliphate”. They also consider Residents of Mosul and outlying areas had hoped Rami Abdulrahman, the head of the of Syria’s largest gas fields are located. Christians as infidels. Last February, the Baghdad and Arbil would make a big push to wrest the Observatory, said the Christians were But so far has made no significance hardline jihadists abducted at least 250 region back from IS as early as late last year. But more than a “either kidnapped from checkpoints or advances. Assyrian Christians, many of whom were year after IS took control of large parts of Iraq, many analysts raids or from churches.” Among those An army statement said its forces had children and women, during raids on vil- say the fight for Mosul is still a long way away. “Their current seized were 45 women and 19 children, targeted “terrorist outposts” in the area lages in northeastern Syria. That mass situation is that they live in camps, some in sort of mobile including 11 families, some of whom and killed scores of militants but did not abduction coincided with an offensive homes, others in unfinished houses,” said Camurat. “And real- were on a militants’ wanted list, said the confirm the capture of the town by the in the same region by Kurdish forces ly their morale is very low... Psychologically waiting one year monitor that tracks the war’s violence militants. An Assyrian Christian group backed by US-led air strikes. The fate of without knowing what will happen to you is something very through an extensive network of said these abductions were the latest in many of these civilians is unclear, as is difficult,” he said. Camurat’s NGO has set up a bakery in the sources on the ground. There were also a string of events that targeted their that of a number of other priests who largest camp for displaced Christians in Arbil that not only hundreds of residents, Muslims and community, one of the oldest Christian have gone missing and are believed to produces 9,000 loaves of bread daily but also provides Christians, whose families have lost populations in the Middle East. Two be held by the militants, according to employment.—AFP touch with them since the militants cap- priests, Father Yacoub Murad and Monk Christian groups.— Reuters INTERNATIONAL SATURDAY, AUGUST 8, 2015
Jewish extremism crackdown draws in a familiar family
JERUSALEM: His long beard, dangling attack at a Gay Pride parade in Jerusalem security agency labeled him the head of Hilltop Youths sidelocks and wide smile give him the look that wounded five people and killed a 16- an “ideological infrastructure” responsible A number of illegal Jewish outposts of a hippie from another era, but Meir year-old girl. The incidents were unrelated, for the arson. According to the Shin Bet, have sprung up in the mountains of the Ettinger has become the symbol of a crack- with the suspect in the Gay Pride stabbings the same “infrastructure” vandalized a West Bank on land Palestinians view as down on Jewish extremism. The young an ultra-Orthodox Jew carrying out a “lone monastery in 2014 and unsuccessfully part of a future state of their own. All Israeli man, whose grandfather headed a racist wolf”-type attack. The firebombing howev- sought to disrupt Pope Benedict’s visit settlements in the West Bank are consid- movement, was arrested on Monday, the er follows a pattern of such actions by sus- the same year. Ettinger’s family is no ered illegal under international law. Israel first alleged extremist to be taken into cus- pected Jewish extremists against stranger to controversy. His grandfather grants approvals for settlements, but tody in connection with Israeli Prime Palestinians, Christians and even the Israeli Meir Kahane founded Kach, a racist move- unauthorized outposts are also illegal Minister Benjamin Netanyahu’s pledge of military. Ettinger, 23 and from Jerusalem, is ment that wanted to chase Arabs from under its laws. Ettinger wandered from one “zero tolerance”. The push to crack down accused of being a key figure in an amor- Israel and which was banned in 1988. outpost to another, allegedly becoming on Jewish extremism follows the July 31 phous band of youths who have engaged Kahane was assassinated in New York in part of what is known as the “Hilltop firebombing of a Palestinian home in the in such violence. 1990. His father is a rabbi at two religious Youth,” a loose band of militants who left West Bank that killed an 18-month-old After the torching of part of a shrine in schools in Jerusalem. His parents disap- their schools and families to live in what child and critically wounded his parents northern Israel in June where Christians proved of his radical stance, and when he they see as “Judea and Samaria”-the name and four-year-old brother. believe Jesus performed the miracle of was 17, Ettinger left to live in the Israeli- given to the West Bank in reference to the It came only hours after a stabbing loaves and fishes, the Shin Bet internal occupied West Bank. ancient Biblical kingdoms.— AFP
Jewish extremism: new fears over old problem Fears mount for Croatian
JERUSALEM: A stabbing attack at a Gay Pride march in abducted by Islamic State Jerusalem and a firebombing that killed a Palestinian child in the West Bank last week have raised concerns over Jewish extrem- ism. Israeli authorities have arrested three alleged Jewish Egypt jihadists threaten to execute Salopek extremists-placing one in a controversial form of detention with- out trial-and pledged to use all means at their disposal to crack CAIRO: Fears mounted over the fate of a down on such activities. Here is a look at such extremism: Croatian abducted in Egypt by Islamic State group militants who threatened to execute Were the two attacks related? him yesterday. Croatian President Kolinda No. The suspect in the July 30 Gay Pride stabbings, which Grabar-Kitarovic said she would talk to her wounded five people and mortally wounded a 16-year-old girl, is Egyptian counterpart President Abdel Fattah an ultra-Orthodox Jew who has said homosexuality defiles the El-Sisi by telephone as the jihadist deadline name of God. On Wednesday, a judge ordered that he undergo a approached. “Be sure that we are really doing psychiatric evaluation. The July 31 firebombing of a Palestinian our best to solve this,” she was quoted as say- home in the West Bank village of Duma, which killed an 18- ing by the state-run HINA news agency. month-old boy and critically wounded his parents and four-year- The unprecedented abduction in the old brother, is believed to have been connected to “price tag” North African country has rattled foreigners incidents-nationalist-motivated hate crimes. Graffiti near the who flock to Egypt to work for multinational family’s home included a Star of David and the words “revenge” companies, while underscoring the jihadists’ and “long live the Messiah”. reach despite a massive military campaign against them. Although Egypt is fighting an What is ‘price tag? Islamic State group insurgency in the sparsely “Price tag” refers to the idea that there is a price to be paid for populated Sinai Peninsula, it had been largely activity that offends the extremists. Some have speculated that spared the horrific kidnappings conducted by the firebombing was in response to a court-ordered demolition the Islamic State group in Syria, Iraq and Libya. of two illegal settlement buildings in the West Bank. The father of Tomislav Salopek, who works for the French geoscience company CGG, Who are the extremists? called on the kidnappers to release the 31- “Price-tag” assailants are seen less as members of a particular year-old father of two, as Croatian Foreign group and more as a loosely organized band. Some are known as Minister Vesna Pusic said she was leaving for the “Hilltop Youth,” militants from illegal outposts in the West Cairo to follow the case. “I am asking the peo- VRPOLJE: Photo shows the house of 31-year-old Tomislav Salopek in Vrpolje in Bank or those that sympathize with them. “It’s not an orderly ple who hold my son to let him return to his eastern Croatia. Egypt’s affiliate of the Islamic State group has threatened to organization with hierarchy, a head and a tail, and in the middle family, because his motive to go to your execute a Croatian kidnapped in Cairo last month within 48 hours if Muslim activists,” said Avi Dichter, a former head of Israel’s domestic homeland was exclusively to earn bread for women jailed in Egypt are not freed.— AFP security agency Shin Bet. “But there are people who simply do his children. Nothing else,” Zlatko Salopek told not accept anyone’s authority... They envision an entity based on AFP at the family’s home in the eastern Salopek had appeared in an Islamic State the group changed its name when it pledged Jewish law, where only God gives instructions.” There have also Croatian town of Vrpolje. video released on the internet on Wednesday, allegiance to IS in November. Last December, been more organized groups such as Lehava, which opposes kneeling next to a masked militant holding a the jihadists claimed they killed an American fraternization between Jews and gentiles. Lehava’s leader, Benzi knife. Reading from a paper, he said that his working for petroleum company Apache, also Gopstein, reportedly said this week that churches should be captors would execute him in 48 hours if the west of Cairo. That attack was at first treated torched. Another group, the anti-Arab movement Kach, was Egyptian government did not release female as a deadly carjacking by police. In July, IS said founded by Meir Kahane, a rabbi assassinated in 1990 in New prisoners, which has been a demand of it was behind a car bomb attack targeting the York. Kahane’s grandson, Meir Ettinger, 23, is one of the three Islamist militants over the past two years. Italian consulate in Cairo-the first such attack alleged extremists arrested since last week’s firebombing. None Thousands of people, most of them Islamists, against a foreign mission in Egypt since of the three have been directly accused of the firebombing. have been jailed since the army overthrew jihadists began their campaign following the Islamist president Mohamed Morsi in 2013 crackdown on Islamists. What drives the extremists? and unleashed a deadly crackdown on his fol- The video of Salopek was released the A range of motivations that sometimes overlap. Religion can lowers. day before a lavish ceremony at the Suez be a driving factor, as in June when extremists torched part of a Canal to celebrate an expansion of the shrine in northern Israel where Christians believe Jesus carried Kidnapped from car waterway, with a host of world leaders in out the miracle of loaves and fishes. Other incidents have been Salopek was abducted last month on a attendance. President Abdel Fattah El-Sisi, related to limits on settlement building in the West Bank. road running from the west of Cairo. His driver who as army chief toppled Morsi, pledged Mosques have been torched and attacks have even targeted was left unharmed and police say they have at the ceremony to “defeat” the militants. Israeli military property. questioned him. It was not clear where the The army says it has killed more than 1,000 “Many of them are disconnected, drop-outs from the educa- militants were holding Salopek in the vast and militants over the past few years, but the tional system,” said Mally Shechory-Bitton, a criminologist at An image grab shows Croatian mostly desert country. While the jihadists insurgency in Sinai appears unabated. The Ariel University. “They found their life’s goal in an extremist national Tomislav Salopek kneeling mostly operate in Sinai, in northeastern Egypt, jihadists have killed hundreds of soldiers ideology and supposed religious values, which they think on the sand next to an IS flag, in front they have also conducted attacks in the coun- and policemen and even destroyed a navy they’re fulfilling but are actually a distortion of religion and its of a man, while holding a piece of try’s western desert over the past two years. vessel with a wire guided missile last values.”— AFP paper. —AFP Formerly known as Ansar Beit Al-Maqdis, month.— AFP INTERNATIONAL SATURDAY, AUGUST 8, 2015
Germany tries to stem tide of Balkan asylum seekers
BERLIN: Germany, overwhelmed by people In the first five months of 2015, more pains to point out, does not qualify them placing them in temporary shelters near fleeing war and poverty, is trying to deter than 32,000 Kosovars arrived, for example- for political asylum. Fewer than 0.2 percent the border for a speedy return. The aim is asylum seekers from the Balkans, a region more than came from war-torn Syria. “The of their applications are successful, but “rapid asylum procedures for people who now considered safe at least from armed high number of migrants from these coun- they often wait for months in refugee cen- have no prospect of being able to stay, to conflict. Ideas range from cutting refugees’ tries diverts resources that we need to take tres, flats, residential containers and even relieve the system,” said the premier of the allowances, to channeling them into sepa- care of people from the crisis regions,” said tent cities while their applications are conservative southern state, Horst rate holding camps, to campaigns in their Manfred Schmidt, head of the Office for processed. Seehofer. The Bavarian plan has met with home countries to discourage them from Migration and Refugees. Germany, now indignation on the political left and among travelling to Europe’s biggest economy. Europe’s number one destination for asy- ‘No economic asylum’ migrant rights groups. Critics say it stigma- About half of Germany’s 300,000 asylum lum seekers, has struggled to process, New ideas abound about how to dis- tizes entire populations and defies each applications since January have come from house and feed a record number, which is courage prospective travelers and reduce individual’s right to apply for asylum, irre- the southeast European region that expected to top 500,000 this year. Often of the backlog of cases in the system and ide- spective of their chances. Many people includes Albania, Bosnia, Bulgaria, Croatia, Roma origin, many Balkan nationals come ally to cut waiting times to six weeks. from the Balkans, especially from ethnic Kosovo, Macedonia, Montenegro and to Germany in hopes of finding work and a Bavaria state has proposed separating minorities, may suffer harsh discrimination Serbia. better life-a motivation that, Berlin is at migrants from the Balkans on arrival and and systemic racism, they argue.—AFP
Cyprus digs up the past with hunt for remains of Greek commandos
NICOSIA: In the pre-dawn hours of July 22, 1974, a transport plane full of Greek commandos on a secret mission to Cyprus was shot down by friendly fire. For more than 40 years, the exact whereabouts of the remains of 19 of the soldiers-sent to support Greek Cypriot forces against invading Turkish troops-has been a mystery. But now efforts are underway at a Nicosia military cemetery to unearth the remains and finally send them home, digging up an ugly past that has haunted the soldiers’ families and ties between Greece and Cyprus. Due to its embarrassing circumstances-Greek Cypriots shooting down Greek comrades-the incident has been largely brushed over in the aftermath of the war in Cyprus. “It was shot down by friendly fire and it crashed, and under instructions of the army, they buried it... it was an embarrassment,” human rights lawyer Achilleas Demetriades said. “It is unacceptable that it took so long to dig up a known grave to deliver remains to the loved ones,” he said. In fact, the move comes only after the families of two Greek army officers who died in the incident brought a case to the European Court of Human Rights. This prompted the government to dig up the transport. The aircraft-the Noratlas-was part of a secret mission codenamed Operation Niki (Victory) to airlift a commando battalion from Greece to help the Greek Cypriot National Guard fend off the better-equipped and much larger Turkish army.
Mistaken as hostile Turkey invaded the northern part of Cyprus on July 20, 1974 in ATHENS: Migrants clean their clothes in a park in central Athens yesterday, where they have found tempo- response to a coup orchestrated by the Greek military to unite the rary shelter after arriving from Greek islands. — AFP Mediterranean island with Greece. It remains split into a Turkish-held north and Greek Cypriot south. Thirteen aircraft were dispatched from the Greek island of Crete with commandos on board. In order to evade Refugees cheer, pray, embrace Turkish forces, the Greek planes flew in low when reaching Cyprus, with no communications and the lights switched off as they headed for Nicosia airport. The Noratlas came under a barrage of anti-aircraft strangers as they reach Greece fire as the Greek Cypriots mistook the aircraft as hostile. It crashed close to the runway at around 3:00 am. All but one of the 28 commandos Two boatloads arrive in Lesbos within an hour and four crew on board were killed. One soldier miraculously survived after jumping out of the burning aircraft before it smashed into the LESBOS: The man in a red and white of the year, representing what the European of Mithimna and Skala Sykaminias. It is ground. checked shirt gingerly waded through the Union has described as one of the biggest strewn with debris from inflatable dinghies The remains of those onboard were thought to be buried at a near- water holding an infant. Seconds after shrug- humanitarian crises since World War II. “I and life jackets left in piles along the shore. by military cemetery in Lakatamia. In 1979, some remains were sent ging off a life jacket, Syrian refugee Mustafa don’t care where I go, I’m just so glad to be The dinghies are slashed when refugees back to their families in Greece, but only those of 12 commandos have Mohammad embraced the first person he out of Syria. We all deserve to live,” said a 26- reach land. In both of Thursday’s cases, and been properly identified through DNA sampling. A search for the oth- met in Greece. A two-hour sea journey from year-old man, travelling with his younger sis- within minutes, men in double cabin pick- ers at Lakatamia in May failed to locate any remains-so the hunt has the western shores of Turkey, this bamboo- ter. A barber by profession, he would only ups arrived on the remote track to retrieve switched to the Makedonitissa cemetery and war memorial, adjacent fringed coastline on the northern Greek give his first name, Issa. “My parents are still what could be salvaged; the expensive to the now defunct airport which serves as a United Nations com- island of Lesbos has become the main gate- in Homs,” he said, a war-ravaged Syrian city motors and a wooden and fibreglass base pound. The memorial was built over the site where the plane went way into the European Union for refugees which has seen some of the fiercest fighting used at the bottom of each dinghy. down and was buried. fleeing conflict in Syria and the wider Middle in the in that country’s conflict. The UN Observers say the flow of refugees reach- East. Others on the inflatable white dinghy refugee agency, UNHCR, estimates that es on average 250 daily. Some make their ‘Send them home with honor’ whooped and cheered as they hit land. Two Greece has received more than 107,000 way to volunteers who make arrangements Cypriot humanitarian affairs commissioner Fotis Fotiou said an ini- men alighted and knelt on the pebble beach, refugees and migrants this year, more than for them to be fed and buses to reach the tial search yielded positive results-a 50-centimetre piece of the their foreheads touching the stones in double its 43,500 intake of 2014. From sever- main city of the island, Mitilini, where they Noratlas was found using a metal detector. “The findings are positive prayer. A woman wearing a hijab picked up a al accounts of people now in reception cen- are taken to reception centers for identifica- in that the first indications show that the doomed aircraft is here,” pebble and hurled it into the sea. ters on the island waiting for papers to move tion. Others walk. Not knowing where they Fotiou told reporters on Thursday during a visit to the excavation site. Within one hour on Thursday, Reuters to other European countries, dinghies are the are going, the boatpeople take to the dusty He said there was danger involved in the project as there were explo- journalists on the island saw two boatloads primary means of transport across a sea strait road to reach the nearest community about sives and ammunition on the buried aircraft. There is no timeframe for of refugees landing on the Greek territory, about 20 km between Turkey and Lesbos. 10 km away. Mustafa Mohammad is still elat- when the excavation might be complete but authorities believe it one carrying roughly 40 Syrians, the other ed, but looks confused. “Where do I go now?” should be finished by November. “Certainly our aim is to find the fuse- the same number of Afghans. They are Hundreds daily he asked, before following the rest of the lage and locate the remains of the fallen... we will do everything possi- among the tens of thousands who have Testament to that is the dirt track refugees kicking up dust as they walked up a ble to find them and send them home with honor,” Fotiou said.—AFP entered Greece illegally since the beginning between the northern Lesbos communities mountain.— Reuters INTERNATIONAL SATURDAY, AUGUST 8, 2015
Myanmar flood death toll climbs to 88
NYAUNG DON: The death toll from severe flooding disaster struck. monasteries or community groups. Authorities across Myanmar has risen to 88, officials said yester- Impoverished western Rakhine state has suffered have insisted that crucial elections set for day, as rising waters swallowed more homes in low- the highest number of fatalities so far, the state-run November 8 will go ahead despite the disruption lying regions in some of the poorest parts of the Global New Light of Myanmar reported, with at least caused by the floods even as they try to assess the country. More than 330,000 people have been affect- 55 killed after Cyclone Komen tore across the Bay of scale of the damage. More than 200,000 acres of ed by torrential monsoon rains that triggered flash Bengal last week. The heavy monsoon downpours farmland have been ruined and large numbers of floods and landslides, cutting off communications as have caused devastation across large parts of South animals killed as well as the thousands of homes the deluge engulfed roads and destroyed bridges. and Southeast Asia in recent weeks, claiming hun- lost, according to state media. Residents have raced to bolster sand-bag dreds of lives and displacing millions. In Myanmar, Fears are also growing over malnutrition as defenses along the Irrawaddy river in the southwest where 12 out of 14 states and regions have suffered some of the worst-hit areas are among the coun- as floodwaters swell the mighty waterway, swamp- flooding, international aid has stepped up in recent try’s poorest, according to the UN’s World Food ing dozens of villages as the waters drain from fur- days following an official government request for Program. “Thousands of people have lost homes, ther north. “Nothing like this has happened before, help. Myanmar’s previous junta government was livelihoods, crops and existing food and seed but I am not the only one suffering,” said Soe Min accused of indifference in its sluggish response to stocks. Food security will be seriously affected,” Paing, a fisherman from Kyauk Taing village in Cyclone Nargis in May 2008, a crisis which left nearly WFP Country Director Dom Scalpelli said in a state- Nyaung Don township, whose home has been 140,000 people dead or missing. ment. In a statement released yesterday the inundated. The death toll has risen to 88 from 74 on The quasi-civilian regime which replaced out- European Union announced the EU and its Member Thursday, according to Phyu Lei Lei Tun of the right military rule in 2011 has been eager to show it States would donate an extra 4.5 million euros ($5 social welfare ministry, although this could climb is mobilizing. But many of those affected by the million) in emergency aid to Myanmar in response again as relief teams reach isolated areas, some of flooding appear not to be relying on government to the government’s appeal for international assis- which remain cut off more than a week after the help, either trying to cope alone or turning to local tance.— AFP
Truck bomb kills 15, Secular blogger hacked wounds 240 in Kabul KABUL: A huge truck bomb tore through central Kabul yes- to death in Bangladesh terday, killing 15 civilians and wounding 240 others in the first major attack in the Afghan capital since the announce- ment of Taleban leader Mullah Omar’s death. No group Fourth such murder this year immediately claimed responsibility for the attack, which came as the Taleban steps up their summer offensive despite DHAKA: A gang armed with machetes a bitter power transition within the militant movement. A hacked a secular blogger to death at his truck packed with explosives detonated just after midnight home in Dhaka yesterday, sparking near an army base in the neighborhood of Shah Shaheed, protests in the capital over the fourth rattling homes across the city, ripping off the facades of such murder in Bangladesh this year. buildings and leaving scattered piles of rubble. The force of Niloy Chakrabarti, who used the pen- the explosion created an enormous crater in the road, name Niloy Neel, was killed after the gang around 10 meters deep, and destroyed the boundary wall of broke into his apartment, according to the base, although no military casualties were reported. the Bangladesh Blogger and Activist “The death toll from the yesterday attack... has risen to Network, which was alerted to the attack 15,” deputy presidential spokesman Sayed Zafar Hashemi by a witness. “They entered his room in said, adding that “more than 240 people have been wound- the fifth floor and shoved his friend aside ed”. The health ministry said the number of wounded could and then hacked him to death. He was a run even higher, with most suffering injuries from flying listed target of the Islamist militants,” the glass. Kabul police chief General Abdul Rahman Rahimi said network’s head, Imran H Sarker said. officials were searching for anyone trapped under the man- Police confirmed Chakrabarti, 40, had gled concrete debris. “The killed and wounded include been murdered by a group of half a women and children, and laborers of a nearby marble stone dozen people in the capital’s Goran company are among the victims. The attack was intended to neighborhood, although they had no details on the motive for the killing. DHAKA: Blood is seen on the floor where Bangladeshi blogger Niloy cause mass murder,” he said. Chakrabarti, who used the pen-name Niloy Neel, was murdered at his home in Soldiers erected a security cordon around the military “There were six people who knocked on his door, saying that they were looking to Dhaka yesterday. A gang armed with machetes hacked a secular blogger to base close to Shah Shaheed, a largely middle-class civilian death at his home in Dhaka, sparking protests in the capital over the fourth residential area with no major foreign presence. The wound- rent a flat,” Muntashirul Islam, a deputy police commissioner said. “Two of them such murder in Bangladesh this year. — AFP ed were overwhelming city hospitals, officials said, with then took him to a room and then slaugh- reports emerging of blood shortages and urgent appeals for gers. Asif Mohiuddin, another blogger who called “this spate of savage killings”. tered him there,” Islam said. “His wife was himself survived an attack in Bangladesh in “There is little doubt that these espe- donors circulating on social media. The carnage comes a day in the flat but she was confined to anoth- 2013, described Chakrabarti as an atheist cially brutal killings are designed to sow after Taleban insurgents killed nine people in multiple er room.” Mahbubur Rahman, another “free thinker” whose posts appeared on fear and to have a chilling effect on free attacks on police targets, including a truck bombing in the deputy commissioner, told reporters that several sites. “He was critical against reli- speech. This is unacceptable,” said David volatile eastern province of Logar. The attacks highlight Chakrabarti’s wife had been heard crying gions and wrote against Islamist, Hindu, Griffiths, the London-based rights group’s growing insecurity in the country amid a faltering peace out “Save us! Save us!” during the attack Christian and Buddhist fundamentalism,” South Asia research director. “The price process with the Taleban as Afghan forces face their first but no one had responded. Mohiuddin, who is now based in the for holding opinions and expressing them summer fighting season without full NATO support. He is the fourth secular blogger to be German capital Berlin said by phone. freely must not be death. The killed in the Muslim-majority nation since Police meanwhile said Chakrabarti Bangladeshi authorities now have an ‘Contemptible act’ February, when Bangladeshi-born US citi- had been one of the organizers of the urgent duty to make clear that no more The NATO mission in Afghanistan condemned yesterday’s zen Avijit Roy was hacked to death in large-scale protests in 2013 against attacks like this will be tolerated.” bombing as a “contemptible act of violence”. Taleban Dhaka. Roy’s wife was also badly wound- Islamists convicted of war crimes dating Bangladesh banned the hardline spokesman Zabihullah Mujahid said he was “unaware” of the ed in the attack. The other victims include back to the 1971 conflict when Islamist group Ansarullah Bangla Team Kabul bombing. The militants are known to distance them- Ananta Bijoy, Das who was attacked by a Bangladesh seceded from Pakistan. (ABT) following Das’s murder in May, selves from attacks that result in a large number of civilian group wielding machetes on May 13 as Immediately after the murder, hundreds after facing accusations that they were casualties. A UN report published Wednesday said civilian he headed to work in Sylhet, and 27-year- of secular activists joined a protest march doing too little to stop such attacks. In a casualties in Afghanistan hit a record high in the first half of old Washiqur Rahman who was hacked to in the city’s Shahbagh Square, which was recent petition addressed to Prime 2015. The report said 1,592 civilians were killed, a six percent death in Dhaka in March. Most secular also the venue for the 2013 demonstra- Minister Sheikh Hasina, authors including fall from last year, but the number of injured jumped four bloggers have either gone into hiding, tions. Salman Rushdie and Margaret Atwood percent to 3,329. Overall, casualties reached their highest often using pseudonyms in their posts, or “We’re protesting a culture of impuni- called on her government “to do all in level since the UN began issuing its authoritative reports in have fled abroad. ty in Bangladesh. One after another blog- their power to ensure that the tragic 2009. The statistics are a grim indicator of the expanding ger is being killed and yet there is no events... are not repeated, and to bring insurgency, with Afghan forces increasingly battling the mili- Bloggers in hiding action to stop these murderers,” said the perpetrators to justice”. Bangladesh is tants on their own after NATO’s combat mission ended in Activist groups say they fear that Sarker, who was among the protestors. an officially secular country, but more December. — AFP Islamist hit squads have lists that contain Amnesty International said the govern- than 90 percent of its 160 million people the real names and addresses of the blog- ment had to do more to stop what it are Muslim. — AFP INTERNATIONAL SATURDAY, AUGUST 8, 2015 Philippines’ Aeta people ‘beggars’ in their land SAPANG UWAK: Philippine bush man Edward Serrano struck two rocks together and wrapped the faint spark in wood shav- ings, building a fire in much the same way Stone Age man must have done two million years ago. The short, Afro-ed jungle sur- vival instructor is an Aeta, from one of the most unique ethnolin- guistic peoples of the Philippines, who are also the archipelago’s first known inhabitants. But after hunting and gathering for most of the past 40,000 years, their bushcraft is nearly forgotten, many of their lan- guages are all but extinct, and their way of life is swiftly dying out. Rapid urbanization has turned tiny Aeta forest settlements into virtual islands, their nomadic lifestyle shut down as the deer, warthog and jungle fowl they hunt for food are extirpated. “We can no longer do many of the things that our ancestors took for granted,” said Serrano, a high-school dropout who teaches sol- diers and police how to make fire without matches or lighters. He teaches them where look for water, should they get lost in the jungle, and which leaves, fruits and seeds are safe to eat- skills learnt from his father. Sapang Uwak, which means Crow Creek, his sun-baked village in the foothills of the Pinatubo vol- cano about two hours’ drive from Manila, showcases both the old way of life-and the disruption of the new. Languid water buf- faloes pull carts filled with bananas and taro along dirt roads, parched river beds and forests that the community of 1,700 peo- ple claim as their ancestral domain. But to leave their village to SAPANG UWAK: An Aeta rides a water buffalo that pulls a bamboo sleds in Sapang Uwak. —AFP take their produce to market or find work as farmhands or con- struction workers, they have to pass through a giant private entertainment park. Turkey’s Erdogan ready ‘Aliens in our own land’ A 1997 law recognised the rights of some 15 million ethnic minorities to their ancestral lands, and Sapang Uwak and nearby Aeta settlements have filed claims on a combined 17,000 for snap polls gamble hectares (42,000 acres). However, the government has yet to define the boundaries of many areas, fuelling fears of encroach- A high-stakes gamble ment by private developers, said Roman King, leader of an asso- ciation of Aeta communities. “We were the first peoples of the Philippines, but now we are aliens in our own country,” said King, ISTANBUL: Bruised by one of the worst setbacks of his political career, present a proposal for a coalition to Erdogan, after which the president a retired policeman from the nearby settlement of Inararo. “If we Turkey’s pugnacious President Recep Tayyip Erdogan is ready to play the can call new elections. Analysts say the most likely scenario is the current lose our lands we have nowhere else to go... You’ll see more of card of calling snap polls in a high-stakes gamble that could yet backfire. AKP cabinet will stumble on as a minority government propped up by us begging in the streets,” he said. Erdogan’s Justice and Development Party (AKP) failed to win an overall the Nationalist Movement Party (MHP) before early elections are called Most of the Philippines’ estimated seven million Aetas live in majority in June legislative elections for the first time since coming to for November or in 2016. “If political parties fail to form a coalition gov- tiny, isolated communities, engaged in slash-and-burn farming- power in 2002, forcing it into the messy business of coalition politics. The ernment, probably an AKP minority government will take Turkey into a clearing forests for fields-moving with the seasons and with limit- result was seen as a personal hiding for Erdogan, whose charisma had new election,” said Ozgur Altug at BGC Partners in Istanbul. Pro-AKP ed contact with the outside world. Aside from Sapang Uwak, turned the AKP into one of the world’s most successful election-winning newspapers have argued that internal polling has shown that the party three other Pinatubo Aeta communities have won titles to 39,000 machines and who had dreamt of ruling Turkey under a new presidential would improve on its June 7 score of 40.9 percent in a re-run of the elec- hectares, giving the families steady cash from land leased to quar- system. Talks to form a coalition have since rumbled on, with a grand tions to win an overall majority. ries, golf courses, and tourist resorts. But it is a cumbersome coalition between the AKP and the main opposition Republican People’s process and typically takes years to complete, said Jonathan Party (CHP) looking like the only viable option. The political impasse has ‘A big risk’ Adaci, director of the ancestral domains office at the National come as Turkey is plunged into one of the biggest security crises of the But analysts are far from convinced the results would be so different. Commission on Indigenous Peoples. A mere 180 titles have been AKP’s rule, with the military pursuing a controversial cross-border “anti- The AKP would hope to squeeze the pro-Kurdish Peoples’ Democratic handed out nationwide, with some five million other claims still terror” operation against Islamic State jihadists in Syria and Kurdish mili- Party (HDP) - which won 13.1 percent of the vote in June-back below the being processed, Adaci said. tants in northern Iraq. But Erdogan’s heart never seems to have been in 10 percent threshold required to secure seats in parliament. But achiev- By law ancestral domains cannot be bought nor sold, but this the coalition talks, grumpily declaring that “if we expect coalitions to ing such a change over such a short time may be over ambitious, even has not stopped outsiders from mysteriously obtaining titles. “At bring benefits to our country, it is in vain”. for the well-oiled AKP campaign machine. “At the current stage, an early times there are some powerful people in government involved,” election is a big risk for the AKP,” said Ziya Meral, director of the Centre he said, declining to give names. Unscrupulous people talk une- ‘Heading for early polls’ on Religion and Global Affairs. ducated Aetas into parting with their land inheritance for a pit- Instead, analysts and commentators believe he has another preferred “It appears with the latest developments the HDP’s share of vote will tance, said Cynthia Zayas, a University of the Philippines anthro- scenario in mind-the failure of the coalition talks and a re-run of the elec- not drop but it is a big possibility that the MHP’s will increase,” he added. pologist. “Private developers are eating up their land. The way tions in snap polls to make up the ground lost by the AKP on June 7. “It’s Meral suggested Erdogan may prefer to keep a minority government it’s turning out, they could become squatters in their own land,” now certain. Turkey is heading for early elections,” wrote the well-con- going and then try to pick up votes from nationalists and religious con- Zayas added. The Aetas of Sapang Uwak are dismayed at the nected pro-AKP columnist Abdulkadir Selvi in the Yeni Safak daily. servatives in new elections later in 2016. Critics have accused Erdogan of delays, but feel helpless, said survival instructor Serrano, a father “President Erdogan has wanted early elections since the night of June 7,” launching air strikes against the banned Kurdistan Workers’ Party (PKK) in of seven in his late 30s. “We’ve been pushed out in the past. We he added. “It’s not clear if the AKP will win an overall majority. But they the hope of discrediting the HDP in the eyes of non-Kurdish secular vot- do not want that to happen to us again,” he said.—AFP want to try.” Prime Minister Ahmet Davutoglu has until August 23 to ers who supported the party in June. —AFP North Korea turns back its clocks to ‘Pyongyang Time’ SEOUL: North Korea announced yesterday it was moving its “The wicked Japanese imperialists committed such unpar- challenges, including for operations at the jointly-run Kaesong clocks back 30 minutes to create a new “Pyongyang Time”-break- donable crimes as depriving Korea of even its standard time industrial complex that lies just inside North Korea. ing from a standard imposed by “wicked” Japanese imperialists while mercilessly trampling down its land,” the North’s official “In the short term, there might be some inconvenience in more than a century ago. The change will put the standard time KCNA news agency said. Standard time in pre-colonial Korea had entering and leaving Kaesong,” ministry spokesman Jeong Joon- in North Korea at GMT+8:30, 30 minutes behind South Korea run at GMT+8:30 but was changed to Japan standard time in Hee told reporters. “And in the longer term, there may be some which, like Japan, is at GMT+9:00.North Korea said the time 1912. KCNA said the parliamentary decree reflected “the fallout for efforts to unify standards and reduce differences change, approved on Wednesday by its rubber-stamp parlia- unshakeable faith and will of the service personnel and people between the two sides,” Jeong said. South Korea had similarly ment, would come into effect from August 15, which this year on the 70th anniversary of Korea’s liberation.” Seoul’s Unification changed its standard time in 1954 — again to reflect the break marks the 70th anniversary of the Korean peninsula’s liberation Ministry, which deals with cross-border affairs, said a different from Japanese rule-but reverted to Japan standard time in 1961 from Japan’s 1910-45 colonial rule. time zone between North and South posed a number of possible after Park Chung-Hee came to power in a military coup. —AFP INTERNATIONAL SATURDAY, AUGUST 8, 2015 4 years after massacre, Norwegian youths reclaim island
UTOYA: Four years after Anders Behring “a meeting place for young activists, a stalked and killed so many of the 600 up- ‘Going back to normal’ Breivik shot dead 69 people on Utoya political workshop, a place for culture, and-coming leaders of Labor, Norway’s Norwegian authorities were harshly criti- Island in Norway, about 1,000 Labor Party sport, friendship, and not least, love”. dominant political party, which he cized for their lack of preparedness and youths gathered yesterday for the first “Utoya is also the site of the darkest day blamed for the rise of multiculturalism. their slow response to the attacks at the summer camp to be held there since the in Norway’s peacetime history,” he added. Trapped on the island of just 30 acres, the time. massacre. The right-wing extremist killed “Utoya will always be the place where we campers had nowhere to go, some of The wooded island has received a mainly teenagers in his rampage on July will remember those we lost, but reclaim- them throwing themselves into the sur- facelift ahead of the reopening. New build- 22, 2011, hunting down participants at a ings have been built next to the old ones, camp of the Labor Party’s youth wing which have been carefully renovated. A lit- (AUF) on the tiny heart-shaped island in tle further away, a memorial entitled “The the middle of a lake. Determined to Clearing” has been installed in the woods: a reclaim possession of the site, the young- giant steel ring suspended from the ever- sters-including a handful of survivors-will greens bears the names of 60 of the 69 vic- hold their annual camp from Friday to tims. Sunday. But in a sign that the wounds are far The atmosphere was relaxed as AUF from healed, nine families did not want head Mani Hussaini told the delegates in their loved ones’ names to appear on the his opening speech: “It’s good to be back ring. Some in Norway feel it was too early, home.” In his only direct reference to the even disrespectful, to hold a summer camp carnage of four years ago, Hussaini said: at the scene of the tragedy. But 22-year-old “July 22 will forever be part of Utoya’s his- survivor Ole Martin Juul Slyngstadli was not tory... but today it is also going to move one of them. “There are of course a lot of into Utoya’s past.” NATO Secretary General emotions linked to the scene but I focus on Jens Stoltenberg, who was prime minister the positive ones,” he said. “For me, it’s at the time of the attack, was attending the important to reclaim the island,” he said. camp and tweeted: “It’s good to wake up “We’ve found the balance between the in Utoya and to be surrounded by so many duty of honoring the memory (of the vic- young activists.” tims), dignity and going back to normal,” Many of the teenagers arrived on Utoya he added. on Thursday, with many pitching their While Breivik said his goal was to wipe tents near the cafeteria, a poignant symbol out the next generation of Labor politi- of the massacre as Breivik killed 13 youths cians, his attacks appear to have had the there. Bullet holes can still be seen in the opposite effect. AUF’s membership has building. Before the seminars and speech- soared by almost 50 percent since the mas- es began on Friday, the teenagers held UTOYA: Activists of Norwegian Labor party youth division (AUF) play volleyball dur- sacre to reach just under 14,000. Among high-spirited games of football or volley- ing the first summer camp of the AUF since the 2011 bloodbath at the Utoya Island the new members are children of migrant ball, although armed police guards kept a some 40 km west of Oslo yesterday. On July 22, 2011 far-right extremist Anders families, who represent everything Breivik careful watch. Two police boats are guard- hated. “I felt it was important, that I wanted ing the waters around Utoya. Many of the Behring Breivik massacred 69 people during an AUF camp on the island. —AFP to make a contribution,” said 22-year-old delegates wore T-shirts bearing the party Joel Gianni, whose parents are from Eritrea, slogan “Working Class Hero”. ing Utoya for the summer camp is about rounding chilly waters. Just before the and who says he joined the party after the not letting the dark history overshadow shootings, Breivik had killed eight people attack. Breivik is in solitary confinement ‘Darkest day’ the light,” he said. with a bomb that exploded near the gov- serving a 21-year prison sentence, which Hussaini told reporters taken to visit Breivik’s shooting spree lasted an hour ernment headquarters in Oslo, some 40 can be extended indefinitely as long as he the island earlier this week that Utoya was and 13 minutes, as he methodically kilometers away. is considered a danger to society. —AFP INTERNATIONAL SATURDAY, AUGUST 8, 2015
Republican debate: the good, the bad and the Trump-y
CLEVELAND: Republican White House their body parts and sell them like they’re hopefuls took to the stage Thursday for a parts to a Buick,” he said. packed debate that touched on fiercely divi- sive issues, including abortion, immigration, Gay rights gay rights and national security. The night Governor John Kasich took a unifying saw a few heated exchanges, some emotion- stance on gay rights, telling the crowd about al moments, a couple of laughs-and plenty of a recent same-sex wedding he attended. antics from the ever-explosive Donald ”Because somebody doesn’t think the way I Trump. Here are a few highlights, lowlights do, doesn’t mean I can’t care about them or and unforgettable quotes from the night. love them. If one of my daughters happened to be there, of course I would love them and Low blow for Rosie accept them,” he said. When asked about calling some women fat pigs, dogs, slobs or disgusting animals, Gun rights Donald Trump was quick to answer, deliver- Senator Rand Paul, however, rejected the ing a low blow to a longtime and very vocal recent decision by the Supreme Court to rival. “Only Rosie O’Donnell,” he said of the legalize same-sex unions and threw in a case actress and talkshow host, to an aghast for his right to bear arms too. “Look, I don’t OHIO: Republican presidential candidates arrive on stage for the crowd. want my marriage or my guns registered in Republican presidential debate at the Quicken Loans Arena in Cleveland, Washington,” he stated. Ohio. — AFP Baby organs Candidates were eager to express their Hillary, Hillary... pro-life stance in the wake of a scandal No one was afraid to dish it out to who is very high in the polls, but doesn’t for a donation he made to the Clinton family involving a secret recording of Planned Democratic candidate Hillary Clinton. Ben have a clue about how to govern. A person foundation, but he made it clear he regrets Parenthood staffers discussing abortion Carson: “If Hillary is the candidate, which I who has been filled with scandals and who the philanthropy. “I said ‘be at me wedding’ techniques and the sale of aborted embryos. doubt, that would be a dream come true... could not lead. And of course, I’m talking and she came to my wedding. She had no Governor Mike Huckabee didn’t dance She is the epitome of the progressive, the about Hillary Clinton.” choice because I gave to a foundation and around the topic. “It’s time that we recog- secular progressive movement. And she frankly that foundation is supposed to do nize the Supreme Court is not the supreme counts on the fact that people are unin- ...And more Hillary good. I didn’t know her money would be being and we change the policy to be pro- formed.” Mike Huckabee: “It seems like this Trump boasted that Hillary Clinton used on private jets going all over the world. life and protect children instead of rip up election has been a whole lot about a person attended his wedding, ostensibly as payback It was,” he said. — AFP
Ten years on, Katrina’s scars In split with Obama, Chuck endure for black New Orleans Schumer opposes Iran deal WASHINGTON: Sen Chuck Schumer, a New York Democrat expect- 2005 storm killed over 1,800 - the costliest in US history ed to be the party’s next leader in the Senate, said he will oppose the Iran nuclear deal in spite of President Barack Obama’s intense lobby- NEW ORLEANS: A decade after Hurricane Katrina population. The number of African- transportation to see a doctor, or help babysit. ing in favor of the accord. The deal, struck last month with Tehran Katrina, New Orleans seems to have found its Americans has plunged by nearly 100,000 since “That was a very unique piece of the fabric of and Western powers, would curb Iran’s nuclear program in rhythm again: The French Quarter is choked the storm, while there are now about 10,000 New Orleans,” said Erika McConduit-Diggs, exchange for billions of dollars in relief from crippling sanctions. with tourists, construction cranes tower over fewer white residents, according to Census fig- president of the Urban League of Greater New “The very real risk that Iran will not moderate and will, instead, use the skyline, and hipsters bike to cafes in gentri- ures and the Data Center, a local nonprofit Orleans, which advocates for African-Americans the agreement to pursue its nefarious goals is too great,” Schumer fying neighborhoods. But recovery has been tracking demographic and economic trends. and other underserved groups. “What Katrina said in opposing the pact. He said he based his decision on the uneven in the city, which took the brunt of the Before the hurricane, African-Americans did was break down a lot of those social net- nuclear and non-nuclear elements of the accord and on the ques- 2005 storm that killed more than 1,800 people comprised 67 percent of the population. By works, and I think that has also had an impact tion, “Are we better off with the agreement or without it?” and was the costliest in US history. Many prop- 2014, that dwindled to 60 percent, the Census on our recovery.” A leading Jewish Democrat, Schumer was the first senator of erties still bear physical scars from the hurri- reported. Orleans Parish, which has the same With the shifting composition of its elec- Obama’s party to step forward to oppose the deal. His announce- cane, particularly in poorer African-American boundaries as the city of New Orleans, is the torate, post-Katrina New Orleans has elected, at ment Thursday night came just hours after two other Senate neighborhoods. Social, demographic and politi- only county or parish in the United States with various points, a majority-white city council, a Democrats - New York’s Kirsten Gillibrand and New Hampshire’s cal changes still ripple through the city. at least 4,500 African-Americans that experi- white district attorney and a white mayor, Jeanne Shaheen - announced their support for the international In the mostly black Lower Ninth Ward, dev- enced such a steep decline between 2000 and which had not been seen in decades. “That was accord. “After deep study, careful thought and considerable soul- astated by the flooding, Charles Brown is still 2010, a Reuters analysis found, based on the something that no one ever would have searching, I have decided I must oppose the agreement and will attending services in his pastor’s nearly empty Census counts before and after Katrina. thought would happen,” said Edward vote yes on a motion of disapproval,” he said in a statement issued living room, waiting for the day when Mount Some of the black population moved out to Chervenak, director of the Survey Research weeks before he will cast a vote. Nebo Bible Baptist Church is rebuilt. The black the suburbs, the Data Center notes, and some Center at the University of New Orleans. “The population of the city, long a hub of African- gradually are moving back. Every year since politics changed.” Mayor Mitch Landrieu hasn’t Profoundly disagrees American culture, has plummeted since Aug. 2010, the city’s African-American population given up on bringing more people home. He is Schumer’s decision was a blow to the administration, though it 29, 2005, the day Katrina swept in from the Gulf has increased, adding on average several thou- planning trips this month to Atlanta and remained to be seen how many other Democratic lawmakers would of Mexico and overwhelmed the levees meant sand residents. Yet some who came back say Houston, where many of the displaced relocat- follow the New York senator. He informed the White House of his to prevent flooding in the low-lying city. they live in a different New Orleans. Tracie L ed, a city official said. He can tout new medical decision Thursday afternoon. New York Rep Eliot Engel, who is Income gaps between blacks and whites Washington, director of the nonprofit Louisiana facilities and schools that have been over- Jewish and the top Democrat on the House Foreign Affairs have widened. Many African-American neigh- Justice Institute, returned to New Orleans after hauled as signs that New Orleans is rising again Committee, said in a statement that he too would oppose the deal. borhoods and the businesses supporting them evacuating. Today she says something feels off after a long decline. Secretary of State John Kerry said Friday he “profoundly disagrees” have not fully recovered. Brown’s family and in the city. She compares it to a missed beat in with the reasoning behind the lawmakers’ decision to oppose the neighbors were among more than 1 million the brass band parades, called second lines, Income gap widens deal. “It’s a question of eliminating options in a realistic way,” he said evacuated from the region after Katrina, which that weave through its traditionally African- Yet the income gap between black and in Vietnam, where he was marking the 20th anniversary of US- exposed deep poverty in the city, and displaced American neighborhoods on many Sundays. white residents has widened, according to the Vietnam relations. “I would respectfully suggest that rejection is not more people than any other event since the “I’m just one of the survivors,” she said. “There local Urban League. In 2013, the median a policy for the future, it does not offer any alternative.” Kerry added Dust Bowl drought and dust storms of the shouldn’t be so few.” income for African-American households in that if the deal is rejected, “there will be a hue and cry about Iran’s 1930s. Brown, an emergency responder, stayed New Orleans was $25,102, compared to continued activity and that will lead people to put pressure on mili- behind to search for the missing. Social disruption $60,553 for white households. The disparity tary action since the United States would have walked away from “We should have made so much more The scale of the exodus reveals itself clearly has increased by 37 percent since 2005, the diplomatic solution.” progress,” said the 55-year-old Brown in an in the Lower Ninth, one of the only communi- according to figures from the Urban League. Schumer’s split with Obama was remarkable for a senior leader in interview before a series of events the city is ties that has fewer than half as many residents “The folks who are benefiting from the most line to replace Senate Minority Leader Harry Reid, D-Nev., after he planning this month to mark the storm’s 10th as it did a decade ago. Boarded-up windows, positive trends are the white community, retires at the end of next year. His decision also put him at odds with anniversary. “I don’t see anything to celebrate.” caved-in roofs and overgrown lots are common whereas the African-American community by the Democrats’ likely presidential nominee, Hillary Rodham Clinton, The population of New Orleans is now about sights. Lower-income households in this neigh- and large has not benefited in the same way,” who has cautiously embraced the deal. The Senate’s No 2 Democrat, 385,000, according to US Census figures from borhood and others were particularly disrupted said Allison Plyer, chief demographer at the Dick Durbin of Illinois, supports the accord and has been working 2014, representing about 80 percent of its pre- by the loss of a relative or neighbor to provide Data Center. —Reuters hard to persuade lawmakers to do the same. — AP Van, taxi latest lodging In ‘Wild West’, some Days may be numbered Businessoption for NY visitors 16find profit, others pain 18 for ‘everyman’ farmers 19 SATURDAY, AUGUST 8, 2015 Russia destroys more smuggled Western food 17
THESSALONIKI: Panagiotis Papadopoulos, the managing director of a glass products company, inspects a pane of glass in the industrial area of Sindos, a few kilometers west of this northern Greek port city yesterday. — AP Greek firms paralyzed by restrictions Reopening of banks no help
THESSALONIKI, Greece: Panagiotis Papadopoulos, the closed for three weeks and indefinite restrictions on cash recession - but the extent of the downturn will largely owner of a Greek company that builds and exports glass transactions were imposed to prevent banks from failing. depend on how quickly business can return to normal. products like shower cabins, has been waiting three While the banks have since reopened, the government In central Athens, Katherina Athanasopoulou said weeks to pay to a supplier in Bulgaria. It’s not that he imposed new controls on business payments abroad. orders from Germany for chairs from her family-run work- doesn’t have the €45,000 ($49,000) or doesn’t want to Papadopoulos says he was lucky to have received a shop had been canceled out of concern that the deliver- pay. It’s that he needs the approval of a committee run by large supply order just before the banks closed. “But if ies might not get through. “There are days when we don’t the finance ministry in Athens. Any business that wants to this continues, I’ll have problems. I’ll have to turn to the even make 5 euros,” she says as she painstakingly weaves pay a foreign supplier needs this approval because the Greek market for supplies, but it doesn’t provide all the a rush seat. “There is no way we will survive if this contin- government is worried about money flowing out of the materials I use.” Papadopoulos heads the chamber of ues. We have rent to pay, taxes, one thing on top of country due to its financial crisis. While banks have commerce in the northern city of Thessaloniki and was another. We can’t make ends meet.” reopened, this restriction is causing huge pain for compa- due to meet later yesterday with finance ministry officials There were some signs of hope before the banking nies in Greece. to request that restrictions be relaxed. restrictions kicked in: Unemployment fell in May to 25 “They are dealing with a huge volume of requests,” percent from 27 the previous year, and non-oil exports Papadopoulos said yesterday, speaking at his factory out- Firms Fleeing rose 18 percent on the year in June, according to figures side the northern city of Thessaloniki. The restrictions The problem appears particularly acute in northern announced Friday by the Greek Statistical Authority. This have cut the amount of business done by small and medi- Greece, were thousands of firms have applied to move to data, however, does not include the period when banks um sized firms but about half, with three in 10 businesses neighboring Bulgaria to avoid the problem and benefit were shut or when restrictions were placed on payments suffering a drop of more than 70 percent, according to a from much lower tax rates. More than 2,500 businesses outside Greece, notes Christina Sakellaridis, head of the survey published this week by the national trading associ- moved to Bulgaria in the last two years, according to the Panhellenic Exporters Association. The chaos surrounding ation GSEVEE. national traders’ association. Now, about 60,000 more businesses has prompted economists to slash their fore- Papadopoulos is no stranger to tough times. He sur- businesses have applications to set up in Bulgaria, though casts for the Greek economy from mild growth to a pun- vived six years of recession, during which one in every that figure includes firms looking to create subsidiaries. ishing contraction of between 2 percent and 4 percent. four businesses around the country - about 200,000 - col- Months of uncertainty surrounding Greece’s new bailout “Capital controls need to be relaxed,” said Sakellaridis, lapsed. He’s had to lay off almost half of his 60 workers. deal, the banking restrictions and a new round of govern- “And approval for payments made abroad need to be On June 28 this year, his job got even harder: Banks ment budget savings have pushed Greece back into speeded up.” — AP BUSINESS SATURDAY, AUGUST 8, 2015
Gold faces longest weekly losing run since 1999
LONDON: Gold steadied yesterday as other assets like equities,” ActivTrades rencies, while global shares fell, against rates”, said Ric Spooner, chief market ana- investors assessed US non-farm payrolls chief analyst Carlo Alberto de Casa said. which gold is seen as an alternative invest- lyst at CMC Markets in Sydney. “There’s not data that could open the door to a Federal Spot gold, which hit a session low of ment. Analysts continued to see gold’s a lot of natural reasons for investors to buy Reserve interest rate hike in September, $1,082.76 an ounce immediately after the upside as temporary, due to strong gold at the moment. The dollar is getting but was still on course for a weekly fall. US jobs report, managed to rebound 0.5 prospects for the dollar. The metal has lost stronger and there’s no real sign of infla- Nonfarm payrolls increased 215,000 last percent to $1,095.26 by 1245 GMT. It had 7.5 percent this year so far, as investors tion on the horizon with weaker oil prices month as a pickup in construction and fallen to $1,077 on July 24, its weakest positioned themselves for an interest rate and other commodities,” Spooner said. manufacturing employment offset further since February 2010. increase in the United States this year. Gold buyers in Asia were in no hurry, declines in the mining sector, the Labor Prices were still marginally down on the Higher interest rates would put non- anticipating the market to weaken further, Department said yesterday. The unem- week, with a seventh weekly loss in a row yield-bearing gold under further pressure, with premiums in India and Hong Kong ployment rate held at a seven-year low of matching a similar losing streak in May- increasing the opportunity cost of holding picking up only modestly this week. Spot 5.3 percent. “Although the market is read- June 1999. US gold for December delivery the metal. A slew of upbeat US economic platinum was up 0.4 percent at $954.24 an ing the US data as supportive of a Fed rate was up 0.4 percent at $1,094 an ounce. The data, including Thursday’s positive weekly ounce, while palladium rose 1.1 percent to hike in September and is boosting the dol- dollar reversed earlier losses and gained jobless claims, shows “there’s not really $601.50 and silver gained 2.2 percent to lar, it is still finding value in gold against 0.3 percent against a basket of leading cur- much to stop the Fed from increasing $14.89 an ounce. — Reuters Oil heads for 6th weekly loss on gasoline glut
NEW YORK: Crude oil dipped yesterday, plumbing multi-month lows and headed for a sixth straight week of losses, pressured by tumbling gasoline prices as the approaching end of the US summer driving sea- son suggested a growing surplus in fuel supply. The dollar’s rise to a 3- 1/2 month high against a basket of currencies after strong US jobs growth in July also weighed on oil and other commodities denomi- nated in the greenback. Traders and investors were awaiting the latest weekly reading on the US oil rig count from industry firm Baker Hughes for signs on whether crude production could rise from higher drilling activity. Drillers have added 26 oil rigs in the past two weeks. Brent, the global oil benchmark, has traded at six-month lows and US crude at a 4-1/2 month trough since Wednesday after government data showed US gasoline stocks exceeding market estimates last week by about 300,000 barrels. Brent was down 70 cents, or 1.5 percent, at $48.82 a barrel by 11:25 a.m. EDT (1525 GMT), after hitting a Jan. 30 low of $48.55. US crude slipped 50 cents, or 1.1 percent, to $44.16 a barrel. It hit a March 20 bot- tom of $43.94 earlier. Analysts said seasonal refinery maintenance and stock builds in key oil products such as distillates, which include diesel, could drag heavily on crude futures in coming months. NEW YORK: In this Aug 3, 2015, photo, Jonathan Powley, who rents parked vehicles on Airbnb, prepares a 1995 Gasoline sank by more than 1.4 percent to 5-1/2 month lows yester- Chevrolet conversion van, one of his offerings, in the Queens borough. — AP day, and ultra-low-sulfur diesel traded not far from six-year lows set ear- lier in the week. “The summer driving season is fading and we could see a quick ramp up in gasoline stocks,” said Chris Jarvis, analyst at Caprock Van, taxi latest lodging Risk Management in Frederick, Maryland. “We’ve had record refining heading out of the driving season that should translate into higher option for NY visitors stocks of refined products in fall and winter.” —Reuters Dollar up, stocks New adventure for bold, cheap tourists dip after solid NEW YORK: There’s no electricity, no run- For now, all the New York City listings on Brooklyn put down $39 for a night in ning water, no bathroom. But travelers to Airbnb for parked vehicles come from one Powley’s minivan taxi, decorated with yel- US jobs data New York City bold enough to book a owner, Jonathan Powley, a 35-year-old low-and-black bedding, yellow towels and parked van for $22 a night through Airbnb standup comedian and former hotel fresh bananas. The Atlanta natives were LONDON: The dollar gained and Wall Street stock futures do get a real bed and a spectacular view of concierge who has been renting his vehicles moving into a sublet and just needed to extended losses as US jobs data came near enough to the Manhattan skyline from across the East for six months and does his best to antici- crash somewhere for one night. Their black expectations to bolster bets the Federal Reserve will raise River in Queens. “If you want a New York pate every question. Is it legal? Police say Labrador was happy curling up on the floor rates for the first time in nearly a decade this year. The adventure, this is it. Great location, great that as long as it is legally parked, there’s no while they soaked up the shimmering views data showed 215,000 jobs were added in July, slightly view,” says Rapha Schaele, a 23-year-old problem sleeping in a vehicle on the street. of the United Nations and the Empire State below a Reuters poll of 223,000 jobs, but the unemploy- student from Freiburg, Germany, who Is it safe? There have been no problems thus Building. “It’s pretty much the best spot to ment rate held at a seven-year low of 5.3 percent and recently stayed in the van with two friends far with those staying in Powley’s vehicles, have a tiny little staycation,” says Tabitha there were signs that wages were beginning to pick up. for four days. all parked in Queens’ Long Island City, a gen- Akins, a fashion stylist. US stock futures extended earlier losses, dropping 0.2 per- While parked vehicles make up a tiny trifying neighborhood of former industrial Such listings are catching on in other cent on the day. The Dow Jones industrial average was set fraction of the thousands of Airbnb private warehouses and new condo towers. places. Along Portugal’s Costa da Prata, a for its seventh day of losses - its worst run in four years. accommodation listings in New York City - Every day, Powley cleans his four- converted truck comes with a wood-burn- The US dollar jumped against a basket of other curren- just three vans, a converted yellow taxi and wheeled hotel rooms, changes the sheets ing stove and an outdoor picnic table for cies, climbing 0.4 percent on the day to a four-month high two campers - they provide an option for and puts out flowers for new guests. He about $70 a night. In London, a VW van of 98.271. US Treasury yields were flat at 2.23 percent as adventurous, budget-minded visitors seek- arranges with several neighborhood coffee with two bedrooms and a kitchen - but no were European benchmark German yields. European ing a place to rest their heads for far less shops for guests to get free snacks and use toilet - can be had for about $200. While stocks moved up slightly after the data, although the than the $200-and-up most hotels charge. the restrooms. And he directs them to a Powley hopes to eventually make some index remained down 0.3 percent on the day. “The money is perfect,” says Clemens Spath, nearby public pool to shower, a practice he money on his steadily booked listings in “It’s another solid report overall. If you thought that the 24, among the German trio who stayed in encourages. Powley goes the distance for New York, he’s barely breaking even for Fed was going to go in September this report would suit the 78-sq-ft van down by the river. They did special details: For one couple celebrating now. “I’m not doing it for the money. I love that thematic nicely,” said Tom Porcelli, chief US economist complain, however, that the battery-pow- their 40th anniversary in one of his vans, he meeting travelers from all over the world,” at RBC Capital Markets in New York. “I don’t think anything ered fan was not enough to cool them on a bought red rose petals to create a heart he says. “I had a Spanish painter who had has changed in that regard. I think it’s another step toward sweltering night and mosquitoes got in waiting for them on their bed. stayed at a Times Square hotel, and he told the eventual liftoff.” — Reuters through an open window. Earlier this month, a couple who live in me he liked my van better.” — AP BUSINESS SATURDAY, AUGUST 8, 2015
BoJ opens door to stimulus as oil drops
TOKYO: The head of the Bank of Japan said yesterday that to drag inflation higher. After a brief recession last year, he would consider pulling the trigger on more stimulus if Japan posted stronger-than-expected growth in the first weak oil prices keep holding back inflation. BoJ chief quarter as a pickup in capital spending drove the recovery. Haruhiko Kuroda said Japan’s economy was perking up, 0The 1.0 percent expansion in January-March - or 3.9 and the bank held off expanding its record 80 trillion yen percent on an annualised basis - was sharply up from an ini- ($640 billion) annual asset-buying scheme following a two- tial estimate of 0.6 percent growth. However, many econo- day meeting. But the country’s near-zero inflation rate is far mists expect second-quarter growth to be weaker, boost- below the BoJ’s 2.0 percent target, a cornerstone of efforts ing the case for more BoJ policy action. Earlier yesterday, to boost the world’s number three economy and conquer the bank kept its view that Japan’s economy was continu- years of deflation. ing to “recover moderately”. Policymakers pointed to an “We would consider adjusting policy if oil rates affect improvement in exports, factory output and capital spend- price trends and impact on underlying price movements,” ing, as Tokyo pushes companies to hike wages in a bid to Kuroda told reporters. “But that is not the situation right stimulate consumer spending, after a sales tax rise last year now. We will continue to watch oil price trends and see hammered demand. how they influence underlying price movements.” A glut of “Against the background of steady improvement in crude oil supply is seen as the main driver for a sharp the employment and income situation, private consump- decline in oil prices that has seen crude fall about 50 per- tion has been resilient and housing investment has been cent from mid-2014 levels. 0Last month, Japan’s central picking up,” the bank said. The BoJ has said it expects the TOKYO: Bank of Japan (BOJ) Governor bank cut its economic growth and inflation forecasts, economy to expand 1.7 percent in the fiscal year to Haruhiko Kuroda answers questions during fuelling speculation that it would soon expand its easing March 2016 while inflation would come in at 0.7 percent. a press conference following a two-day poli- scheme, aimed at boosting prices and kickstarting growth. That was down from earlier estimates of 2.0 percent and cy board meeting yesterday. — AFP Economists widely expect the bank to act before year’s end 0.8 percent, respectively. — AFP
Tata cuts sales, production targets for JLR in China
MUMBAI/NEW DELHI: India’s Tata Motors Ltd has cut prices, sales and production targets at its luxury Jaguar Land Rover (JLR) arm in China, a top executive said, as it struggles with high inventories in a slowing market. Economic growth in China, the world’s biggest car market, has slowed to a 25 year low and a drop in consumer confidence is hurting sales of automakers from BMW to General Motors. “Production and sales targets (for JLR in China) have been adjusted to reflect the slowing market,” Tata Motors finance chief C Ramakrishnan said yesterday after the group posted a near halving of quarterly profit. He did not elaborate on the extent of cuts. Tata Motors has also cut the price of JLR’s local- ly-made Range Rover Evoque sport-utility vehicle (SUV) by up to 6 percent, and lowered the launch price of its Jaguar XE compact sedan, he said, but did not give price details. The cut in price and targets for JLR comes weeks after automakers such as BMW, GM and Ford Motor Co announced price cuts on their Chinese models to combat weak sales growth. China’s automakers association has cut its 2015 sales growth forecast to 3 percent from 7 percent. JLR should see a return to sales growth from the December quarter driven by new launches and as management improves brand awareness for the China-made Evoque, said auto analyst Nitesh Sharma at brokerage Phillip Capital. Tata Motors’ net profit for the April-June quarter fell 49 per- cent to 27.69 billion rupees ($434 million), compared with the same period a year ago. Analysts on average expected profit to NOVOZYBKOV, Russia: A worker uses a bulldozer to crush crates of peaches outside this city yesterday. — AFP be 34.59 billion rupees, according to Thomson Reuters data. Net sales fell 6 percent to 601.8 billion rupees. JLR’s sales in China fell by a third to 21,920 vehicles during the quarter, Russia destroys more tons pulling down total sales at the luxury carmaker by 1 percent to 114,905. Sales in Europe rose 28 percent to 28,878 vehicles. The company, which began local production of its Range of smuggled Western food Rover Evoque SUV in China in October, has been criticised for pricing it too high and was also forced to recall some vehicles over quality issues. “With the slower retail sales and the head- Move sparks rare outburst of public ire winds we have seen in China, there has also been a pipeline inventory build up,” said Ramakrishnan, adding JLR had an MOSCOW: Russian officials yesterday petition asking officials to give the food including some meat from Italy which inventory of 8,000 to 10,000 vehicles. destroyed hundreds of tonnes of fruit to the rising number of poor in the cri- was burned in a garbage incinerator at Strong sales of its JLR cars, especially in China, have long as they pushed on with a controversial sis-hit nation. Russia’s food safety Saint Petersburg’s Pulkovo airport. propped up profits at Tata Motors, which has been struggling drive to eradicate smuggled Western agency said it destroyed around 180 Moscow last year banned a slew of with sluggish demand for its cars in the last couple of years in food. Authorities started trashing pro- tonnes of fruit including peaches, nec- food products from the West, ranging India due to an economic downturn. A slow recovery in India’s duce on Thursday after President tarines, cherries and grapes that from specialties such as Parmesan passenger vehicle market, where sales grew 6 percent in the Vladimir Putin ordered the destruction crossed over the border from Belarus cheese, pate and Spanish hams to sta- April-June quarter, has pushed up Tata Motors’ domestic sales, of food brought into the country in and were “falsely” marked as coming ples like apples. Food brought in for which rose at double the pace to more than 37,000 vehicles breach of a year-old embargo imposed from Turkey. private consumption is still permitted. over the same period a year ago. The company expects to in retaliation for Western sanctions Another 40 tonnes of fruit were Russia has complained that some maintain this pace helped by at least two new product launch- over the Ukraine conflict. seized and destroyed at a landfill site importers are circumventing the ban es every year until 2020, according to Mayank Pareek, presi- The decision to eliminate the food close to the border, the agency said in a by illegally slapping on new labels that dent of the passenger vehicle unit at Tata Motors, India’s top sparked a rare outburst of public ire as separate statement. About 319 tonnes claim the food was produced in neigh- automaker by revenue. — Reuters more than 300,000 people signed a of food were destroyed Thursday, bouring ex-Soviet countries. — AFP BUSINESS SATURDAY, AUGUST 8, 2015
In ‘Wild West’, some find profit, others pain
SAN FRANCISCO: Medical student Syed ed a surprise second-quarter loss late on July sharply after they reported earnings or E-Trade, TD Ameritrade and other online Shah loves to trade tech stocks when most 28. He shorted the stock in extended trade as reversed moves that were initially positive. brokerages have also made it easy for any on Wall Street have called it a day. In what it dropped to $28 from $33 and then bought it On July 28, Twitter’s stock surged 9 percent individual investor to trade stocks outside of many professional investors view as an at $24 the following day to close his position. minutes after the company released second- normal hours. inhospitable trading landscape starved of liq- But he’s lost money, too. In May he bought quarter results that beat investors’ expecta- After-hours trades by institutional uidity and fraught with dramatic price Fossil as its shares surged to $90 from $86 tions, only to reverse direction and slump to investors go through the Nasdaq and other swings, Shah and others see buying stocks immediately after its quarterly report, only to a 7 percent loss as CEO Jack Dorsey said on a exchanges as well as through dark pools, outside of normal trading hours as a chance see them sink as low as $76 the next day. “It’s conference call that the social networks’ cloaked from the broader market. Online bro- to get in early on those swings after popular definitely risky,” said Shah, who taps his after- future growth was uncertain. kerages used by Shah and other non-profes- companies such as Facebook and Chipotle hour stock orders into an online broker app on The wild price swings are at least in part sionals often route orders through electronic Mexican Grill post quarterly reports. his iPhone at the hospital where he trains. “I’ll a result of programmed trading, as algorith- networks trying to match orders between cus- Observing that steep moves in the after- buy stocks that are already up 10 or 15 per- mically-driven investors jump into thinly tomers, and they warn of light liquidity and market hours often extend into the following cent after hours. It’s not for everybody.” traded markets in the moments following an heavy volatility. To protect their customers, day, the 26-year-old New Yorker made a quick Those risks have been on display in earnings report. Changes in the past decade they don’t allow “market orders” to buy and profit on Yelp after the review website report- recent weeks as some high-flying stocks fell to regulations and the technology used by sell stocks for open-ended prices.— Reuters Kerry confident of concluding TPP trade pact
HANOI: US Secretary of State John Kerry expressed confidence yes- terday that an ambitious Pacific trade pact could be completed this year and said a recent nuclear deal with Iran proved hurdles in inter- national agreements could be overcome. Kerry said many chal- lenges remained in thrashing out a Trans-Pacific Partnership (TPP), particularly on issues of autos and dairy, but the United States would do everything in its power to make it happen. “We can com- plete this negotiation by the end of this year and we are going to do everything possible to work through these differences,” he told stu- dents in Hanoi. The US-inspired TPP is a “mega regional” accord set to cover 12 countries with a combined gross domestic product of $28 trillion, among them Australia, Japan and the United States. Kerry likened the TPP talks to a deal negotiated over 18 months between Iran and six other countries to lift sanctions in return for curbs on a nuclear programme Iran insists is for peaceful purposes. “When you get 12 nations together, it’s very complicated. I will tell you that having just negotiated with Iran ... there were six of us all with expertise, all with our own opinions and we had to come together in order to agree on what we would then negotiate with Iran. “This is the same thing,” he said of the TPP. The TPP would con- nect the 12 economies by cutting trade barriers and harmonising NEW YORK: This July 1, 2015 photo shows a cook preparing an order for a customer at a restaurant. The US unemploy- standards covering two-fifths of the world economy and a third of ment rate held steady at 5.3 percent in July. — AFP global trade. TPP trade ministers discussing the pact, which would stretch from Japan to Chile, have said an agreement is within reach, despite Improving US jobs market the failure last week to settle differences at talks in Hawaii. Kerry met Vietnamese President Truong Tan Sang and said it was crucial to iron out remaining issues. “One of the very important things now is bolsters case for Fed hike for us to be able to stay where we are on the TPP negotiations, not to slide backwards, but to finish that job in which Vietnam is very much an important contributor,” Kerry said. Unemployment rate steady at 5.3% Vietnam’s export-dominated economy could be among the biggest beneficiaries of the TPP because of its farm and fisheries WASHINGTON: US employment rose at a sol- er-dated US Treasuries were trading lower ployment rate holding steady at 5.3 percent. resources, cheap labour and growing manufacturing sector, espe- id clip in July and wages rebounded after a after the data. The dollar rose to a two-month Wage growth has been disappointingly cially in textiles, footwear, telephones and televisions. Among its surprise stall in the prior month, signs of an high against the yen and firmed versus the slow. But tightening labor market conditions investors are Samsung, LG and Microsoft. Vietnam has some linger- improving economy that could open the door euro. The swaps market was pricing in a 52 and decisions by several state and local gov- ing concerns on TPP, including issues related to labour, which Kerry wider to a Federal Reserve interest rate hike in percent chance of a September rate hike, up ernments to raise their minimum wage have said could be settled. “I think your government is very much pre- September. Nonfarm payrolls increased from 47 percent before the jobs data. Though fueled expectations of a pickup. In addition, a pared with us to help complete that,” he said. — Reuters 215,000 last month as a pickup in construction hiring has slowed from last year’s robust pace, number of retailers, including Walmart , the and manufacturing jobs offset further declines it remains at double the rate needed to keep nation’s largest private employer, Target and in the mining sector, the Labor Department up with population growth. The Fed last TJX Cos have increased pay for hourly workers. said on Friday. The unemployment rate held at month upgraded its assessment of the labor a seven-year low of 5.3 percent. market, describing it as continuing to Nearing Full Employment Payrolls data for May and June were “improve, with solid job gains and declining The jobless rate is near the 5.0 percent to 5.2 revised to show 14,000 more jobs created unemployment.” percent range most Fed officials think is consis- than previously reported. In addition, the Average hourly earnings increased five tent with a steady but low level of inflation. A average workweek increased to 34.6 hours, cents, or 0.2 percent, last month after being broad measure of joblessness that includes the highest since February, from 34.5 hours in flat in June. That put them 2.1 percent above people who want to work but have given up June. “If you thought that the Fed was going the year-ago level, but well shy of the 3.5 per- searching and those working part-time because to go in September, this report would suit cent growth rate economists associate with they cannot find full-time employment fell to that thematic nicely. I don’t think anything full employment. Still, the gain supports views 10.4 percent last month, the lowest since June has changed in that regard. I think it’s another that a sharp slowdown in compensation 2008, from 10.5 percent in June. But the labor step toward the eventual lift-off,” said Tom growth in the second quarter and consumer force participation rate, or the share of working- Porcelli, chief US economist at RBC Capital spending in June were temporary. age Americans who are employed or at least HANOI: US Secretary of State John Kerry speaks during a Markets in New York. Economists had forecast nonfarm payrolls looking for a job, held at a more than 37-1/2- press conference with Vietnam’s Foreign Minister Pham Binh US stock index futures and prices for short- increasing 223,000 last month and the unem- year low of 62.6 percent. — Reuters Minh at the Ministry of Foreign Affairs yesterday. — AFP BUSINESS SATURDAY, AUGUST 8, 2015
Coal safari offers excavators, not giraffes
MOST, Czech Republic: It is a safari with a under the guide’s watchful eye. The compa- twist: two private Czech mining companies nies want to “allow the public to take a clos- have joined forces to take tourists on trips to er look at coal-mining technology but also at see long-necked excavators and coal beds, landscape renewal after mining”, according instead of giraffes and lush wilderness. “We to the safari website. The tour covers former are standing at the edge of a mine that was mines turned into lakes and an overview of opened in 1901,” guide and former miner former spoil banks - artificial hills formed by Josef Gerthner told a group as they snapped waste removed from the mines - that have pictures of monster excavators in the dis- come to serve as building plots. tance on a hot summer day. Most of the coal goes to state-run power Wearing protective helmets, the 18 producer CEZ, Europe’s second largest pow- adventurers toured the sprawling surface er exporter after France’s electricity giant brown-coal mines in an off-road truck dur- EDF. The Czech firm still relies on coal for ing the 4.5-hour “coal safari” in the northern about half of its output and continues to city of Most. Offered by the Vrsanska Uhelna build new coal-fired units. The flames are fed and Severni Energeticka companies, the by the Czech Republic’s four brown-coal bumpy safari ride has drawn 16,500 people mining companies, which extracted 40.6 mil- representing every continent except lion tons of coal in 2013. That number is Antarctica since it was launched in 2009. down about seven percent from 2012, Its three routes are typically sold out at according to data from the Energostat asso- MOST, Czech Republic: Participants in a coal safari look at the least two months in advance. The admission ciation monitoring the Czech energy sector. bucket excavator on Aug 5, 2015 in a coalmine in this town. — AFP fee of 150 koruna ($6) goes toward the Vrsanska Uhelna and Severoceska upkeep of a local mining museum. “It’s fan- Energeticka contributed a total of 10.2 mil- years. But a plan to expand the mine by flat- mining region that is grappling with heavy tastic to be able to come up so close,” lion tons. tening the village has angered environmen- pollution. “I know what smog is like. I sup- Prague computer programmer Premysl Maly talists, while conservationists are concerned pose there are cleaner kinds of energy,” she said while standing under an excavator that City built on mines that landslides caused by mining might told AFP. Coal mining is a hot issue in the EU is 160 m long and 52 meters high and Gerthner, the guide, pointed in the direc- endanger a nearby castle. member nation of 10.5 million people owing weighs 4,300 tons. Instead of collecting pho- tion of a nearby village, Horni Jiretin. It “I’m glad I got a chance to see it all. I’ve to a 1991 government resolution that set tographs of lions or buffalo, tourists can fill stands on 750 million tons of coal - enough heard a lot about the castle,” said Marta mine border limits. Industry lobbies would plastic bags with souvenir lumps of coal to keep the miners going for another 100 Galiova, visiting from the country’s eastern like to see them lifted.— AFP
German exports, Days may be numbered industrial output fall in June for ‘everyman’ farmers BERLIN: Germany’s industrial output fell 1.4 percent and exports from Europe’s top economy dropped by one percent in June from the pre- Privileges threatened for Greek growers vious month, data showed yesterday. Many German companies are struggling with China’s slowdown and recent volatility over the NAXOS, Greece: A jovial potato farmer whose to 26 percent, making them pay tax upfront, crimes unit, who declined to be named Greece crisis, despite the benefits of a low euro, cheap oil and rock- family has tilled the fertile land on the island of full instead of partial taxation of EU farm funds because he was not authorized to speak to the bottom interest rates. “Overall, today’s data is a setback for the Naxos for over 200 years, Stelios Vathrokilis is and scrapping benefits such as a 40 percent media. German economy and bodes ill for second-quarter real GDP growth,” unfazed by all that he believes a farmer must discount on power and diesel subsidies, Greek said Natixis bank, which revised down slightly its forecast to 0.4 per- inevitably face: God, inclement weather and officials say. Farmers are also expected to triple Agrarian Roots cent GDP growth quarter-on-quarter. natural disasters. But mention tax hikes on contributions to their pension fund. But in a country that prides itself on an UniCredit also lowered its forecast for the second quarter GDP fig- farmers demanded by Greece’s creditors and The changes would mark the end of an era agrarian heritage and where most urban ure to be released next Friday to 0.4 percent, from 0.5 percent, Vathrokilis’ face darkens with anger. “With the for Greek farming, a sector dominated by Greeks have family or roots in villages, the lat- although it called the output drop “a statistical fluke”. Industrial pro- new taxes we will turn the clock back to 1970 small-scale farmers who thrived in recent est proposals have stirred deep anger and a duction, adjusted for seasonal swings and inflation, unexpectedly fell when my mother cooked on a wood stove,” decades thanks to an influx of EU funds and backlash from opposition and government 1.4 percent over the month, with a particularly severe 4.5 percent the portly 50-year-old says. “Life will be like benefits aimed at making up for a lack of lawmakers. “Greece is seen as an agrarian soci- drop in construction output, said the economy ministry. Analysts what it was when Nazis occupied the country, economies of scale and ensuring the country ety - the farmer is more associated with the polled by financial services provider FactSet had forecast a small except this time it will be forever.” preserved its agricultural sector. The lenders common man than the industrial labourer,” increase of 0.4 percent. For Vathrokilis’ compatriots, the hardships say farming should now simply be brought in said Joann Ryding, vice president of the Economists at BayernLB blamed the Greece crisis and the effects of seven years of austerity are nothing new. line with other professions. In a country where American Farm School in Thessaloniki, which of an earlier major train strike for the disappointing figure and pre- One in four workers is unemployed and virtual- inheriting a tiny olive grove or a small patch of teaches farmers to run their farms as a busi- dicted a recovery, given a recent rise in factory orders. The economics ly every industry has made sacrifices in jobs land in the countryside is common, the ness. “The farmer represents the struggling ministry said an unfavourable working-day effect artificially damp- and in pay. Yet some sectors, notably agricul- changes would also end the incentive to common man.” ened industrial activity. Capital Economics stressed that June’s figures ture, have been relatively untouched and even, declare oneself a farmer in order to enjoy pref- So contentious is the issue that Prime were “unlikely to signal the start of a sustained contraction in German critics say, coddled. No longer. The change is erential tax treatment. Only about 350,000 of Minister Tsipras excluded it from two sets of industry”. “The jump in industrial orders in June points to stronger an illustration of the hardened mood among the 850,000 Greeks involved in farming are full- reforms passed last month, leaving it part of a production growth ahead. Nonetheless, the performance of the Greece’s creditors in Brussels, Berlin and at the time farmers, said an agriculture ministry offi- small set of unresolved issues still being dis- country’s growth engine has been disappointing in light of the boost IMF, and a sign of Greek Prime Minister Alexis cial, adding that a third of agricultural output is cussed with lenders before being voted on. expected from the decline in the euro exchange rate,” said Jonathan Tsipras’ weakened hand in the latest round of sold or traded illegally without receipts. This week, Tsipras visited the agriculture min- Loynes, Capital’s chief European economist. bailout negotiations. Farming has also been beset with legal loop- istry to pledge he would fight for farmers even The industrial production figure for May was revised to 0.2 per- Greece’s new bailout program, the third, holes: until recently, the size of land held rather as his government rushed to conclude talks cent growth compared to April, against zero percent reported earlier. looks set to scrap the status of Greece’s farmers than output determined eligibility for farmers’ with creditors before a mid-August deadline. Germany’s trade surplus narrowed to Ä22 billion ($24 billion) in June, as a protected group long the beneficiaries of benefits, allowing some Greeks cultivating He said he was pushing to keep the farmers’ according to seasonally adjusted figures released by federal statistics subsidies and tax breaks. Farmers have been small plots for their own use to enjoy the perks. income tax rate at 13 percent and have them office Destasis. Exports fell one percent to Ä101.1 billion from a shielded by successive governments in a nod And even the current 13 percent income pay half rather than all tax upfront. “We need to month earlier, while imports contracted by 0.5 percent to Ä79.1 bil- to supporting agriculture and keeping an tax rate was only introduced in 2013 under support agricultural production which can be a lion. For the first six months of the year, however, the trade data important voter base on side. As a conse- pressure from EU/IMF creditors after they tool to grow and exit the crisis,” Tsipras said, looked better German gross exports reached nearly Ä600 billion, up quence, farmers largely escaped the worst of found farmers were being taxed not on income and then, referring to farmers: “Without them, seven percent from the first half of 2014. Other European Union Greece’s financial ruin. As the crisis bit, many but on a method based on acreage and type of we cannot make it.” In Naxos, a large Cycladic member nations remained the biggest market for German exports. Greeks who lost big-city jobs even returned to crop that resulted in minimal taxes for most, island famous for its potatoes, meat and hard But the rise was most marked to non-euro EU countries, where villages for the relative safety of farming. the official said. Before that tax rate was set, graviera cheese, that is cold comfort to local exports grew 8.5 percent in the first half, and to other world regions, But that is set to change at a stroke. farmers paid a total of 350 million euros in tax farmers who fear the end of a lifetime of tilling where they increased 8.2 percent overall. The weakness of the single Greece’s creditors are demanding measures to in 2013 - meaning the state only received the land. Farmers here say they are already currency against the dollar reduces the cost of European products for end special treatment for farmers. These about 400 euros in taxes annually per Greek struggling as a consequence of Greece’s finan- foreign buyers. — AFP would involve doubling their income tax rate farmer, said an official at Greece’s financial cial crisis. — Reuters BUSINESS SATURDAY, AUGUST 8, 2015
Hackers turn Square readers into crime tools
LAS VEGAS: Hackers on Thursday showed Playback Attack how to turn the latest model Square mobile On the software side, Moore provided payments readers into crime tools. details about a mobile application that Independent security researchers and self- enables a “playback attack” that allows mer- described hackers Alexandrea Mellen and chants to charge customs for bogus transac- John Moore were at the Black Hat computer tions in the weeks or months after legitimate security conference in Las Vegas to demon- purchases are completed. “We find this trou- strate hacks targeting Square software or the bling because unless you are closely watch- dongle that plugs into audio jacks to read ing your credit card statements, you might credit card magnetic strips. “We converted a not notice,” said Moore, a recent Boston Square Reader into a credit card skimmer in University graduate on his way to a job with under 10 minutes,” Mellen told AFP. “Any lay- Google. Moore said that he and Mellen, also a man could do it.” recent Boston University graduate, targeted She said the hardware hack can be done the Square Reader because the company, with simple tools including a screwdriver, headed by Twitter co-founder Jack Dorsey, is wire and soldering iron, and that most of the a leader in a booming trend of using smart- time involved was spent carefully popping phones for real-world financial transactions. LAS VEGAS: John Moore and Alexandrea Mellen attend a Black Hat com- open the reader that Square provides to users “Square, given its size and a bug bounty pro- puter security conference on Thursday, where they showed ways to hack of its mobile payments application. Inside the gram, is no easy target,” Moore said. “We sus- Square mobile payments hardware and software.—AFP reader, a wire is soldered between two points pect the vulnerabilities we found in Square to bypass an encryption chip. After that, might easily apply to other mobile point-of- and software is quickly being fielded in the with a variety of mobile phones, which can’t unscrambled information from swiped credit sale service providers.” competitive mobile payments market, with be secured as easily since they are used for cards can be collected, essentially stolen, to An array of major Internet firms offer cash pressure on to keep plug-ins compact and many more purposes than making purchases. be sold on a black market or abused in other rewards, or bounties, for software bugs that inexpensive, according to Moore. Mobile Moore referred to the combination of factors ways, according to Mellen. can be exploited by hackers. New hardware payments software needs to be compatible as “a recipe for disaster.”— AFP
Seoul N Korea store opens to brisk business
SEOUL: A shop in South Korea’s capital specializ- ing in goods made in the North has run nearly $140,000 through its tills in just three months of business, helping dispel the notion that products from the impoverished state are shoddy and unde- sirable. The Kaesong Industrial Complex Shop opened in May showcasing North Korea and the skills of its workers, to present the country as a viable business partner to the prosperous South. “North Korean employees are young and are fast learners, and we use materials from the South. So the quality is just as good as products of South LONDON: Commuters cross the river Thames on the Millennium footbridge as a Tube strike hits the morning Korean brands, at relatively lower prices,” said rush hour on Thursday.— AFP shop vice president Lee Joung-duk. Lee is presi- dent of Young Inner Foam Corp, one of 125 firms from the South operating in Kaesong. The industri- ‘What Tube strike?’ ask al zone was set up by the two Koreas in 2003 a few kilometres north of their armed border, and now employs about 53,000 North Koreans. London digital workers Lee partnered the owners of 11 other Kaesong companies, investing about $17,000 each, to set City’s burgeoning tech sector not tied to daily commute up the store to bring Kaesong goods directly to consumers. “We are the first to be using the line LONDON: For tech-sector workers like Chris But the number of companies operating the impact of Tube strikes on the economy, but ‘Made in Kaesong.’” The two-storey store, the first McClelland, whose job only requires a laptop, a primarily over digital platforms is growing. my sense would be that they have a more limit- of several planned outlets, sells clothing and jew- Wi-Fi connection and maybe a coffee, London’s Government agency TechCityUK estimates ed impact now than in the past given the ellery boxes in downtown Seoul. Business has been underground rail strike has had little impact. A that 15 percent of the UK companies formed changes in working practices which allow more brisk, with sales of about $1,700 a day and more London-based employee for San Francisco- in 2013-2014 were digital firms. “The Tube people to work from home,” said Andrew than 200 daily visitors. based startup Planet Labs, McClelland is one of strike has brought headaches, but not chaos,” Goodwin, an economist at Oxford Economics. Lee Ae-ran, a defector from the North who runs an estimated 250,000 people who work in inner said its head, Gerard Grech. Estimates of the So what does this mean for the striking London’s digital economy and who are less tied hit to London’s economy from such stoppages workers themselves? Might the lessening a nearby restaurant serving North Korean-style to a daily commute than most employees. vary wildly depending on the source and impact of a Tube shutdown reduce bargain- food, welcomed the idea of a platform to change Changes in technology and work habits are methodology. The UK Federation of Small ing power? Not necessarily, argues Sean attitudes towards the North’s workforce. “Many having a big impact on estimates of just how Businesses last year reckoned a 48-hour shut- McKee, director of policy at the London South Koreans assume North Korean products to much such strikes actually cost. down had cost the capital’s small firms £600 Chamber of Commerce and Industry. “Thanks be poor quality because the country isn’t doing so “Obviously some people have jobs that million ($930 million) in lost working hours, to more flexible working patterns, many well economically.” Yang Sang-cheol, a taxi driver require them to be physically present at work, business and productivity. office-based staff may have had the option to parked outside the shop, said he would be inter- but many other people can work productively The Centre for Economics and Business work from home yesterday, lessening the ested in buying something for his son-in-law. “We from home, and their numbers have probably Research said that in the new “Flat White impact on their employer,” said McKee. should know better than to always criticise and increased over the last ten years or so,” said Economy”, digital companies were more flexi- “However, it stands to reason that the service compete with each other,” he said of the Koreas. McClelland. The tech sector’s 250,000 workforce ble and that people could work from home industries, restaurants, cafes, event spaces in “We should allow more things to come and go is small beer out of London’s total population of with little if any loss of productivity. It put the particular, and those that rely on foot traffic, between us so that we can actually ‘feel’ one 8.6 million, and there were obvious scenes of cost per day of last year’s strike at 10 million like retail, will have been hardest hit as they disruption this week for commuters lining up to pounds, saying the increase of cycling also faced a city with fewer workers and most like- another.” — Reuters squeeze onto buses or overground trains. helped. “It would be very difficult to quantify ly a significant drop in trade.”— AFP after 16years Show’ hostleaves Stewart: ‘Daily Farewell Jon SATURDAY, AUGUST 8, 2015 www.kuwaittimes.net SEE PAGE 24 SATURDAY, AUGUST 8, 2015
Hilton says her life changed after visiting an Indian orphanage he 34-year-old DJ-and-socialite made a decision and they were saying, ‘This is so sweet, no one ever vis- to visit a group of AIDS-infected children at a its them and people are scared to hang out with them.’ Thome when she went to the Asian country and That just made me so hurt inside that these poor chil- what she saw inspired her to make it part of her life’s dren, who are literally dying, are being treated like out- work to help disadvantaged kids. In an interview with casts. That is just something that really stuck with me New You magazine, she said: “There’s this one orphan- and I always think about.” When asked what her plan is age in India where all the children there were left there for the future, Paris admitted she wants to use her because their parents all died of AIDS and the children fame to help orphans all over the globe. She said: “I had it as well. They were all in there, just so sick. It just know that I have a voice to help those who don’t (have broke my heart to see all these children left there with a voice), and I’m really going to dedicate my life a lot to no families, with nothing. Even the people in the town that in the upcoming years ... I have worked very hard were treating them in a bad way because of it. It just and I have a really big heart.” broke my heart.” Since that visit, Paris made a vow to visit orphanages in every country she goes to and always spoils the children with toys and gifts. Recalling that life altering day in India, she added: “I brought them all (children in orphanages) toys and art projects
Diesel teaching his Imbruglia needed four-month-old a tutor to pass her daughter to read British citizenship test he ‘Furious 7’ actor took his baby girl Pauline Sinclair - who he ‘Torn’ hitmaker has revealed she recently passed the he named after his late co-star Paul Walker - to New York exam to become a Brit, but had to employ a personal Library on Thursday where he said she was “reading up a T teacher after failing the first time she took it, despite the storm”. He also thinks it’s an “awesome thing” that she can expe- T fact she has lived in the UK for the past two decades. Speaking rience the city her grew up in. He told ExtraTV: “Just yesterday about officially becoming British, she said: “[It’s] so exciting! I had she went to the New York Library for the first time, you know in to take an exam. “[There were] lots of questions about the suffra- all of her 4-month glory, and she very much enjoyed it, she was gette movement. But I failed the first time and had to get a tutor.” reading up a storm. It’s heaven, it’s heaven for her, even though Now she has passed the exam, the 40-year-old star - who origi- she’s so young, just her experience in the city that I grew up in, in nally hails from Sydney, Australia - has insisted her new nationali- the city is that’s so much a part of me ... is an awesome thing.” ty is extremely special to her, and so much so that she almost The 48-year-old hunk who has three children with girlfriend began sobbing at a ceremony when she had to pledge allegiance Paloma Jimenez - son Vincent Sinclair, four, daughter Hania Riley, to the nation. She explained: “I got really emotional. I choked. I six, and new born Pauline - is all about his children being early couldn’t believe it. I thought, ‘I really, really care about this. It’s a learners and recently revealed daughter Hania is already an really big deal. I have lived here for more than 20 years and this is orange belt in Judo and Jiu Jitsu and he isn’t worried about hav- a big part of me.’ “ And the ‘Johnny English’ actress confessed it ing to fight off boys because his philosophy is “you teach them to Cumberbatch was especially poignant because she was almost forced to return handle their own”. He said: “Oh, I won’t have to say anything. My to Sydney shortly after arriving in London because she struggled six-year-old daughter is an orange belt in Judo and Jiu Jitsu unable to sign so desperately for work and almost ran out of money. She told already so my philosophy is you teach them to handle their own.” Evening Standard magazine: “You can see why that ceremony autographs after Hamlet made me feel really secure. Like I was home.” he 39-year-old actor took to the stage as the Shakespearean character for the first time at the TBarbican Theatre in London but due to the over- whelming amount fans who besieged the venue a deci- sion was made to place a sign outside the Stage Door stating signings would not be taking place. The message read: “Mr Cumberbatch will not be signing autographs before or after the performance of ‘Hamlet’. “Due to the overwhelming number of requests, Stage Door are unable to accept gifts or items for signing. “We apologize for any disappointment this may cause and appreciate your understanding.” Benedict has a huge fan base due to his role as Sherlock Holmes in the BBC series ‘Sherlock’ and many of his female followers refer to themselves as ‘Cumberbitches’. The Oscar-nominated actor has been vying to play the Prince of Denmark in Shakespeare’s tragedy for a long time and always thought when he reached his late 30s he would be the right age to portray the famous character. He previously said: “I don’t know if there is such a thing as a right age to play the part, but 36 or 37 seems appropriate to me, so I need to do it before long.” ‘Hamlet’ runs until October 31 at the Barbican Theatre. SATURDAY, AUGUST 8, 2015 Beyonce launches collection of temporary tattoos he ‘Drunk in Love’ hitmaker unveiled the range of “fierce, fabulous, and flawless” skin transfers, a Tcollaboration with Flash Tattoos, in a series of Blunt has images in the CR Fashion Book. The black and gold designs include a gun - which the 33-year-old singer posed with on her bare shoulder - bees, bracelet and choker-style jewelry, as well as song titles like become a ‘Flawless’, ‘Blow’, and ‘Naughty Girl’, and lyrics such as ‘I woke up like this’. Speaking about the collection of 57 different designs on five sheets, Flash Tattoos founder Miranda Burnet said: “The collection is an edgier take on traditional jewelry.”We wanted to focus US citizen on making a strong and empowering statement with the designs that embodied BeyoncÈ — fierce, fabu- lous, and flawless!” The 57-piece set - which Beyonce he British actress obtained her citizenship alongside American he took to Twitter to tell the world. He tweeted: creatively directed and co-designed - retails at $28. Matthew McConaughey’s Brazilian wife Camila Alves at a “Congratulations Camila on getting your US citizenship today. The tattoos will reportedly last four to six days if TVIP legal oath ceremony in Los Angeles on Tuesday. It Another fellow and great American” Meanwhile, the day after applied to skin correctly. Beyonce’s tattoo collection comes five years after the ‘Into The Woods’ actress married her becoming a US citizen Blunt and her husband attended the comes shortly after Rihanna teamed up with Jacquie Massachusetts-born actor husband John Krasinski. According secret wedding of Jennifer Aniston and Justin Theroux. The Aiche for her own collection of temporary inkings. The to UsMagazine.com, Blunt - who was born in London - was happy couple tied the knot at their $21 million Bel Air home in 27-year-old beauty - who has an extensive collection spotted leaving the courtroom holding Krasinski’s hand, Los Angeles on Wednesday evening. They were joined by 70 of body art herself including a henna-style hand tattoo accompanied McConaughey and Alves and their children, guests, including Aniston’s former ‘Friends’ co-stars Courteney and an Egyptian goddess on her chest - worked with Levi, seven, Vida, five, and Livingston, two. Blunt or her hus- Cox, who served as maid of honor, and Lisa Kudrow. the jewellery designer on a seven-sheet set which fea- band are yet to comment on the news, but McConaughey, 45, tures cuticle and knuckle wraps, a DIY chain set and was so pleased his model wife had finally become an nameplates, arm bands, chains and gothic letter tat- toos in gold and silver. — Bangshowbiz
Aniston enlisted Courtney Cox to be maid of honor
he ‘Cougar Town’ actress was Jennifer’s and Emily Blunt and husband John Krasinski. top choice for the ceremonial role at her The happy couple’s wedding rings were creat- Tsecret wedding on Wednesday night, ed by jewelry designer to the stars and which took place at the Bel Air home she Jennifer’s friend Jennifer Meyer, the wife of shares with new husband Justin Theroux. The ‘Spider-Man’ actor Tobey Maguire. Guests best pals of over 20 years met on the hit TV were entertained by Sia, who sang her hit sitcom ‘Friends’. Their co-star Lisa Kudrow also ‘Chandelier’, and dined on a lavish feast of attended the nuptials. Meanwhile, Justin’s chicken, fish, sausage, fettuccine carbonara best man was none other than his tattoo with pork and mostaccioli pasta with red artist, Scott Campbell, who is married to sauce. A source told Us Weekly magazine: “It actress Lake Bell, according to People maga- was really, really good. The cake was deli- zine. The special occasion came as a shock to cious!” invited guests, who believed they were simply being invited to a party. Other A-list well- wishers included Chelsea Handler, Jason Bateman, Ellen DeGeneres and Portia de Rossi SATURDAY, AUGUST 8, 2015
File photo shows television host Jon Stewart during a taping of “The Daily Show with Jon President Barack Obama talks with Stewart during a taping of his appearance on “The Daily Stewart” in New York. — AP/AFP photos Show with John Stewart”. Farewell Jon Stewart: ‘Daily Show’ host leaves after 16 years he host of “The Daily Show with Jon Stewart” used his last turn any information of value. behind the desk to make the program a daily show about all One might even liken Stewart to a sort of Mister Rogers for a Tthe people who put the program together. Jon Stewart didn’t swath of viewers growing up in an era when the flaws of institutions use his final time on the landmark Comedy Central program to wal- their parents believed in without question were more evident than low in memories. There were no clips of past stunts, no skatey- ever. He chided CNN for presenting “partisan hackery” on a program eighth rerun of Stewart berating CNBC financial commentator called “Crossfire” suggested was toxic to national discourse. He James Cramer for the tone of that network’s coverage of finance. dressed down former New York Times reporter Judith Miller for Instead, Stewart spent a good part of a 63-minute finale celebrating allowing sources with bad information to help spur a nation to send the comedians who contributed to the program over his 16 years at US troops to Iraq. its helm and the writers and support staff behind the scenes. In doing so, Stewart - who turned a light-hearted program osten- ‘Smell something, say something’ sibly about delivering fake news into a very real, cultural touchstone Little of that was celebrated Thursday evening. Stewart delivered for thousands of viewers four nights a week - flipped another format a short monologue about being wary of “bull-t.” The world, he told on its ear. TV’s biggest latenight finales have been about the hosts viewers, is full of it, whether it be “Tolstoy’s iTunes agreement,” the and their antics. David Letterman gave nods to Chris Elliott and Larry Patriot Act, or the way cupcakes are made and marketed. “I say to “Bud” Melman when he signed off from CBS’ “Late Show” in May, you tonight, friends, the best defense against bulls-t is vigilance,” he but a thank you to his staff came in the show’s closing moments, cautioned. “So if you smell something, say something.” not in two mammoth segments that kicked things off. Jay Leno in Stewart’s farewell is the fifth in TV’s latenight firmament over the In this Nov 7, 2014 file photo, Stewart poses for a portrait in his first “Tonight Show” goodbye featured the kids of his staffers last year. Chelsea Handler left E! last summer, and Craig Ferguson promotion of his film “Rosewater” in New York. who had been born during his time on the air, but it was part of his left CBS’ “The Late Late Show” and Stephen Colbert left Comedy nearly-last hour’s denouement, not the main gist of the au revoir. Central’s “Colbert Report” last December. Letterman’s departure seems fresh, mainly because Colbert will not succeed him on CBS Cast and crew spotlight until September and the network has used the “Late Show” timeslot Stewart, on the other hand, put his contributors and cast front to show repeats of “The Mentalist” and “Blue Bloods.” and center. A frenetic opening segment made use of dozens of Stewart’s “Daily Show” finale may be one of the final moves on “Daily Show” correspondents ranging from early Stewart sidemen TV’s wee-hours chessboard, meaning that upheaval in what has like Mo Rocca and Vance DeGeneres to newer players like Jessica been an area where hosts stay on for decades may be ready to settle Williams and Al Madrigal. The show’s biggest success stories - down once again, albeit with a greater array of players in place. Stephen Colbert, Steve Carell, John Oliver, Larry Wilmore - made Conan O’Brien, who has hosted latenight programs since 1993, is prominent appearances. Trevor Noah, who will succeed Stewart arguably the genre’s elder statesman. Stewart seemed not to care September 28, popped up on stage to measure the set - and for any of it - the timeslot, the TV industry or his place in any of it. Stewart’s, er, inseam. “Actually, hey, Trevor, could you give me, like, The most ornate segment of the night was a single-take shot of the 20 more minutes?” Stewart asked him. “Daily Show” staff in the office, during which Stewart aped a scene Politicians and targets of Stewart’s ire over the years also joined from Martin Scorsese‘s 1990 film “Goodfellas,” introducing his co- the spectacle in taped cameos. Fox News host Bill O’Reilly jokingly workers in rapid-fire style, each getting a nickname and a second for teased Stewart for being a “quitter.” “So long, jackass!” hooted a quick word. People receive posters while in line for the taping of the final Senator John McCain. Hillary Rodham Clinton lamented the “bum- Scorsese showed up in the middle to protest Stewart’s hom- episode of “The Daily Show” with Jon Stewart, Thursday, mer” that Stewart was leaving just as she began to run for President. age.”Hey, Jon, you ripped me off for the last time on ‘Goodfellas,’ Aug. 6, 2015, in New York. CNN’s Wolf Blitzer and Craig Kilborn, Stewart’s predecessor on the OK? You’ll hear from my lawyers soon.” Stewart professed not to show, made brief appearances. Paul Brown, the chief executive of know what the director was talking about. “There are days where Arby’s, a frequent Stewart target, offered a new slogan for the you come in and the confusion and the fog is everywhere, and the comedian: “Jon Stewart: It’s like a TV threw up on your face.”Bruce people here never fail to have my back on those moments. Springsteen and the E Street Band played “Land of Hope and Somebody in the building bringing inspiration - ideas, tenacity, hard Dreams” a selection the singer said were a “request” from the host. work - it’s the thing I’m proudest of, of this place. It’s not the show. Stewart appeared visibly stirred, if not shaken, during all the pro- It’s the process of the show. It’s the people of the show and the ceedings. He begged Colbert not to spend time praising him on atmosphere,” Stewart said, adding: “This is the most beautiful place I camera. During the finale’s taping earlier in the evening, Stewart have been and I’ll never have that again, and I had to come to terms hugged nearly every correspondent who came on the program, with that before leaving.” then turned to his desk and blew air from his mouth, obviously In his final moments, Stewart told the audience that the show emotional. That last moment was not shown during Comedy wasn’t ending but that the exchange he has had with them for 16 Central’s broadcast. years was due for a small break. “We are merely taking a small pause He had reason to be overwhelmed. Under his aegis, “The Daily in the conversation,” he said, “a conversation, which, by the way, I Show” became more than a spoof of TV news on Comedy Central. have hogged, and I apologize for that.” — Reuters For a certain generation, it developed into a truth-seeking exercise as Stewart railed against monoliths like government and the media in hopes of reducing confusion and bureaucracy into simple truths. Not since Walter Cronkite has a generation put so much trust in a Stewart exits the studio following the final taping of “The single on-air host - and this when Stewart never professed to offer Daily Show With Jon Stewart”. SATURDAY, AUGUST 8, 2015
In this Sunday, August 2, 2015 photo, Ice Cube (left) and son O’Shea Jackson Jr pose for a por- O’Shea Jackson Jr as Ice Cube in the film, “Straight Outta Compton.” trait in promotion of the new film “Straight Outta Compton,” at the Four Seasons Hotel in Los Angeles. — AP photos Ice Cube’s son becomes him in ‘Straight Outta Compton’
’Shea Jackson, Jr was determined to play his father, Ice Q: Kids often think their parents are dorky in some way. been looking at his movements and then getting them down. I Cube, in “Straight Outta Compton.” Not only does the 23- Did you discover anything like that in portraying your dad as had the time of my life. Oyear-old look uncannily like his dad, but he’s got the rap- a teenager? Cube: We first took him on tour, me and my wife, when he was per-turned-movie star’s mannerisms and expressions down - O’Shea Jackson, Jr: The only thing that would be remote to 1 1/2... So he’s been around movies and music his whole life... something he used to his advantage during the two-year audition that would be the lingo of the ‘80s, just the things that they said Then at 18, he started to really perform with me. So he has a process. “I’d go around frowning for no reason,” Jackson recalls that were ‘in’.... No pun intended: Ice Cube’s the coolest dad. knack for the stage. I’ve seen him rap my songs before on stage, with a warm smile. with me. So to see him do this on the big screen, it was great. I Jackson Jr makes his acting debut in “Straight Outta Q: Was there anything you didn’t want your son to know wasn’t surprised that he was so good, because I knew how good Compton,” opening Aug 14. The film captures the rise and rup- about you? he was. ture of NWA, the group credited with starting gangster rap and Cube: Seeing my son getting roughed up by the police is not inspiring warning labels on album covers for its provocative, fun. It brings back memories of when I got roughed up by them. Q: Cube, would you ever write an autobiography? incendiary lyrics. Founding members Ice Cube and Dr Dre are He grew up totally different than how I grew up, and to me, he Cube: I don’t know. I think I have so much to do. I don’t want among the film’s producers. Father and son sat side by side to talk shouldn’t have to go through that. But in a movie like this, and to to have like volume one, volume two. I just feel like I got a whole with The Associated Press about bringing Ice Cube to life on understand really what we all went through, I’m glad that he did lot of living to do before I think about summing it up in a book. screen. The remarks have been edited for clarity and brevity. feel the tone of what we went through so he could understand it a lot more. He was able to do it in a controlled environment, and Q: What’s next for you? Q: What’s it like seeing your story told by your son? not really have these police put their hands on him, because that Jackson: I’m working on my autobiography (laughs). I’m defi- Ice Cube: I’m proud on a thousand different levels. You always would hurt me if they did that for real. nitely ready to get my foot in as far as the cinema, definitely trying want your kids to step up at the moment of truth, and he did to get my acting career off the ground. I want to wait until more than step up. He just owned it. I’m just proud of the produc- Q: How was it rapping your dad’s words, and Cube, how “Straight Outta Compton” is well in everyone’s minds and see tion. I’m proud of the movie. I’m proud of the group. I have never was it watching him do it? where we go from there. — AP been this happy for any project that I’ve ever done. Jackson: I’ve been seeing him rap these words forever, you know? So it’s cool to finally be on the other side of that. To have Dr Dre vows not to forget rough roots r Dre has become one of music’s richest company of headphones and other audio prod- references to his once estranged bandmate. Dr entrepreneurs but on the work he has ucts. Apple last year bought Beats and brought Dre also taps younger artists including the rela- Ddeclared as his grand finale, the rap leg- Dr Dre into its fold in a $3 billion deal. Dr Dre, who tively unknown LA rapper Anderson Dr Paak, end vows never to forget his street roots. released the album first on the new Apple Music British soul singer Marsha Ambrosius, and espe- Capping one of the biggest waits in rap history, streaming platform, has pledged to donate all his cially 28-year-old hip-hop sensation Kendrick Dr Dre late Thursday put out his first album in 16 royalties to build a performing arts center in Lamar, who also hails from Compton. years, timed one week before the release of the Compton. Dr Dre’s net worth is estimated by Eminem, in “Medicine Man,” shows off his rep- biopic “Straight Outta Compton” about his for- Forbes at $700 million. Or as he puts it in his first utation as the quickest-tongued of rappers. But mer band, gangsta rap pioneers NWA. lines on the album: “I just bought California / Eminem also makes a crude comment about sex- “Compton: A Soundtrack by Dr Dre” offers a Them other states ain’t far behind it either.” ual assault-an indirect reminder that Dr Dre, wistful look back at the now 50-year-old’s despite his commercial success, has faced accusa- upbringing in the Los Angeles County city long Ice Cube, Eminem among guests tions of violence against women. synonymous with gang violence. While in time- “Compton” marks a wider musical exploration tested hip-hop fashion the album’s lyrics are full for Dr Dre beyond the turntable-driven hip-hop ‘Ultimate high’ of music of bloodshed and boasting, Dr Dre’s tone is strik- early in his career. The album features powerful Dr Dre has only released two previous solo ing for coming off not as angry but inspirational. performances by Baltimore trumpeter Dontae albums: the blockbuster 1992 work “The Chronic” “I’m strong-financially, physically / Mentally I’m Winslow, who closes out the album with brassy and “2001,” which, despite its name, came out in on a whole ‘other level / And don’t forget that I strength. 1999. He had long been reported to be working came from the ghetto,” he raps on the introspec- Dr Dre drives into hard-edged funk on tracks on an album called “Detox” but recently revealed tive “Talking to My Diary,” the closer of the album such as “One Shot, One Kill” and “Genocide.” The he had shelved the project, admitting to himself and perhaps his recording career. Death Row Records co-founder also brings out an that the quality was subpar. Dr Dre, whose real name is Andre Romelle all-star cast of collaborators for the album includ- By contrast, Dr Dre said that songs came to Young, was instrumental in creating the sound of ing his proteges Eminem and Snoop Dogg and him quickly for “Compton” as he returned to sites NWA. The group stunned much of white America NWA band mate Ice Cube. Also appearing in a to shoot the movie. Interviewed on Apple Music’s in 1988 with “F**k tha Police,” an unapologetic brief, posthumous snippet is Eazy-E, the original Beats One radio, Dr Dre said that music remained indictment of officers’ treatment of young African NWA front man who died in 1995 from complica- his calling despite years in business. “We made a Americans. tions of AIDS. lot of money. And it was very gratifying-I’ve got In this Nov 5, 2014 file photo, Dr Dre attends After massive success as a solo artist and pro- “I know Eazy can see me now, looking down to be honest with you,” he said. —AFP the WSJ Magazine 2014 Innovator Awards at ducer, Dr Dre headed Beats, an equally dominant through the clouds,” Dr Dre says in one of many MoMA in New York. — AP SATURDAY, AUGUST 8, 2015
Amateur actors from a clashing Alawite Jabal Mohsen neighborhood and the Sunni-majority Bab Al-Tebbaneh of Lebanon’s northern city of Tripoli perform in the play “Love and War on the Rooftop: a Tripolitan Tale” by Lebanese director Lucien Bourjeily at the Metro Theatre in the capital Beirut. — AFP photos Battle-scarred Lebanese teens reconcile through theatre he young man cowered behind a barrel on the barely lit stage, young men from Jabal Mohsen as “thugs,” he said. “But then I saw as his companion pointed a fake weapon towards a roaring that just like there are good people in Bab Al-Tebbaneh, there are Taudience in a Beirut theatre. The amateur actors were re-enact- good people in Jabal Mohsen.” ing a familiar scene from their native Tripoli, one of Lebanon’s most volatile cities. ‘We’ve become family’ For decades, but with increasing frequency since the Syrian con- The play tells the story of a frustrated director attempting to put flict erupted next door, fighters from the city’s mostly Alawite Jabal together his own performance in which Ali, from Jabal Mohsen, falls in Mohsen neighborhood and the Sunni-majority Bab Al-Tebbaneh love with Aisha, from Bab Al-Tebbaneh. The play’s debut in Beirut was have clashed in recurring bouts of violence. Men, young and old, fire received with a standing ovation for the actors, who hugged each at each other from the rooftops of pockmarked buildings. Sheets are other tearfully on stage. hung across streets to stop snipers targeting passers-by. “It’s the world of theatre that creates this common space for them Even during peaceful periods, residents often avoid passing to gather, talk, discuss,” said Bourjeily, the director. Putting the play through rival districts. Tensions between the two neighborhoods together was fraught with challenges. On the day of the first rehears- worsened as Syria’s war dragged on, with Sunnis identifying with the al, violence broke out in Bab Al-Tebbaneh — where the rehearsals Sunni-led uprising in Syria, and Alawites siding with their religious kin were to be held — so none of the youth from Jabal Mohsen left their of Bashar Al-Assad’s regime. neighborhood. For the second rehearsal, the participants attended It is against that backdrop that a local NGO and director brought but immediately divided themselves into two groups based on their together battle-scarred teens from the two districts to perform in neighborhood, Bourjeily said. Yet when they began sharing their sto- “Love and War on the Rooftop: a Tripolitan Tale”. For four months, the ries as part of the playwriting process, “they saw that they’re like each young residents-some of them former fighters-worked with conflict- other,” said March head Lea Baroudi. resolution group March and Lebanese director Lucien Bourjeily to “They saw that they have the same problems. They suffer from the produce a modern-day tale of romance and reconciliation. same things,” Baroudi told AFP. Some of the shared problems-unem- “I was really hesitant in the beginning because there was some- ployment, unfair stereotypes-feature prominently in “Love and War”. thing I didn’t like-that there were guys from Jabal (Mohsen),” said “I got a job, but as soon as they found out I was from Bab Al-Tebbaneh Tarek Hebbawi, a 24-year-old from Bab Al-Tebbaneh. He saw all they fired me,” one young man said to his nodding companions as they gathered to play cards in one scene. “We’ve all become family, and thankfully we can all sit together-we go down (to Bab Al- Tebbaneh) and they come to us,” said Ahmad Suleiman, a slender 20- year old from Jabal Mohsen.
‘We want to work’ Relations between Lebanon’s 18 religious communities, mainly Christian and Muslim, are tense and have driven the country to politi- cal paralysis. The multi-confessional fabric has been further strained by the spillover from the four-year war in neighboring Syria, sparking violence elsewhere in the country, though not as recurrent and infa- mous as in Tripoli. Hebbawi said he hoped other young residents of the city might see the value in spending time with each other and laying down their guns. “These weapons aren’t for us. They’re for thugs,” Hebbawi said. The play’s organizers say political wrangling and high youth unem- ployment not sectarianism-drive Tripoli’s tensions. “The problem in Tripoli isn’t the result of an ideological struggle. The problem is a lack of employment opportunities,” Baroudi said. She called on officials to reduce youth unemployment to “get them out of this vicious cycle they’re living in.” March is considering open- ing a cafe, run by the cast, between Bab Al-Tebbaneh and Jabal Mohsen where teens could build bonds and plan events instead of joining local militias. Baroudi and the actors also blamed Lebanon’s political class for aggravating tensions in the city by supporting armed groups. “The first thing I want to say is to all the politicians: ‘Don’t stir things up like you did before’,” said Suleiman. “My message for Lebanon is... why all these wars?” said Hebbawi. - AFP SATURDAY, AUGUST 8, 2015
‘Inside Out’ co-director thrilled to bring film to Filipinos he Filipino-American co-director of the box-office hit “Inside Out” it’s a dream come true for him to be Tsharing with Filipinos the animated film he helped create. “It’s kind of a surreal experience because I just watched movies here growing up,” said Ronnie del Carmen, a former advertising art director who migrated to the US in 1989 at 29. He said he loved movies but never expected to be doing films. He joined Pixar in 2000, and before that worked as sto- ry board artist for “Batman: The Animated Series” and for Emma Roberts attends the 2015 Summer TCA - Fox All-Star Party at Soho House on Thursday, Aug. 6, 2015 in Los Angeles. — AP DreamWorks as a story supervisor. “It’s an amazing experi- ence because I’m not just coming home, there’s a movie I helped make that’s opening here,” he said. “It’s a dream come true.” Study finds women few, far He and director Peter Docter spoke to journalists yes- terday in Manila, the last leg of their Asian tour to pro- mote “Inside Out.” The movie that opens in the between in Hollywood films Philippines later this month has earned $630 million at the box office so far. The two directors, who also collabo- ess than a third of the characters in top-grossing Hollywood cent of characters were female, and three-quarters of them rated on “Up” with Del Carmen as story supervisor, said films are female, and women directors are much rarer still, appeared to be under the age of 40. When female characters did they drew from some of their childhood experiences as Laccording to a study Thursday that bemoaned Tinseltown’s appear, they were more likely than their male counterparts to be well as their children’s for the movie they also co-wrote. lack of diversity. Researchers at the University of Southern shown as caregivers and “in a committed romantic relationship.” Docter said it was a challenge to create characters to California’s Annenberg School for Communication and Moreover, only 28 women worked as directors on the 700 top illustrate the emotions and gaggle of voices in the mind Journalism examined 700 hit films released between 2007 and films from 2007 to 2014, the study said. Only three of those of 11-year-old Riley, who moves with her family from the 2014 to measure the extent of gender and ethnic diversity. female directors were black and one was Asian. Of the top 100 Minnesota of her childhood to a run-down townhouse in It concluded that Hollywood remains very much a white male films of 2014, two were directed by women. Looking at race and San Francisco. Sadness begins creeping in Riley’s core domain and called for greater activism to make the silver screen a ethnicity, the study found that 5.8 percent of directors between memories, where bubbly Joy earlier reigned supreme. more accurate reflection of American society. Of the more than 2007 and 2014 were black or African-American and 2.4 percent Anger, Fear and Disgust complete the five emotions in 30,000 speaking characters who appeared on screen between were Asian.—AFP the “headquarters” of her mind. 2007 and 2014, only 30.2 percent were female, the study said. Doctor said they had to consult psychologists and had “Clearly, the norm in Hollywood is to exclude girls and women to pare to five what some experts claim to be as many as from the screen,” the 29-page study said. Last year, only 28.1 per- 27 emotions. They also had to find the right look for each emotion to remind filmgoers that the characters are the personification of feelings and are not little people. “I think it’s simultaneously the most sort of realistic film we’ve ever done and completely fantasy at the same Filmmaker tries to rebut docu time,” Docter said. They used San Francisco and Minnesota as settings aside from Riley’s mind. He said it was a real challenge “because we decided to set it not in the brain but in the mind, so it’s not blood on Japan dolphin hunt vessels ... its consciousness, personality, so we talk about these very abstract things.” They also used moving as a metaphor for growing up, he added. Del Carmen said in Japanese film is being offered as a rebuttal to the Oscar- respect each other’s food culture, war will be a never-ending sto- the end it’s a movie about family, not just Riley and her winning documentary, “The Cove,” which graphically ry,” Yagi told reporters after a screening yesterday in Tokyo. emotions. — AP Adepicted dolphins being slaughtered in the tiny town of She filmed retired whalers reminiscing about the old days, but Taiji. “Behind The Cove” has interviews with Japanese whaling not today’s dolphin hunters or the people engaged in the lucra- officials and footage of a whaling festival and Hiroshima atomic tive business of selling dolphins to overseas aquariums and bomb victims to counter what director Keiko Yagi thinks is an marine shows. “The Cove” was named best documentary at the unfair dosage of “Japan-bashing.” 2009 Academy Awards. It referred amply to the aquarium indus- Her film argues that whale meat provided food in the lean try and contained surreptitiously obtained footage of Taiji fisher- years after Japan’s defeat in World War II and was frequently men in small boats, herding a pod of dolphins into the cove, scar- served in school lunches. The practice has been phased out, and ing them with loud clanging noises, and then repeatedly stab- most Japanese these days though have never eaten whale or dol- bing them to death, as the dolphins writhed about, and the water phin meat, no more than Westerners have. “Unless we can turned red. Yagi, who acknowledged she didn’t even own a tripod until halfway through her first film, was delighted people agreed to speak on camera, and her film is largely a stream of interviews. Among those interviewed are “The Cove” star Ric O’Barry and director Louie Psihoyos, as well as members of Sea Shepherd, an activist group against dolphin and whale hunts. O’Barry acknowledges he would have included more Japanese people in “The Cove,” if he had directed. He trained dolphins for the 1960s “Flipper” TV series, had a change of heart and has since devoted his life to defending dolphins. Psihoyos says he does not approve of picking on Japanese people, and the Sea Shepherd looking remarkably friendly before Yagi’s camera. Both O’Barry and Psihoyos declined comment to The Associated Press, saying they had not yet seen the film. In previ- ous interviews with AP, both have said they wanted to point out the cruelty of the dolphin killing. They say only a small group of people in Taiji benefit from the slaughter, and have suggested In this May 18, 2015, file photo, director Ronnie del other ways, such as tourism, to support the local economy. There Carmen poses for a photo upon arrival for the screen- are no immediate screening plans for Yagi’s film. — AP ing of the film “Inside Out” at the 68th Cannes Film Director Keiko Yagi speaks during an interview in Tokyo, Festival. — AP yesterday. — AP SATURDAY, AUGUST 8, 2015
Women stand on a Viking statue on August 1, 2015 during the Icelandic Festival in Gimli, Viking village members display Viking art and life-style to the public. Manitoba. — AFP photos Vikings storm beaches of lakeside Canadian town words and battle axes drawn, shields up, combatants thrust president of Iceland, ”oafur Ragnar Grimsson, was on hand for the and heritage with Manitobans, Canadians and people from all and parry in a stunning recreation of Viking battles at the festival last year. over the world,” she said. “It’s really important for me as a third or SIcelandic Festival of Manitoba in Canada’s midwest. The “Outside of Iceland we have the highest population of people fourth generation of western Icelanders, that connection to the annual Gimli summer festival dates back 126 years to the colo- of Icelandic descent anywhere else in the world,” said Kathi homeland isn’t lost,” commented Robbie Russo, who brought nization of the south shore of Lake Winnipeg by Icelandic immi- Thorarinson Neal, a member of the Islengadagurinn organizing several Icelandic musicians to play at the festival. grants. committee. “The mission of the festival is sharing Icelandic culture “Art is a really great bridge to get our generations communi- The small town 46 miles north of Winnipeg is home to the cating and getting interested in each other,” he said. The cultural largest concentration of residents with Icelandic ancestry outside education component of the festival is important. Re-enactors Iceland and during four days every August hosts a festival which present the daily life of the Vikings of centuries past, including attracts as many as 70,000 visitors. demonstrating their warfare tactics on a field adjacent to the The migrants came in the late 1800s along with several other encampment. ethnic groups, including Hungarians, Ukrainians and Mennonites, This year the blacksmiths, tailors, weavers and other re-enac- accepting Canadian government land grants during the mass set- tors share their knowledge of the Viking cultures across tling of the nation’s vast midwestern plains. Their direct descen- Scandinavia, the British Isles, Iceland, Greenland and Canada’s dants now number 30,000 in Manitoba province and 100,000 Newfoundland island province between the years 850 and 950. across Canada-equivalent to about one-third the current popula- Sporting a luxurious-looking tunic, Christian Arel is playing the tion of Iceland. role of jarl-a Viking royal. It is the tenth year the Quebecer, who A horn announces the opening of a replica Viking village-the moved several years ago to Alberta (two provinces over from main attraction-echoing across the waters of one Canada’s largest Manitoba), has participated in the festival. lakes, which is surrounded by vast prairies and pristine boreal “Viking history is vibrant, dynamic, with a lot going on,” he forests. Warren Cummins, president of the Vikings Vinland said, explaining why he keeps coming back. Also, he added, he Society, which built the replica and organized fight events, told gets to make crafts. “We often see Vikings stereotypes in popu- AFP: “All the fighters and the people that participate in the fight lar culture,” noted Eric LimpalaÎr. The French historian who show go through a training process. “It’s a combination of educa- recently moved to Winnipeg also takes part in the annual festi- tion and entertainment to help dispel the myths and mystery val, appreciating an opportunity to “reestablish certain histori- around the Viking culture,” he said. cal truths.” — AFP
Vikings in the Americas A large stone statue of a stoic Viking welcomes visitors, many of whom have their picture taken with the ancient warrior. This year, the bishop of Iceland, Agnes Sigurdarduttir, was welcomed as official representative of the old country in New Iceland. The SATURDAY, AUGUST 8, 2015
In this photograph taken on April 24, 2015, trekkers and climbers make their way up a trail leading to the village of Gorak Shep and Everest Base Camp deep in the Kumbhu region of the Sagamartha National Forest in north eastern Nepal. — AFP photos Popular Everest trek route still intact after earthquake he vast majority of guesthouses and trails on the popular Miyamoto International had also studied the Annapurna route Mount Everest trekking route emerged unscathed from and, in a report released last month, said that the route was largely TNepal’s devastating earthquake, said an assessment report unaffected, with only six of 250 guesthouses assessed showing released yesterday. Tourism-dependent Nepal had called in inter- repairable damage. Following the quake, international trekking national experts to examine trekking routes in the Everest and operators expressed concerns about safety, while insurance com- Annapurna region following April’s disaster to certify that they panies have been reluctant to cover trekkers visiting Nepal. were safe for hikers. A team of structural and geotechnical engi- “This report will help assure our visitors of safety,” said Ram neers led by US-based firm Miyamoto International surveyed the Sapkota of a trekking company, Mountain Delights. “But after Everest trail on foot and on a helicopter to check for quake-trig- monsoon the government as well as private tour operators need to gered destruction and hazards. reexamine the dangers pointed in the report and make sure that “About 83 percent of accommodations are undamaged on the the route is not risky,” Sapkota added. main trekking route and others are repairable,” said the firm’s presi- The 7.8-magnitude quake that struck on April 25 killed more dent Kit Miyamoto. Miyamoto identified five damaged areas along than 8,800 people across the Himalayan nation and triggered a the route with rockfall and landslide hazards and suggested divert- deadly avalanche on Mount Everest that killed 18 people including ing the trails to safer alternatives. “A post-monsoon assessment foreign climbers. It also wreaked a trail of death and destruction in has to be done in the region,” Miyamoto said, adding that the short Langtang, another popular trekking trail. Nepal’s snow-capped window of time ahead of the monsoon made it difficult for a com- peaks make it a trekker’s destination, with around 150,000 of them prehensive study. visiting the Annapurna circuit and Everest region every year. — AFP Tulsi Gautam, chief of Nepal’s tourism department, said that the government is committed to follow up on the recommendations. “We have already allocated budget for this purpose and will begin work as soon as the monsoon ends,” Gautam said.
Porters haul their mer- chandise on their back up a valley near Pangboche in the Khumbu region that eventually leads up to much higher altitude in north east Nepal. TECHNOLOGY SATURDAY, AUGUST 8, 2015 New hacks strike heart of mobile innovations
LAS VEGAS: As fierce competition leads to rapid innovation in the smartphone market, hackers have pounced on cracks in defenses of developments on devices at the heart of modern lifestyles, experts say. Smartphones have become increasingly targets for cyber crimi- nals as people cram the gadgets with troves of personal informa- tion and go on to use them for work. “Mobile devices are taking a bigger place in businesses and in our lives,” Avi Bashan of Tel Aviv based cyber defense firm Check Point Software Technologies told AFP on Thursday at a Black Hat computer security conference in Las Vegas. “As more people use them for more things, attackers gain interest.” Check Point has seen attacks rise during the past three years on the world’s leading mobile operating systems - Apple iOS and Google-backed Android, according to Bashan. Check Point researchers at Black Hat revealed a vulnerability that allows hackers take over Android smartphones by taking advantage of a tool pre- installed that was intended to give tech support workers remote access to devices. “It effects every version of Android,” Check Point mobile threat prevention director Ohad Bobrov said. The hack can be triggered by tricking a smartphone user into installing an application rigged to reach out and connect with the pre-installed support tool, Bobrov explained. In some cases the hack can be accomplished by sending a text message that a recipient doesn’t even have to open, he warned. The text message tricks a smartphone into thinking it is connecting with a legitimate support technician remotely when it is actually linking to an online server commanded by a hacker. “I need your phone number and that is it,” Bashan told AFP. Bobrov said the flaw in Android software architecture has been disclosed to Google and smartphone makers.
Dealing with Stagefright This image provided by onelogin.com shows a recruitment ad for the tech startup company featuring engineer The Check Point revelation came a week after cyber security firm Isis Anchalee. — AP Zimperium warned of a “Stagefright” vulnerability in the world’s most popular smartphone operating system that also lets hackers take control with a text message. Zimperium research senior direc- Women tweet ilooklikeanengineer, tor Joshua Drake took a stage at Black Hat to discuss Android code at the heart of the problem. Stagefright automatically pre-loads video snippets attached to Facebook turns to stream services text messages to spare recipients from the annoyance of waiting to view clips. Hackers can hide malicious code in video files and it will Breaking down gender stereotypes in the industry be unleashed even if the smartphone user never opens it or reads the message, according to Drake. Stagefright imperils some 95 per- NEW YORK: Thousands of female engineers, coders, self- Meerkat and Periscope launched. The Live videos will be auto- cent, or an estimated 950 million, of Android phones, according to described science nerds and other tech superstars joined a matically published to the celebrity’s Facebook page so they can the security firm. Zimperium reported the problem to Google and Twitter campaign this week to break down stereotypes about be viewed on demand. The page’s administrators can remove it, provided the California Internet firm with patches to prevent what engineers should look like. just like any other post. Although it’s possible to save streams on breaches. Updates have started hitting Android devices, according As of Thursday afternoon, more than 75,000 people used the Periscope and Meerkat to your phone, this isn’t done automati- to Drake. Computer security firm Secunia on Thursday said about hashtag ILookLikeAnEngineer to post photos of themselves and cally. 80 vulnerabilities were discovered in Apple mobile operating soft- promote gender diversity in technology, according to analytics ware so far this year and about 10 were found in Android. “There has been a big boom in mobile,” Drake said. “When there firm Topsy. The campaign started when Isis Anchalee, an engi- Physical media falling is a big boom, people take a lot of shortcuts, when you take short- neer at tech startup OneLogin, got an avalanche of attention Meanwhile, Blu-ray players capable of showing movies with cuts you build up a lot of technical debt.” Mobile operating system after her photo appeared in a recruitment ad for her company. super-crisp images will likely hit stores this holiday season. Ultra makers who raced ahead now have to backtrack to squash bugs, The ad features Anchalee, with long, wavy hair and glasses, HD Blu-ray players support four times as many pixels as existing some of which are exposed by good-guy hackers. Check Point’s smiling in a black T-shirt bearing her company logo. Many peo- Blu-ray players. The Blu-ray Disc Association will start licensing Bashan sees it as a case of smartphone rivals moving so fast to add ple could not believe that an attractive woman could also be an the technical specifications for such players starting Aug. 24. features and improvements that innovation trumped security at engineer at a tech company and assumed that the company had Currently, content for Ultra HD TV sets, also known as 4K, are lim- times in the process. “The operating systems developed so quickly,” hired a model for its recruiting efforts. “I didn’t want or ask for ited to certain streaming videos offered by Netflix, Amazon, Bashan said.”And when you develop quickly, some things get any of this attention, but if I can use this to put a spotlight on YouTube and M-Go. IHS estimates that 11.7 million homes developed badly.” — AFP gender issues in tech I consider that to be at least one win,” she worldwide had 4K TVs as of 2014. In addition, some media play- wrote in an essay on Medium. As such, she suggested people ers from manufacturers like Sony let you watch 4K video down- use #ILookLikeAnEngineer to post photos of themselves and loaded to it. redefine perceptions of what engineers should look like. From Spending on physical media has been falling, with US pack- Apple music has more the look of the photos, it’s working. And it’s not only women. aged disc sales down 14 percent to $2.8 billion in the first half of Other traditionally underrepresented groups in tech, such as the year, while subscription streaming revenue grew 25 percent than 11m subscribers African-American men, have joined in too, as the campaign to $2.4 billion, according to the Digital Entertainment Group, an grows bigger each minute. industry consortium pairing Hollywood studios and manufactur- NEW YORK: Apple says more than 11 million people have ers. Panasonic demonstrated its Blu-ray player at the signed up for a trial of its music streaming service since it Facebook streaming International CES gadget show in January and is expected to be launched on June 30. The three-month trial membership is In other news Facebook is launching its own live streaming among the manufacturers that’ll have a model ready soon. free. After that, individuals can pay $10 a month, while fami- service - with a catch: It’s only for famous people. The streaming Expect bundles with 4K movie discs - though specific studios lies of up to six people can pay $15 a month for unlimited tool, called Live, is part of Facebook’s Mentions app, which lets and bundle pricing haven’t been announced yet. Ultra HD Blu- access to Apple Music on their devices. Apple says 2 million celebrities, athletes, politicians and other public figures interact ray discs will provide picture quality up to resolutions of 3,840- people have signed up for the family plan trial. In addition with fans. Facebook says Live lets public figures host question by-2,160 pixels (which is known as 4K). They will also support to the streaming subscription plan, Apple Music also and answer sessions, make announcements or take their fans high frame rates up to 60 frames per second for hyper-realistic includes a free Internet radio station and a media platform behind the scenes, all in real time. motion and object-based surround sound, including the Dolby for artists to upload songs and videos for fans. In compari- Live comes amid the popularity of two live-streaming apps Atmos and DTS:X formats, though studios decide which movies son, popular music streaming service Spotify has more than 20 million paying subscribers. available to anyone, Meerkat and Twitter’s Periscope. Facebook get those upgrades on a case-by-case basis. — AP says it has been planning its service since last year, before TECHNOLOGY SATURDAY, AUGUST 8, 2015 Emojis are taking over advertising
PARIS: Everyone speaks emoji, and now adver- is about branding. “Stickers have to represent tisers do too. Catching on to the digital era’s emotions. A logo doesn’t work by itself,” said cross-cultural language of choice, advertisers Feeligo co-founder Davide Bonapersona, whose have learned to speak emoji in a world where campaigns have spread to several European promotional videos are ignored and ad banners countries and which often cost clients less than are blocked. Tiny digital pizza and French fries traditional formats. icons, and pictures of animals and planes are “Depending on the target, we are looking at being used to advertise fast food, airlines and 20,000 to 100,000 euros ($22,000 to $110,000),” even NGOs. Bonapersona said. US-based Swyft Media and Emoji characters have become at least as Asian messaging apps Line and WeChat share pervasive as smartphones, and users are moving this growing niche market with Feeligo. The lat- away from communication platforms that allow est advertising trend is mainly logo-free, giving advertising towards networks that don’t, said emoji users on both ends of the chat more free- Marie Dolle, a digital media content specialist at dom. Kantar Media. “Users are saturated with publicity,” Dolle In their online advertising campaigns, the said, adding that many people use free software World Wildlife Fund charity and Domino’s Pizza that blocks pop-up advertising to keep their have tapped into the bank of emoji icons uni- screens uncluttered by ad banners and videos. NEW YORK: A Garmin Forerunner 310XT GPS Sports Running Multisports Speed & versally approved by the Unicode Consortium, Emoji is “less aggressive, it’s not intrusive. We Distance Watch, an Amazon Kindle, Apple iPod Shuffle and a Canon S110 camera are the non-profit group that develops and main- give them playful tools that they can choose arranged for a photo. — AP tains digital standards. whether or not to use. This contributes to mak- In May, McDonald’s — a pioneer in emoji ing people love the brand and share it in their advertising-launched its own digital stickers conversations,” she added. Review: stand alone gadgets package that allows users to pictures of Big France’s state-owned postal service La Poste Macs, sundaes and chicken nuggets into their has also launched its own stickers in the shape vie against all-in-one devices Whatsapp, Facebook Messenger or text mes- of personalized stamps to celebrate special days sages. Disney and Duracell have commissioned in users’ lives, such as the birth of a child or a Which gadget does the everyday person prefer? Feeligo, a Paris-based start-up, to create their wedding. The campaign has proved a major brand stickers. Last winter, Duracell’s iconic pink success, with the digital stamps seen by users NEW YORK: When Apple announced new iPod to display current pace, average pace for the bunny was shared 20 million times alone. more than nine million times, said Rassem music players a few weeks ago, many people whole run or average pace since the last split. The Swedish low-cost homeware giant Ikea also Belhouadjeb, a member of La Poste’s digital asked why anyone would need iPods when smart- model I currently use, the Forerunner 310XT, is launched an emoji range depicting its products marketing team. “We exceeded our goal eight phones can play music and more. I had that ques- bulky and isn’t meant for all-day use. There’s no earlier this year, from furniture to the meatballs times over,” he said. But emoji campaigns may tion myself - until I remembered I’ve been carry- touch screen or anything fancy. But it’s great for sold in its cafeterias. do little to keep brands’ foes at bay, as a prank ing an iPod almost every day, mostly for my runs. what it’s supposed to do. Plus, because it’s an old- by a graffiti artist in the British city of Bristol There are times a stand-alone device such as er model, you can find one for well below the ‘Less aggressive’ than ads showed this summer. The artist had some fun an iPod works better than a jack-of-all-trades like a $250 suggested retail price. Emoji advertising is just as much about com- with one of McDonald’s billboards, embellishing smartphone. A stand-alone device does one or munication and having a sense of humour as it it with a vomiting emoji. — AFP two things, but does them really well. Of course, E-book readers this means one more thing to buy and carry, so With a stand-alone reader, I’m not constantly the phone is often simpler. But here are ways you tempted to check email and Facebook, as I am might find a stand-alone device preferable. reading on a tablet. In addition, e-reader screens are typically better than tablets outdoors because Music players they have to be only good for displaying black- Sure, I can listen to music on my smartphone, and-white text - not colorful video, photos or but it’s not convenient on a run. The iPod Nano is magazines. With tablets, you have glare. much easier to carry, and all the music and pod- I’ve found Amazon’s Kindles among the best e- casts on it doesn’t eat up space on my phone. readers. They tend to be slimmer and lighter than Apple just updated all three iPod models, but only other readers, and they have reading-related the iPod Touch changed significantly. The Touch extras, such as more information on characters, is essentially an iPhone without the cellular con- places and terms in a novel. The $119 Paperwhite nection, so it isn’t really a stand-alone music play- model will be adequate for most people. The er. The ones that are - the Nano and the Shuffle - Voyage has conveniences such as auto-brightness got only minor updates, namely in the choices of for the screen, but it’s also $80 more. color. Then again, as a device designed to play audio, Digital cameras neither needs a super-fast processor. The $49 I used to shudder when I saw people rely on Shuffle is cheaper than the $149 Nano, but the smartphones for their precious digital memories, Shuffle lacks a display and gives you fewer as stand-alone cameras were much better. But options to choose songs, forward or rewind. The these days, I usually leave my stand-alones Nano also has an FM receiver and fitness-tracking behind, too. Smartphones have improved capabilities - though a stand-alone fitness device tremendously and even outsmart point-and- is better for that. shoot cameras sometimes with advanced soft- ware. Stand-alone cameras still excel in two ways: Fitness devices When you’re zooming on a phone, you’re get- I’ve worn smartwatches like the Apple Watch ting a software adjustment that’s akin to crop- PARIS: A picture shows emoji characters also known as emoticons on the screens of two and general-purpose fitness trackers like the ping. The zoomed images won’t be as sharp as mobile phones. — AFP Fitbit. I’ve also used my phone and the Nano to what you get with either point-and-shoots or full- track my workouts. None of that beats my Garmin bodied, SLR cameras. Phones are too thin to have GPS sports watch, which specializes in tracking the lens itself do the zooming by projecting out. Reddit updates content policy running, cycling and swimming workouts. That’s SLR cameras have larger sensors, which can not to say the other devices aren’t good. The pick up light better. In low-light environments, NEW YORK: Reddit, the online discussion site “involuntary pornography” are still banned. So Apple Watch is quite accurate when you have an the phone camera’s shutter has to stay open known for free-wheeling discussions, is updat- what’s new? A community can now be quaran- iPhone with you, as it borrows the phone’s GPS. slightly longer to let in enough light, a technique ing its content policy as it tries to be a more wel- tined - so that only people who choose to see its The high-end Fitbit Surge model comes with GPS, that introduces blur. Better phones have image- coming place for everyone. Co-founder and CEO content can see it. Huffman says groups will be as does Sony’s SmartWatch 3 and Microsoft’s stabilizing technology to counter that, but it’s not Steve Huffman posted on the site Wednesday quarantined if they would be “extremely offen- Band. the same as getting enough light to begin with. that the goal is to consolidate the “various rules sive” to the average Redditor. He says Reddit is But the Garmin watches I’ve used do a lot Usually, a good phone camera is good enough, and policies that have accumulated over the also banning communities that exist solely to more. You can record splits, such as the time it but it’s no match for a stand-alone camera, partic- years into a single set of guidelines.” annoy others, and “generally make Reddit worse takes to complete a lap. For pace, you can choose ularly an SLR, for those special moments. He says illegal content, inciting violence and for everyone else.” — AP TV listings SATURDAY, AUGUST 8, 2015
17:40 Impossible Engineering 20:20 H2O: Just Add Water 08:00 Chopped 21:30 Breathless 07:00 Late Night With Seth Meyers 18:30 The Island With Bear Grylls 20:45 H2O: Just Add Water 09:00 The Big Eat... 22:30 Callie-Anne Cooks Into The 08:00 The Simpsons 19:20 Asphalt Cowboys 21:10 Good Luck Charlie 09:30 The Big Eat... Wild 08:30 Til Death 20:10 Alaskan Bush People 21:35 Wizards Of Waverly Place 10:00 The Kitchen 23:00 Coronation Street 09:00 Baby Daddy 21:00 Railroad Alaska 22:00 Wizards Of Waverly Place 11:00 The Kitchen 23:25 Coronation Street 09:30 Melissa & Joey 00:45 Tanked 21:50 Storage Hunters UK 22:25 Sabrina: Secrets Of A Teenage 12:00 Easy Chinese 23:50 Coronation Street 10:00 Melissa & Joey 01:40 The Lion Queen 22:15 Storage Hunters UK Witch 12:30 Easy Chinese 10:30 Cristela 02:35 River Monsters 22:40 Storage Hunters UK 22:50 Sabrina: Secrets Of A Teenage 13:00 Guy’s Big Bite 11:00 The Tonight Show Starring 03:25 Gator Boys 23:05 Big Giant Swords Witch 13:30 Guy’s Big Bite Jimmy Fallon 04:15 I’m Alive 23:55 Fast N’ Loud: Demolition 23:10 Wolfblood 14:00 Diners, Drive-Ins & Dives 12:00 The Goldbergs 05:02 Treehouse Masters Theater 23:35 Wolfblood 14:30 Diners, Drive-Ins & Dives 12:30 The Simpsons 05:49 The Lion Queen 15:00 Diners, Drive-Ins & Dives 13:00 Til Death 06:36 Meet The Sloths 15:30 Diners, Drive-Ins & Dives 13:30 Cristela 07:00 Meet The Sloths 16:00 Diners, Drive-Ins & Dives 00:10 Locked Up Abroad 14:00 New Girl 07:25 Tanked 16:30 Diners, Drive-Ins & Dives 01:00 Bridge The Gap 14:30 Melissa & Joey 08:15 Tanked 17:00 Chopped 02:00 Classified: Secret Service Files 15:00 Melissa & Joey 09:10 Tanked 18:00 Siba’s Table 02:55 Finding Atlantis 15:30 The Daily Show With Jon 10:05 Tanked 18:30 Siba’s Table 03:50 Last War Heroes Stewart 11:00 Tanked 00:00 Violetta 00:00 #RichKids Of Beverly Hills 19:00 Roadtrip With G. Garvin 04:45 Ultimate Survival Alaska 16:00 The Nightly Show With Larry 11:55 Austin Stevens: Snakemaster 00:45 The Hive 00:55 Extreme Close-Up 19:30 Roadtrip With G. Garvin 05:40 Bridge The Gap Wilmore 12:50 Wild Dog Island 00:50 Sabrina: Secrets Of A Teenage 01:25 THS 20:00 Chopped South Africa 06:35 Dead End Express 16:30 The Goldbergs 13:45 Shamwari: A Wild Life Witch 02:20 E! News 21:00 Diners, Drive-Ins & Dives 07:30 The Big Picture With Kal Penn 17:00 Late Night With Seth Meyers 14:15 Shamwari: A Wild Life 01:15 Sabrina: Secrets Of A Teenage 03:15 Keeping Up With The 21:30 Diners, Drive-Ins & Dives 07:55 The Big Picture With Kal Penn 18:00 Baby Daddy 14:40 Africa’s Outsiders Witch Kardashians 22:00 Roadtrip With G. Garvin 08:25 Cesar To The Rescue 18:30 New Girl 15:35 Gangland Killers 01:40 Wolfblood 04:10 E!ES 22:30 Roadtrip With G. Garvin 09:20 Cesar To The Rescue 19:00 Your Family Or Mine 16:30 The Lion Queen 02:05 Wolfblood 05:05 E!ES 23:00 Food Court Wars 10:15 Wicked Tuna 19:30 The Mindy Project 17:25 Wild Dog Island 02:30 Violetta 06:00 Keeping Up With The 11:10 Dino Death Match 20:00 The Tonight Show Starring 18:20 Shamwari: A Wild Life 03:15 The Hive Kardashians 12:05 Bizarre Dinos Jimmy Fallon 18:50 Shamwari: A Wild Life 03:20 Sabrina: Secrets Of A Teenage 06:55 Keeping Up With The 13:00 Inside Maritime Singapore 21:00 The Daily Show Global Edition 19:15 Africa’s Outsiders Witch Kardashians 14:00 Megastructures 21:30 The Nightly Show Global 20:10 Gangland Killers 03:45 Sabrina: Secrets Of A Teenage 07:50 Style Star 15:00 Innovation Nation Edition 21:05 The Lion Queen Witch 08:20 E! News 15:30 Innovation Nation 22:00 Saturday Night Live 22:00 Big Fish Man 04:10 Wolfblood 09:15 #RichKids Of Beverly Hills 00:35 The Chase 16:00 The Big Picture With Kal Penn 23:00 Married 22:55 Austin Stevens: Snakemaster 04:35 Wolfblood 10:15 #RichKids Of Beverly Hills 01:30 Callie-Anne Cooks Into The 16:30 The Big Picture With Kal Penn 23:30 Late Night With Seth Meyers 23:50 Man-Eating Zombie Cats 05:00 Violetta 11:10 The E! True Hollywood Story Wild 05:45 The Hive 12:05 E! News 02:00 Blue Go Mad In Ibiza 17:00 Cosmos: A Spacetime 05:50 Mouk 13:05 New Money 02:55 Emmerdale Odyssey 06:00 Mako Mermaids 13:35 New Money 03:20 Emmerdale 18:00 Star Talk 06:25 Hank Zipzer 14:05 Christina Milian Turned Up 03:45 Emmerdale 19:00 Ultimate Survival Alaska 06:50 Girl Meets World 15:00 Fashion Bloggers 04:10 Emmerdale 20:00 The Big Picture With Kal Penn 00:00 Scandal 07:15 H2O: Just Add Water 15:30 Fashion Bloggers 04:35 Emmerdale 20:25 The Big Picture With Kal Penn 01:00 Sleepy Hollow 00:35 Tareq Taylor’s Nordic Cookery 07:40 Suite Life On Deck 16:00 House Of DVF 05:00 Emmerdale 20:50 Cosmos: A Spacetime 02:00 Devious Maids 01:00 Come Dine With Me 08:05 Suite Life On Deck 17:00 House Of DVF 05:25 Emmerdale Odyssey 03:00 The Knick 01:25 Homes Under The Hammer 08:30 Suite Life On Deck 18:00 E! News 05:45 Coronation Street 21:40 Star Talk 04:00 Drop Dead Diva 02:20 Bargain Hunt 08:55 Suite Life On Deck 19:00 E!ES 06:10 Coronation Street 22:30 Ultimate Survival Alaska 05:00 The Astronaut Wives Club 03:05 Extreme Makeover: Home 09:20 Suite Life On Deck 20:00 Keeping Up With The 06:35 Coronation Street 23:20 The Big Picture With Kal Penn 07:00 Resurrection Edition Specials 09:45 Girl Meets World Kardashians 07:00 Coronation Street 23:45 The Big Picture With Kal Penn 08:00 Bones 03:45 Extreme Makeover: Home 10:10 Good Luck Charlie 21:00 #RichKids Of Beverly Hills 07:25 Coronation Street 09:00 The Astronaut Wives Club Edition Specials 10:35 The Princess Diaries 2: Royal 22:00 E! News 07:50 Sunday Night At The Palladium 10:00 Drop Dead Diva 04:25 Tareq Taylor’s Nordic Cookery Engagement 23:00 The Soup 08:50 Paddock To Plate 11:00 Sleepy Hollow 04:50 Bargain Hunt 12:40 Dog With A Blog 09:50 Come Date With Me Australia 13:00 The Ellen DeGeneres Show 05:35 Come Dine With Me 13:05 Girl Meets World 10:15 Come Date With Me Australia 14:00 Bones 06:00 Homes Under The Hammer 13:30 Austin & Ally 10:40 Come Date With Me Australia 15:00 Scandal 07:00 Homes Under The Hammer 13:55 Mako Mermaids 11:10 Come Date With Me Australia 00:30 The Daily Show With Jon 17:00 The Ellen DeGeneres Show 07:50 Extreme Makeover: Home 14:25 H2O: Just Add Water 11:35 Blue Go Mad In Ibiza Stewart 18:00 Bones Edition Specials 14:55 Lolirock 12:30 Coach Trip 01:00 The Nightly Show With Larry 19:00 C.S.I. 08:30 Masterchef: The Professionals 15:25 Austin & Ally 00:00 Chopped 12:55 Coach Trip Wilmore 20:00 Witches Of East End 09:20 Masterchef: The Professionals 16:00 Jessie 01:00 Siba’s Table 13:25 Coach Trip 01:30 Web Therapy 21:00 Supernatural 10:15 DIY SOS: The Big Build 16:30 Jessie 01:30 Siba’s Table 13:50 Coach Trip 02:00 Web Therapy 22:00 Devious Maids 11:10 Come Dine With Me 17:00 Liv And Maddie 02:00 Chopped South Africa 14:15 Coach Trip 02:30 Married 23:00 Better Call Saul 11:35 Come Dine With Me 17:25 Mako Mermaids 03:00 Man Fire Food 14:40 Sunday Night At The Palladium 03:00 Baby Daddy 12:00 Come Dine With Me 17:50 Dog With A Blog 03:30 Man Fire Food 15:35 Endeavour 03:30 New Girl 12:25 Come Dine With Me 18:15 I Didn’t Do It 04:00 Diners, Drive-Ins & Dives 17:15 Breathless 04:00 The Simpsons 12:50 Come Dine With Me 18:40 Girl Meets World 04:30 Diners, Drive-Ins & Dives 18:05 Doc Martin 04:30 The Tonight Show Starring 13:15 DIY SOS: The Big Build 19:05 The Next Step 05:00 Chopped 19:00 The Chase Jimmy Fallon 14:10 Extreme Makeover: Home 19:30 H2O: Just Add Water 06:00 Iron Chef America 19:45 Sunday Night At The Palladium 05:30 Til Death Edition Specials 19:55 H2O: Just Add Water 07:00 Roadtrip With G. Garvin 20:40 Doc Martin 06:00 The Goldbergs 01:00 Good Morning America 14:50 Masterchef: The Professionals 07:30 Roadtrip With G. Garvin 06:30 Cristela 03:00 American Horror Story: Freak 15:40 Masterchef: The Professionals Show 16:35 Homes Under The Hammer 04:00 Empire 17:25 DIY SOS: The Big Build 05:00 Good Morning America 18:20 Extreme Makeover: Home 08:00 The Ellen DeGeneres Show Edition Specials 09:00 Prison Break 19:00 Masterchef: The Professionals 11:00 The Ellen DeGeneres Show 19:50 Masterchef: The Professionals 12:00 24 20:45 DIY SOS: The Big Build 13:00 The Blacklist 21:35 Come Dine With Me 15:00 Live Good Morning America 22:00 Homes Under The Hammer 16:00 Prison Break 22:55 Kirstie’s Fill Your House For 17:00 24 Free 18:00 The Blacklist 23:40 Kirstie’s Fill Your House For 19:00 Prison Break Free 20:00 24 21:00 The Blacklist 22:00 American Horror Story: Freak Show 23:00 Empire
00:20 Fast N’ Loud 01:10 Fast N’ Loud 02:00 Extreme Car Hoarders 02:50 Street Outlaws 00:00 The Exorcism Of Emily Rose 03:40 Auction Hunters: Pawn Shop 02:00 47 Ronin-PG15 Edition 04:00 Double Take-PG15 04:05 Storage Hunters UK 06:00 Shadow Conspiracy-PG15 04:30 American Digger 07:45 Shaolin-PG15 05:00 What Happened Next? 10:00 The Wolverine-PG15 05:30 How Do They Do It? 12:15 Befriend And Betray-PG15 06:00 Dynamo: Magician Impossible 14:00 Shadow Conspiracy-PG15 06:50 Mythbusters 15:45 The Recruit-PG15 07:40 The Carbonaro Effect 17:45 Shaolin-PG15 08:05 Magic Of Science 20:00 Ender’s Game-PG15 08:30 The Island With Bear Grylls 22:00 Android Cop-PG15 09:20 Asphalt Cowboys 23:45 300-18 10:10 Dual Survival 11:00 Yukon Men 11:50 Yukon Men 12:40 Yukon Men 13:30 Yukon Men 14:20 Yukon Men 00:00 Wedding Crashers 15:10 Dual Survival 02:00 Captain Ron 16:00 Ice Cold Gold 300 ON OSN MOVIES ACTION HD 04:00 Life With Mikey 16:50 Ice Cold Gold 06:00 The Life Aquatic With Steve TV listings SATURDAY, AUGUST 8, 2015
Zissou 08:00 Catch That Kid 10:00 Life With Mikey 12:00 Streetdance: All Stars 14:00 The Life Aquatic With Steve Zissou 16:00 Vamps 18:00 Moms’ Night Out 20:00 Gun Shy 22:00 Tim And Eric’s Billion Dollar Movie
01:15 Little Red-PG15 03:00 Mandela: Long Walk To Freedom-PG15 05:30 Breathe In-PG15 07:15 Blancanieves-PG15 09:00 Playing For Keeps-PG15 10:45 Breathe In-PG15 12:30 Mandela: Long Walk To Freedom-PG15 15:00 The Bag Man-PG15 17:00 Playing For Keeps-PG15 19:00 Fruitvale Station-PG15 20:30 Prisoners-PG15 23:00 Dallas Buyers Club-18
02:30 Nebraska 04:45 Jack And The Cuckoo Clock Heart 06:45 All Is Lost 09:00 The Letter 11:00 Nebraska 13:00 The Fifth Estate 15:15 Serial (Bad) Weddings 17:00 The Double 19:00 Collaborator 21:00 Hoffa 23:30 Jennifer Eight
PARANORMAL ACTIVITY- THE MARKED ONES ON OSN MOVIES PREMIERE HD 01:15 Inside Llewyn Davis-PG15 03:15 Man Of Tai Chi-PG15 17:10 Ninjago: Masters Of 09:00 Limon And Oli 05:15 Postman Pat: The Movie-PG Spinjitzu 09:10 Doc McStuffins 07:00 The Gabby Douglas Story-PG 17:30 Ninjago Master Of Spinjitzu 09:35 Mickey Mouse Clubhouse 09:00 A Promise-PG15 New 10:00 Sofia The First 11:00 The Secret Life Of Walter Mitty- 01:30 Live PGA Tour 17:55 Teen Titans Go! - Elements 10:25 Nina Needs To Go PG15 03:30 AFL Premiership 18:06 Teen Titans Go! 10:30 Jake And The Never Land 13:00 Big Hero 6-PG 06:30 Live AFL Premiership 00:00 The Listener 03:20 Total Drama: All Stars 18:15 Teen Titans Go! Pirates 15:00 Tinker Bell And The Pirate 01:00 Castle 18:40 The Amazing World Of 10:55 Miles From Tomorrow Fairy-FAM 10:30 Live NRL Premiership 03:42 Total Drama: All Stars 02:00 Transporter: The Series Gumball 11:20 Doc McStuffins 17:00 A Promise-PG15 12:30 World Rugby 04:05 Ninjago: Masters Of 03:00 Car Lot Rescue Spinjitzu 19:25 Adventure Time 11:45 Henry Hugglemonster 19:00 The Other Woman-PG15 13:00 Live The Rugby Championship 20:10 Regular Show 12:00 Henry Hugglemonster 21:00 Barefoot-PG15 15:15 Live Rugby Union Currie Cup 04:00 The Hero 04:28 Ninjago: Masters Of 05:00 Cougar Town Spinjitzu 20:55 Teen Titans Go! - Elements 12:15 Mickey Mouse Clubhouse 23:00 Black Rock-18 17:30 The Rugby Championship 21:06 Teen Titans Go! 12:35 Sheriff Callie’s Wild West 05:30 Cougar Town 04:50 Teen Titans Go! Highlights 21:15 Transformers: Robots In 13:00 Miles From Tomorrow 06:00 According To Jim 05:00 Teen Titans Go! 18:00 Live The Rugby Championship Disguise 13:25 Jake And The Never Land 06:30 According To Jim 05:10 Grojband 05:35 Grojband 21:40 Adventure Time Pirates 07:00 The Bridge 21:51 Adventure Time 13:50 Miles From Tomorrow 08:00 Private Practice 06:00 Clarence 06:20 Ben 10: Omniverse 22:02 Adventure Time 14:15 Jake And The Never Land 01:00 Miffy The Movie 09:00 Private Practice 22:13 Adventure Time Pirates 10:00 Transporter: The Series 06:40 Ben 10: Omniverse 02:45 Justin And The Knights Of The 07:00 Ninjago Master Of Spinjitzu 22:25 Johnny Test 14:50 Doc McStuffins 00:30 Golfing World 11:00 Car Lot Rescue Valour New 23:10 Regular Show 15:15 Sofia The First 07:00 World Rugby 12:00 The Hero 23:55 Total Drama: All Stars 15:40 Art Attack 04:30 Garfield’s Fun Fest 07:30 NRL Full Time 07:25 Transformers: Robots In 13:00 Cougar Town Disguise 00:20 Total Drama: All Stars 16:05 Nina Needs To Go 06:00 Justin And The Knights Of The 08:00 Live NRL Premiership 13:30 According To Jim 00:40 Grojband 16:10 Lilo & Stitch Valour 07:45 Matt Hatter New 12:30 Live NRL Premiership 14:00 Army Wives 08:10 Teen Titans Go! - Elements 01:05 Grojband 16:35 Adventures Of The Gummi 07:45 Pim And Pom: The Big 15:15 Live Rugby Union Currie Cup 15:00 Army Wives 08:22 Teen Titans Go! 01:25 Teen Titans Go! Bears Adventure 17:30 ICC Cricket 360 16:00 MasterChef Australia 08:30 Teen Titans Go! 01:50 Regular Show 17:00 Chip n Dale Rescue 09:15 Dinosaur Island 18:00 European Tour Weekly 17:00 Melissa & Joey 08:55 The Amazing World Of 02:35 Johnny Test Rangers 10:45 See Spot Run 17:30 Happy Endings Gumball 17:25 Ducktales 19:00 Live World Golf 17:50 Jake And The Never Land 12:30 Justin And The Knights Of The 18:00 End Game 09:06 The Amazing World Of Championships Pirates Valour 19:00 The Walking Dead Gumball 09:15 Johnny Test 18:00 Miles From Tomorrow 14:15 Little Gobie 20:00 The Walking Dead 18:25 Messages From Miles 16:00 Ernest & Celestine 21:00 Melissa & Joey 10:00 Adventure Time 10:11 Adventure Time 18:30 Sofia The First 18:00 Dinosaur Island 21:30 Happy Endings 18:55 Nina Needs To Go 22:00 The Listener 10:25 Clarence 20:00 Home Alone 3 10:45 Steven Universe 03:10 Henry Hugglemonster 19:00 Jake And The Never Land 12:00 Live The Ashes: ENG v AUS, 23:00 The Listener Pirates 22:00 Little Gobie 4th Test, Day 3 11:10 Regular Show 03:20 Calimero 23:45 Ernest & Celestine 11:55 Uncle Grandpa 03:35 Zou 19:30 Loopdidoo 21:00 ICC Cricket 360, Episode 31 19:45 Doc McStuffins 23:30 Ashes H/Ls: 4th Test, Day 3 12:06 Uncle Grandpa 03:45 Loopdidoo 12:17 Uncle Grandpa 04:00 Art Attack 20:00 Adventures Of The Gummi 12:28 Uncle Grandpa 04:25 Henry Hugglemonster Bears 12:40 Ninjago Master Of Spinjitzu 04:35 Calimero 20:30 Sofia The First 01:45 The Outfit New 04:50 Zou 20:55 Cars Toons 01:30 Captain Phillips-PG15 03:25 The Arrangement-PG 13:00 Ninjago: Masters Of 05:00 Loopdidoo 21:00 Chip n Dale Rescue 03:45 Muppets Most Wanted-PG Spinjitzu 05:15 Art Attack Rangers 05:30 Challenge To Lassie-FAM 21:25 Ducktales 05:45 Saving Mr. Banks-PG15 07:00 Easter Parade-FAM 13:25 Teen Titans Go! - Elements 05:35 Henry Hugglemonster 05:50 Calimero 21:50 Lilo & Stitch 08:00 Searching For Sugar Man- 01:15 Garage Sale Mystery 08:40 Guns For San Sebastian-PG 13:37 Teen Titans Go! 13:45 Matt Hatter New 06:00 Zou 22:15 Zou PG15 02:45 Nixon 10:30 Ride, Vaquero!-FAM 14:10 Transformers: Robots In 06:15 Loopdidoo 22:30 Art Attack 10:00 Turbo-PG 05:45 Out Of Reach 12:00 The Oklahoma Kid-FAM Disguise 06:25 Limon And Oli 22:55 Limon And Oli 11:45 Captain Phillips-PG15 07:30 The Four 13:20 Across The Wide Missouri- 14:30 Ben 10 06:35 Art Attack 23:05 Henry Hugglemonster 14:00 Police Story-PG15 09:30 A Good Man In Africa FAM 14:55 Ben 10 07:00 Calimero 23:20 Calimero 16:00 Searching For Sugar Man- 11:00 Armageddon 14:40 The Fighting 69th-PG 15:15 Adventure Time 07:10 Zou 23:35 Zou PG15 15:40 The Amazing World Of 07:25 Minnie’s Bow-Toons 23:50 Loopdidoo 13:30 Age Of The Dragons 16:00 Penelope-FAM 00:05 Art Attack 18:00 Anchorman 2: The Legend 15:00 One Day 17:40 The Yellow Rolls-Royce-PG Gumball 07:30 Jake And The Never Land Pirates 00:30 Henry Hugglemonster Continues-PG15 16:45 Garage Sale Mystery 19:40 They Died With Their Boots 16:25 Regular Show 16:36 Regular Show 07:55 Sofia The First 00:45 Calimero 20:00 St. Vincent-PG15 18:15 Deep Rising On-FAM 16:45 Regular Show 08:20 Sheriff Callie’s Wild West 01:00 Zou 22:00 Paranormal Activity: The 20:00 Deja Vu 22:00 Straight Time-18 16:56 Regular Show 08:45 Loopdidoo 01:15 Loopdidoo Marked Ones-18 22:15 Signs 23:50 The Gypsy Moths 01:30 Art Attack WHAT’S ON SATURDAY, AUGUST 8, 2015
The ‘El-Funoun Dance Troupe’ performed at the Palestine International Festival in Ramallah, Palestine last Wednesday. The performance marked the popular group’s first participation in the festival in 30 years, group member Samer Qaraan told Kuwait News Agency (KUNA).
Greetings Islamic Presentation ight from the very Committee courses first time we held Ryou in our arms, we knew you were special. he Ladies Section of the Islamic Arabic Conversation Course The courses include: Today we find ourselves Presentation Committee (IPC) The IPC Rawdah Ladies Section will l Tilawa Surah Ar-Rad and Surah really happy to see you Twill commence the Autumn commence the Arabic Conversation Ibrahim, on Sunday 5:30 - 7 pm, grown up so beautifully Course in September 6, 2015. It offers Course. The student must have success- September 6, 2015. and filling our lives with Arabic Language Course (basic and fully completed at least 3 levels of l Principles of Tafsir (Part 2), on joy and fun. And may the advanced) designed for Non-Arab Arabic. Placement test will be taken by Sunday, 7 - 8:30 pm, September 6, 2015. years ahead be blessed ladies. Classes are available on Fridays those who took Arabic class outside IPC. l Tajweed 3, on Tuesday, 5:30 - 7 pm, and happy always. Happy and Saturdays. Islamic Subjects and Class is every Friday from 9 - 11 am, September 8, 2015. Birthday to our little Quran Classes are also presented in starting from September 11, 2015. For l Jesus in Surah Mariam (Part 2), on princess, Kripa Mariam different languages. more information, call: IPC Rawdah- Tuesday, 7 - 8:30 pm, September 8, 2015. Laku (Ammu) - Appa, Classes are offered only once a week. 22512257 Instructor: Zeinab Hassan Ashry. Place: Amma, Rohan, Linuppa, For more information, call: Rawdah- Registration of Islamic Courses IPC - Women Section Al-Rawdah - Area 3 Thottathil family and 22512257; Salmlya-25733263; Al-Sadiq- IPC is offering Islamic courses in - St. 30, House 12, Opp. 4th Ring road. For Areekal family. 99285459; Mangaf-23720931; Jahra- English (for ladies (only). more information, call: 2251225 or email: 24567714. Muslims and non-Muslim are welcome. [email protected]. WHAT’S ON SATURDAY, AUGUST 8, 2015
The construction program at Kuwait University recently organized the opening ceremony for the YCE summer training program in cooperation with the American Society of Civil Engineers (ASCE).
Huawei Telecommunications welcomed a delegation from Kuwait University’s College of Engineering and Petroleum, as well as student delegations from France and Thailand at the company’s headquarters in Beijing, China. Abdullah Al-Reesh, third secretary at Kuwait’s embassy in China, attended the ceremony. HEALTH SATURDAY, AUGUST 8, 2015
US teens start school too early - need more sleep
WASHINGTON: Most teenagers in the United States start the academic performance, the CDC said in its Morbidity and mended hour. The effects are not limited to academic perform- school day too early each morning, robbing them of the sleep Mortality Weekly Report. ance, and researchers warned students may also suffer outside they need to concentrate properly and remain healthy, accord- “Getting enough sleep is important for students’ health, the classroom. “Insufficient sleep is common among high ing to a study published Thursday. Fewer than one in five mid- safety, and academic performance,” said Anne Wheaton, lead school students and is associated with several health risks such dle and high schools in the United States start at 8:30 am or lat- author and epidemiologist in CDC’s Division of Population as being overweight, drinking alcohol, smoking tobacco and er, as recommended, according to data from the Centers for Health. “Early school start times, however, are preventing many using drugs,” the CDC study found. Many parents have urged Disease Control and Prevention (CDC). Research from the adolescents from getting the sleep they need.” In 2014, the AAP schools to delay start times, but administrators often refused, American Academy of Pediatrics (AAP) has found that adoles- urged secondary schools not to begin classes until 8:30 am to arguing that after-school extra-curricular activities would be too cents are biologically programmed to stay asleep longer than give teens the 8.5 to 9.5 hours of nightly sleep they need. But hard to organize. An estimated two out of three US students are adults. Depriving teens of that sleep could wreak havoc on their only 17.7 percent of US high schools actually start at the recom- sleep-deprived, according to a 2013 CDC study. —AFP
Thailand has banned commercial surrogacy for foreigners, singles
BANGKOK: Thailand, once a top choice for would-be par- ents around the world who were seeking a surrogate, has narrowed the choices for people looking to hire a woman to carry a fetus in her womb. It had been one of the hand- ful of Asian countries where commercial surrogacy was not specifically banned. And the cost of having a baby by sur- rogate, often with an implanted embryo from biological parents, was less than $50,000 in Thailand, compared to about $150,000 in the United States. However, recent scandals in Thailand involving foreign clients caused a public outcry. In one case, an Australian couple abandoned an infant born to a surrogate last year after they found out the baby had Down syndrome. In another, the son of a Japanese billionaire hired at least a dozen surrogate mothers in what appeared to be an eccentric effort to replicate himself. The law that took effect on July 30 prohibits commercial surrogacy serving foreign clients, with violations punishable by up to 10 years in prison and a fine of up to 200,000 baht ($6,200). Only Thai heterosexual couples married for more than three years can hire surrogates, a provision that excludes gay people since same-sex marriage is not recognized. CONCORD: Photo shows roasted kohlrabi with Parmesan in Concord, NH. Kohlrabi is a member of the brassi- Under an earlier law, the surrogate mother had full ca family and its relatives include broccoli, cauliflower, turnips and kale. Both its bulb and its leaves are edi- rights over the newborn, even though she has no genetic ble, it is tasty raw or cooked and it plays nicely with many other ingredients. —AP ties with the child. The new law gives intended parents full rights upon the child’s birth. The new law also has a tem- porary provision that allows intended parents with a surro- In paternalistic S Korea, ‘sexy gacy contract from before the law came into effect to peti- tion in court for full parental rights. When the law was still being debated, Rarinthip Sirorat, an official from the Social cooking men’ break barrier Development and Human Security Ministry, explained to The Associated Press that its purpose was “to give maxi- ‘Happy Guys Cooking Class’ mum benefits to the surrogate babies.” “What’s significant about it is that Thailand is not going to have international surrogacy anymore,” said Stephen SEOUL: After work on a recent Friday, friends. “I’ve been thinking recently, cook you can’t get married’,” said Han 53-year-old Lee Jin-soo headed for hierarchy is not needed for making a Hee-won, a chef who has run the Page, a surrogacy lawyer at Harrington Family Lawyers in the “Happy Guys Cooking Class”, happy family. Cooking is,” he said. The cooking class for men in a trendy Brisbane, Australia. When surrogacy is banned in one where he joined six other mostly mid- kitchen was once seen as off-limits for riverside neighborhood of Seoul since country, it invariably means the practice will flourish in dle-aged men in tall white hats and men in South Korea, so much so that 2012. other places, he said. Other countries in Asia such as India aprons. Lee, who runs a business mak- according to a saying: “If a man enters Go Dong-rok, a student chef and a and Nepal are also popular destinations for international ing compression bags for bedding, the kitchen, he risks losing his testi- human resources executive at auto surrogacy, and more people will now seek surrogates gently handled abalone and shrimp cles.” Demographics and popular cul- parts maker Hyundai Mobis, found the there. Details on how to enforce the new law are still and made a rice crust that went into ture are changing that. With more experience of learning to make pizza the Korean stew of chicken and women working in demanding profes- and the traditional Korean dish bibim- unclear, according to Nandana Indananda, a Bangkok- seafood on the evening’s menu. He is sional jobs and households shrinking, bap so enlightening that he brought based lawyer who has been calling for legal reform on the one of a growing number of men tak- meaning fewer women family mem- the idea to his work, organizing an matter. ing up cooking in a country where bers, many men no longer have the event where male employees cooked A current high-profile case could resolve some of the men have long done little housework. choice not to cook. Korean food and invited their wives. questions. It involves a gay couple - an American and a South Korean men came bottom in a Reality television shows featuring “Korean society is paternalistic and Spaniard - who cannot take their daughter Carmen out of 2014 Organization for Economic Co- men cooking and the emergence of just because they work during the operation and Development survey star male chefs are also credited with day, husbands want to be served by Thailand because the surrogate mother decided that she on housework, with just 21 minutes a helping lure men into the kitchen, their wives. But cooking can soften wanted to keep the baby, and refused to sign legal papers day. Lee described himself as an spawning a catch phrase: “Sexy cook- this,” he said. Whether Korean men allowing the girl’s exit from the country. The situation authoritarian father and domineering ing men.” Gmarket, an online retailer apply their newfound zeal for cooking leaves Gordon Lake, the biological father and his husband husband, which he says he now owned by eBay Inc, said sales of to the more menial chores remains to - currently living together in Bangkok with Carmen and a regrets. kitchen utensils to men rose 24 per- be seen. “I hear some men have fun toddler son - in legal limbo. They hope that by going to “I wanted to change. Taking cook- cent in the first half of 2015. The cooking but then they leave the court, they will be able to have full and uncontested rights ing classes here was the turning appeal of men who can cook as kitchen without doing the dishes,” point,” he said, showing off pictures potential husbands is also prodding said Lee Soo-yeon, a researcher at the to Carmen, if the judge interprets the applicable laws in of himself serving a Chinese cold veg- younger males to take to the kitchen. Korean Women’s Development their favor. —AP etable dish for his wife and her “Young men are saying: ‘if you can’t Institute. —Reuters HEALTH SATURDAY, AUGUST 8, 2015 Pfizer, Bristol revive cancer drugs
NEW YORK: Some of the most heralded cantly lower doses of a 4-1BB antibody, giv- effects. One of Kohrt’s follicular lymphoma tive market. With 4-1BB they have an inter- new cancer drugs fight the disease by en at the right time, could achieve the patients received two months of the Pfizer esting opportunity,” Leerink Partners ana- removing brakes on the immune system. desired anti-cancer effect without the toxic- treatment and has been cancer free for lyst Seamus Fernandez said of Pfizer. The Now a few leading drugmakers are paying ity. They now believe immune system accel- more than three years. Her prior prognosis pharma landscape is littered with drugs that attention to a second, opposing force: med- erator therapies could work for many types was about six months to a year to live. looked promising early only to fail when icines that accelerate the immune system’s of cancers, bolstering an arsenal of new John Lin, Pfizer’s head of immunothera- larger trials turned up safety problems or attack. Pfizer Inc, which is lagging rivals in medications that are changing the field of py, said it began human trials with a very disappointing efficacy, and that could hap- the lucrative field of cancer immunothera- oncology. small dose. “The safety profile looks to be pen with 4-1BB therapies. pies, has been the first to report early data Bristol and Merck & Co have debuted excellent,” he said. “That came as a surprise But Phase I cancer trials have become of an “accelerator” treatment that targets a potent drugs that work by blocking a pro- to some people in the field who are familiar better predictors of future results, experts protein called 4-1BB. It has at least five other tein known as PD-1, which tumors use to with 4-1BB, because in the past this target say, as researchers employ their growing Phase I studies underway or in planning evade detection by the immune system. looked a little bit dangerous.” The early suc- understanding of immunology and human stages in solid tumor cancers and lym- Doctors are seeing some patients live for cess led Stanford researchers, including genetics. Health regulators have also accel- phomas, which are blood cancers. years with diseases like advanced Kohrt, to test other existing treatments with erated their review of medicines they deem Bristol-Myers Squibb Co is hot on Pfizer’s melanoma, which had nearly always meant the new accelerator therapies from Pfizer to be important advances, particularly in heels with a handful of early-stage trials of death within months. The expensive treat- and Bristol. For example, they plan to test cancer. In many cases, they have allowed its own 4-1BB antibody. Others, including ments are being tested in combination with Pfizer’s drug with Roche’s Herceptin in drugmakers to move from Phase I directly Johnson & Johnson and AbbVie Inc are many other medicines to help them work breast cancer, and Bristol’s 4-1BB therapy into pivotal trials that can be used to seek doing early testing of their antibodies prior for a wider group of patients, and perhaps urelumab with Eli Lilly and Co’s Erbitux in approval, cutting years off the development to starting human trials, company execu- further improve the duration of responses. colon and head and neck cancers. process. Immunotherapy pioneer Dr. tives and researchers said. “What they have The immuno-oncology market could reach Lieping Chen, who did early work for Bristol- shown are some pretty phenomenal $40 billion by 2025, according to Leerink Bristol comes back Myers, in 2002 published the first paper responses in patients ... where you would Partners. Bristol’s plans for urelumab also show showing a 4-1BB antibody could stimulate a not expect the drug to work very well” how cancer experts are overcoming their powerful anti-cancer attack. because the patients had stopped respond- Tiny gas pedals previous reluctance. The company halted “This is probably going to be the next big ing to any available treatments, said Dr. When T-cells and “natural killer” cells in human testing of the therapy from 2008 to one,” said Chen, who now works at Yale Holbrook Kohrt, a researcher from Stanford the body’s immune system identify cancer, 2011 after seeing an unusually high rate of Cancer Center. “4-1BB was always one of my University Cancer Institute, referring to the 4-1BB protein appears on their surfaces, severe and potentially fatal hepatitis in a favorites,” Chen said, based on his observa- results from a small trial of Pfizer’s treat- which researchers have likened to tiny gas melanoma study. Bristol is enrolling tion of a 4-1BB antibody’s ability to shrink ment in patients whose lymphoma had pro- pedals. They are using existing cancer ther- patients in five Phase I studies and planning tumors in mice. Chen was the first to identi- gressed after they received several other apies, such as Roche’s Rituxan, to help acti- a sixth for urelumab against multiple myelo- fy PD-L1, a target related to PD-1 for which therapies. vate the immune system, then add the new ma, lymphomas and solid tumor cancers in Roche, AstraZeneca, Pfizer and others are 4-1BB, also known as CD137, and its con- experimental treatment, which locks onto combination with other therapies, including developing treatments. He said several nection to the immune system was identi- the 4-1BB protein, stepping on the gas to its PD-1 drug Opdivo. companies looking to develop 4-1BB anti- fied more than 20 years ago by scientists at intensify the cells’ attack. In the study of Pfizer said it will test its 4-1BB drug in bodies, including Pfizer, have reached out the University of California San Diego. The Pfizer’s antibody in 38 patients with conjunction with an immunotherapy from to him in an advisory capacity. “Personally, approach was largely abandoned in 2008 advanced lymphomas, nearly 40 percent of Japan’s Kyowa Hakko Kirin and in combina- I’m happy this field has finally come back,” after early clinical trials of a Bristol therapy those with follicular lymphoma and a third tion with Merck’s PD-1 drug Keytruda, both he said of immuno-oncology. “Now it’s showed dangerous signs of liver damage. of those with mantle cell lymphoma saw a in solid tumor cancers, with other trials almost overheated. Things are being tested Scientists eventually realized that signifi- reduction in cancer with no serious side planned. “This is an unbelievably competi- at amazing speed.” —Reuters SATURDAY, AUGUST 8, 2015 Kuwait KNCC PROGRAMME FROM THURSDAY TO WEDNESDAY (06/08/2015 TO 12/08/2015)
SHARQIA-1 SRIMANTHUDU - Telugu 9:30 PM INSIDE OUT 12:30 PM COP CAR 12:30 AM INSIDE OUT 2:45 PM INSIDE OUT 5:00 PM FANAR-3 ANT-MAN 7:15 PM BAJRANGI BHAIJAAN -Hindi 12:00 PM ANT-MAN 9:45 PM BAJRANGI BHAIJAAN -Hindi 3:00 PM ANT-MAN 12:15 AM BAJRANGI BHAIJAAN -Hindi 6:00 PM BAJRANGI BHAIJAAN -Hindi 9:00 PM SHARQIA-2 BAJRANGI BHAIJAAN -Hindi 12:05 AM MISSION: IMPOSSIBLE - ROGUE NATION 12:15 PM MISSION: IMPOSSIBLE - ROGUE NATION 2:45 PM FANAR-4 MISSION: IMPOSSIBLE - ROGUE NATION 5:15 PM MISSION: IMPOSSIBLE - ROGUE NATION 12:15 PM MISSION: IMPOSSIBLE - ROGUE NATION 7:45 PM MISSION: IMPOSSIBLE - ROGUE NATION 2:45 PM MISSION: IMPOSSIBLE - ROGUE NATION 10:15 PM MISSION: IMPOSSIBLE - ROGUE NATION 5:15 PM MISSION: IMPOSSIBLE - ROGUE NATION 12:45 AM MISSION: IMPOSSIBLE - ROGUE NATION 7:45 PM MISSION: IMPOSSIBLE - ROGUE NATION 10:15 PM SHARQIA-3 MISSION: IMPOSSIBLE - ROGUE NATION 12:45 AM BAJRANGI BHAIJAAN -Hindi 1:00 PM MISSION: IMPOSSIBLE - ROGUE NATION 4:00 PM FANAR-5 BAJRANGI BHAIJAAN -Hindi 6:30 PM INSIDE OUT 12:00 PM MISSION: IMPOSSIBLE - ROGUE NATION 2:15 PM NO FRI+SAT INSIDE OUT 4:45 PM SRIMANTHUDU - Telugu 6:30 PM INSIDE OUT 7:00 PM CHANGE OF NAME SITUATION WANTED SRIMANTHUDU - Telugu 10:00 PM MISSION: IMPOSSIBLE - ROGUE NATION 9:15 PM HAYATI MOUBAHDILAH 1:00 AM MISSION: IMPOSSIBLE - ROGUE NATION 11:45 PM Indian, I, Avula Ohamundeswari finance professional, HAYATI MOUBAHDILAH 9:30 PM MBA, CGMA, CPA, with 10 MISSION: IMPOSSIBLE - ROGUE NATION 11:30 PM MARINA-1 holder of Indian Passport No. K9651511, Sree Ramaulapeta years of experience in INSIDE OUT 11:30 AM Investment Banking, Real MUHALAB-1 INSIDE OUT 1:45 PM Dalavati Palli Pullampet Estate & Trading seeks a suit- BAJRANGI BHAIJAAN -Hindi 1:30 PM INSIDE OUT 4:00 PM Kadapa AP, hereby change BAJRANGI BHAIJAAN -Hindi 4:30 PM INSIDE OUT 6:15 PM my name Vaddi able middle level manage- INSIDE OUT 7:30 PM MISSION: IMPOSSIBLE - ROGUE NATION 8:30 PM Chamundeswari wife of ment position in finance & SRIMANTHUDU - Telugu 10:30 PM MISSION: IMPOSSIBLE - ROGUE NATION 11:15 PM Vaddi Subramanyan Reddy. accounts. Please call 00965 (C 5015) 65094498, email: kurianjo- MUHALAB-1 MARINA-2 [email protected] (C 5013) BAJRANGI BHAIJAAN -Hindi 1:30 PM MISSION: IMPOSSIBLE - ROGUE NATION 11:45 AM I, Vaddi Subramanyam hold- 3-8-2015 SRIMANTHUDU - Telugu 4:30 PM MISSION: IMPOSSIBLE - ROGUE NATION 2:15 PM er of Indian Passport No. BAJRANGI BHAIJAAN -Hindi 4:30 PM MISSION: IMPOSSIBLE - ROGUE NATION 4:45 PM 9651550, Sree Ramulapeta BAJRANGI BHAIJAAN -Hindi 7:30 PM MISSION: IMPOSSIBLE - ROGUE NATION 7:15 PM Dalavayi Palli Pullampet MISSION: IMPOSSIBLE - ROGUE NATION 10:30 PM MISSION: IMPOSSIBLE - ROGUE NATION 9:45 PM ACCOMMODATION POUND OF FLESH 1:00 AM MISSION: IMPOSSIBLE - ROGUE NATION 12:15 AM Kadapa AP, hereby change my name to Vaddi Partition room available for MUHALAB-2 MARINA-3 Subramanyam Reddy father couple or bachelor in INSIDE OUT 11:30 AM ANT-MAN 1:00 PM name Vaddi Nagi Reddy. Salmiya. Call 66711141. MINIONS 1:30 PM MINIONS 3:30 PM (C 5016) (C 5014) 4-8-2015 INSIDE OUT 3:30 PM ANT-MAN 5:30 PM 5-8-2015 INSIDE OUT 5:45 PM HAYATI MOUBAHDILAH 8:00 PM ANT-MAN 8:00 PM ANT-MAN 10:00 PM ANT-MAN 10:30 PM ANT-MAN 12:30 AM ANT-MAN 1:00 AM AVENUES-1 Sabah Hospital 24812000 MUHALAB-3 PIXELS 11:30 AM Amiri Hospital 22450005 MISSION: IMPOSSIBLE - ROGUE NATION 11:45 AM MAX 1:45 PM MISSION: IMPOSSIBLE - ROGUE NATION 2:15 PM PIXELS 4:00 PM Maternity Hospital 24843100 MISSION: IMPOSSIBLE - ROGUE NATION 4:45 PM THU Mubarak Al-Kabir Hospital 25312700 MISSION: IMPOSSIBLE - ROGUE NATION 7:15 PM SRIMANTHUDU - Telugu 4:00 PM MISSION: IMPOSSIBLE - ROGUE NATION 9:45 PM MAX 7:00 PM Chest Hospital 24849400 MISSION: IMPOSSIBLE - ROGUE NATION 12:15 AM SRIMANTHUDU - Telugu 7:00 PM Farwaniya Hospital 24892010 SRIMANTHUDU - Telugu 10:00 PM FANAR-1 PIXELS 1:00 AM Adan Hospital 23940620 ANT-MAN 11:30 AM Ibn Sina Hospital 24840300 ANT-MAN 2:00 PM AVENUES-2 BIN ROYE -Pakistani 4:30 PM THE GIFT 11:45 AM Al-Razi Hospital 24846000 ANT-MAN 7:00 PM COP CAR 2:00 PM Physiotherapy Hospital 24874330/9 HAYATI MOUBAHDILAH 9:30 PM THE GIFT 4:15 PM ANT-MAN 11:30 PM COP CAR 6:30 PM THE GIFT 8:45 PM FANAR-2 HABIB AL ARAD -Kuwaiti Film 11:00 PM Kaizen center 25716707 MINIONS 11:45 AM THE GIFT 1:45 PM AVENUES-3 Rawda 22517733 COP CAR 4:00 PM INSIDE OUT-3D 12:45 PM Adaliya 22517144 MINIONS 6:00 PM INSIDE OUT 3:00 PM THE GIFT 8:00 PM INSIDE OUT-3D 5:15 PM Khaldiya 24848075 SRIMANTHUDU - Telugu 10:15 PM INSIDE OUT 7:30 PM Kaifan 24849807 COP CAR 1:15 AM INSIDE OUT 9:45 PM THE GIFT 12:05 AM Shamiya 24848913 FANAR-2 Shuwaikh 24814507 COP CAR 1:30 PM AVENUES-4 SRIMANTHUDU - Telugu 3:30 PM MISSION: IMPOSSIBLE - ROGUE NATION 1:30 PM Abdullah Salem 22549134 SRIMANTHUDU - Telugu 6:30 PM MISSION: IMPOSSIBLE - ROGUE NATION 4:15 PM Nuzha 22526804 SRIMANTHUDU - Telugu 9:30 PM MISSION: IMPOSSIBLE - ROGUE NATION 7:00 PM Industrial Shuwaikh 24814764 COP CAR 12:30 AM MISSION: IMPOSSIBLE - ROGUE NATION 9:45 PM MISSION: IMPOSSIBLE - ROGUE NATION 12:30 AM Qadsiya 22515088 FANAR-2 Dasmah 22532265 MINIONS 11:45 AM 360º 1 THE GIFT 1:45 PM ANT-MAN 1:15 PM Bneid Al-Gar 22531908 COP CAR 4:00 PM ANT-MAN 3:45 PM Shaab 22518752 SRIMANTHUDU - Telugu 6:30 PM ANT-MAN 6:15 PM THE GIFT 9:30 PM ANT-MAN 8:45 PM Qibla 22459381 information SATURDAY, AUGUST 8, 2015 DIAL 161 FOR AIRPORT INFORMATION
In case you are not travelling, your proper cancellation of bookings will help other passengers use seats
Arrival Flights on Saturday 8/8/2015 SVA 510 Riyadh 17:15 ETD 302 Abu Dhabi 10:00 Airlines Flt Route Time UAL 982 IAD 17:25 KAC 101 London/New York 10:00 QTR 1084 Doha 00:05 JZR 357 Mashhad 17:30 RJA 649 Amman 10:15 PIA 205 Lahore 00:15 GFA 215 Bahrain 17:30 KAC 511 Mashhad 10:20 THY 772 Istanbul 00:15 JZR 177 Dubai 17:45 IRM 1181 Mashhad 10:25 JZR 239 Amman 00:20 KAC 742 Dammam 17:45 QTR 1071 Doha 10:40 SYR 343 Damascus 00:25 JZR 777 Jeddah 17:50 FDB 056 Dubai 10:40 JZR 267 Beirut 00:30 SVA 500 Jeddah 18:00 SYR 342 Damascus 10:55 DLH 637 Dammam 00:35 IRM 1180 Mashhad 18:10 KAC 501 Beirut 11:00 FDB 069 Dubai 00:55 KAC 176 Geneva/Frankfurt 18:20 KAC 165 Rome/Paris 11:25 JZR 539 Cairo 01:30 KAC 502 Beirut 18:35 KAC 561 Amman 11:25 JAI 574 Mumbai 01:30 KAC 786 Jeddah 18:35 IRA 3406 Mashhad 11:35 SAI 441 Lahore 01:35 CLX 856 Luxembourg 18:50 GFA 214 Bahrain 11:35 PGT 858 Istanbul 01:40 KAC 618 Doha 18:55 JZR 356 Mashhad 11:40 RJA 642 Amman 01:45 KAC 542 Cairo 18:55 KAC 541 Cairo 12:05 ETH 620 Addis Ababa 01:50 QTR 1080 Doha 18:55 UAE 874 Dubai 12:10 OMA 643 Muscat 02:05 KAC 104 London 19:00 RBG 554 Alexandria 12:10 GFA 211 Bahrain 02:15 GFA 217 Bahrain 19:05 JZR 776 Jeddah 12:15 KKK 6507 Istanbul 02:15 UAE 875 Dubai 19:05 MSC 402 Alexandria 12:20 UAE 853 Dubai 02:25 FDB 063 Dubai 19:10 AGY 685 Sohag 12:40 THY 768 Istanbul 02:50 KAC 614 Bahrain 19:10 IAW 158 Al Najaf 13:00 QTR 1076 Doha 02:55 ABY 123 Sharjah 19:20 KAC 785 Jeddah 13:00 ETD 305 Abu Dhabi 03:05 JAI 572 Mumbai 19:35 IRM 1189 Mashhad 13:10 RJA 644 Amman 03:10 KAC 774 Riyadh 19:40 FDB 076 Dubai 13:10 FDB 067 Dubai 03:15 FDB 061 Dubai 19:50 JZR 176 Dubai 13:10 MSR 612 Cairo 03:15 AGY 684 Sohag 19:50 OMA 642 Muscat 13:15 KAC 1544 Cairo 03:35 OMA 647 Muscat 20:00 JZR 124 Bahrain 13:30 PGT 860 Istanbul 03:45 KAC 674 Dubai 20:00 NIA 152 Cairo 13:35 THY 1464 Istanbul 03:55 KNE 480 Taif 20:10 IRC 6512 ABD 13:50 MSC 401 Alexandria 04:00 MEA 402 Beirut 20:15 MSR 611 Cairo 14:00 JZR 555 Alexandria 04:15 ABY 121 Sharjah 20:20 THY 767 Istanbul 14:10 THY 770 Istanbul 04:40 DLH 634 Frankfurt 20:20 UAE 872 Dubai 14:15 THY 5582 Bursa 05:05 JZR 189 Dubai 20:25 MSR 576 Sharm el-Sheikh 14:40 DHX 170 Bahrain 05:10 MSR 618 Alexandria 20:40 KAC 741 Dammam 14:40 KAC 416 Jakarta/Kuala Lumpur 06:00 KAC 174 Munich 20:55 IRC 527 Mashhad 15:00 KAC 412 Manila/Bangkok 06:15 ALK 229 Colombo 21:10 QTR 1079 Doha 15:05 BAW 157 London 06:35 ETD 307 Abu Dhabi 21:15 FDB 058 Dubai 15:05 JZR 1541 Cairo 06:40 UAE 859 Dubai 21:15 GFA 222 Bahrain 15:05 JZR 563 Sohag 06:45 KLM 415 Amsterdam 21:25 KNE 481 Taif 15:10 JZR 503 Luxor 07:20 FDB 073 Dubai 21:30 KAC 617 Doha 15:15 KAC 382 Delhi 07:30 QTR 1074 Doha 21:30 KAC 673 Dubai 15:20 KAC 206 Islamabad 07:45 GFA 219 Bahrain 21:45 IZG 4168 Mashhad 15:30 KAC 204 Lahore 07:50 KNE 470 Jeddah 22:05 JZR 188 Dubai 15:50 FDB 053 Dubai 07:50 ETD 309 Abu Dhabi 22:10 KAC 773 Riyadh 15:55 KAC 302 Mumbai 07:55 THY 764 Istanbul 22:10 KNE 463 Madinah 16:00 QTR 1086 Doha 07:55 AIC 987 Chennai/Hyderabad 22:25 KAC 613 Bahrain 16:00 KAC 154 Istanbul 08:10 UAL 981 Bahrain 22:40 OMA 646 Muscat 16:05 KAC 344 Chennai 08:15 MSC 407 Sohag 22:45 IZG 4162 Mashhad 16:10 KAC 352 Kochi 08:15 FDB 059 Dubai 22:50 RJD 136 Abu Dhabi 16:10 UAE 855 Dubai 08:25 JZR 157 Dubai 22:55 ABY 128 Sharjah 16:15 KAC 362 Colombo 08:30 JZR 185 Dubai 23:00 ETD 304 Abu Dhabi 16:45 KAC 284 Dhaka 09:00 JAI 526 Chennai/Abu Dhabi 23:00 NIA 252 Alexandria 16:50 ABY 125 Sharjah 09:05 MSR 614 Cairo 23:30 RJA 641 Amman 16:55 ETD 301 Abu Dhabi 09:10 JZR 513 Sharm el-Sheikh 23:30 KNE 473 Jeddah 16:55 IRM 1186 Tehran 09:15 LZB 7787 Varna 23:45 JZR 266 Beirut 17:05 QTR 1070 Doha 09:25 FDB 071 Dubai 23:55 FDB 052 Dubai 17:10 RJA 648 Amman 09:30 JZR 512 Sharm el-Sheikh 17:15 KAC 350 Kochi 09:40 Departure Flights on Saturday 8/8/2015 QTR 1073 Doha 17:25 FDB 055 Dubai 09:40 Airlines Flt Route Time UAE 858 Dubai 17:40 SYR 341 Damascus 10:00 AIC 976 Goa/Chennai 00:05 KNE 475 Jeddah 17:50 IRA 3407 Mashhad 10:35 RBG 556 Alexandria 00:05 IRA 666 Esfahan 18:10 GFA 213 Bahrain 10:40 BBC 044 Dhaka 00:10 SVA 511 Riyadh 18:15 UAE 873 Dubai 10:40 JZR 562 Sohag 00:20 GFA 216 Bahrain 18:20 MSC 405 Sohag 11:20 JAI 573 Mumbai 00:25 JZR 184 Dubai 18:20 RBG 553 Alexandria 11:30 MSR 615 Cairo 00:30 KAC 563 Amman 18:30 AGY 680 Alexandria 11:40 FDB 072 Dubai 00:30 KAC 287 Dhaka 18:35 IRM 1188 Mashhad 11:45 KLM 413 Amsterdam 00:55 JZR 156 Dubai 18:35 JZR 165 Dubai 11:50 JZR 502 Luxor 01:10 UAL 982 Bahrain 18:40 OMA 641 Muscat 11:50 SYR 344 KAC/Damascus 01:25 JZR 538 Cairo 18:40 IAW 157 Al Najaf 12:00 PIA 206 Lahore 01:30 JZR 238 Amman 18:45 FDB 075 Dubai 12:25 DLH 637 Frankfurt 01:35 IRM 1187 Tehran 19:10 NIA 151 Cairo 12:35 THY 773 Istanbul 02:05 SVA 505 Jeddah 19:30 JZR 241 Amman 12:40 SAI 442 Lahore 02:35 GFA 218 Bahrain 19:50 UAE 871 Dubai 12:45 ETH 621 Addis Ababa 02:50 FDB 064 Dubai 19:50 IRC 6511 ABD 12:50 JAI 525 Abu Dhabi/Chennai 02:55 QTR 1081 Doha 19:55 MSR 610 Cairo 13:00 PGT 859 Istanbul 02:55 ABY 124 Sharjah 20:00 THY 766 Istanbul 13:10 KKK 6508 Istanbul 03:10 KAC 361 Colombo 20:00 JZR 779 Jeddah 13:50 OMA 644 Muscat 03:35 CLX 856 Hong Kong 20:20 KAC 672 Dubai 13:55 THY 769 Istanbul 03:40 UAE 876 Dubai 20:35 MSR 575 Sharm el-Sheikh 13:55 UAE 854 Dubai 03:45 JAI 571 Mumbai 20:35 IRC 526 Mashhad 14:00 RJA 645 Amman 03:55 FDB 062 Dubai 20:35 QTR 1078 Doha 14:05 FDB 068 Dubai 04:00 KAC 351 Kochi 20:45 KNE 460 Riyadh 14:10 ETD 306 Abu Dhabi 04:05 AGY 681 Alexandria 20:50 GFA 221 Bahrain 14:20 MSR 613 Cairo 04:15 KAC 1543 Cairo 20:55 FDB 057 Dubai 14:20 PGT 861 Istanbul 04:45 KAC 333 Trivandrum 20:55 IZG 4167 Mashhad 14:30 THY 765 Istanbul 04:55 OMA 648 Muscat 21:00 KAC 540 Sharm el-Sheikh 14:50 MSC 406 Sohag 05:00 ABY 122 Sharjah 21:00 IZG 4161 Mashhad 14:50 QTR 1077 Doha 05:05 KNE 461 Riyadh 21:10 JZR 257 Beirut 14:55 QTR 1085 Doha 05:20 MEA 403 Beirut 21:15 ABY 127 Sharjah 14:55 THY 1465 Istanbul 05:55 JZR 554 Alexandria 21:15 KAC 788 Jeddah 15:00 RJA 643 Amman 06:35 MSR 607 Luxor 21:40 RJD 135 Abu Dhabi 15:00 GFA 212 Bahrain 06:50 DHX 171 Bahrain 21:50 OMA 645 Muscat 15:05 THY 771 Istanbul 06:50 ETD 308 Abu Dhabi 22:05 KNE 462 Madinah 15:05 FDB 070 Dubai 07:05 FDB 074 Dubai 22:10 KAC 1802 Cairo 15:35 JZR 240 Amman 07:05 ALK 230 Colombo 22:20 UAE 857 Dubai 15:45 JZR 164 Dubai 07:15 KAC 381 Delhi 22:20 NIA 251 Alexandria 15:50 JZR 256 Beirut 07:30 UAE 860 Dubai 22:25 RJA 640 Amman 15:55 KAC 173 Munich 07:45 KLM 415 Dammam/Amsterdam 22:25 ETD 303 Abu Dhabi 16:00 BAW 156 London 08:30 KAC 349 Kochi 22:30 KNE 472 Jeddah 16:00 FDB 054 Dubai 08:30 KAC 301 Mumbai 22:30 JZR 535 Cairo 16:05 JZR 778 Jeddah 08:30 QTR 1075 Doha 22:40 KAC 512 Mashhad 16:10 KAC 539 Sharm el-Sheikh 08:50 GFA 220 Bahrain 22:45 FDB 051 Dubai 16:10 QTR 1087 Doha 08:55 KAC 205 Islamabad 22:50 QTR 1072 Doha 16:20 KAC 1801 Cairo 09:00 THY 5579 TZX 23:00 JZR 125 Bahrain 16:25 JZR 534 Cairo 09:15 ETD 310 Abu Dhabi 23:00 KAC 118 New York 16:30 KAC 671 Dubai 09:25 KAC 153 Istanbul 23:00 KNE 474 Jeddah 16:55 KAC 787 Jeddah 09:30 KNE 471 Jeddah 23:05 KAC 562 Amman 17:00 ABY 126 Sharjah 09:45 KAC 411 Bangkok/Manila 23:25 IRA 669 Mashhad 17:10 UAE 856 Dubai 09:50 MSC 408 Sohag 23:45 Directorate General of Civil Aviation Home Page (www.kuwait-airport.com.kw) SATURDAY, AUGUST 8, 2015
Word Search Puzzles 72. An indehiscent fruit derived from a single ovary having one or CROSSWORD 985 many seeds within a fleshy wall or pericarp. 73. The fatty flesh of eel. 74. The musical interval between adjacent keys on a keyboard instru- ment. 76. A rotating disk shaped to convert circular into linear motion. 77. Earnest and conscientious activity intended to do or accomplish something. 78. White Southerner supporting Reconstruction policies after the Civil War usually for self-interest. 79. A loose sleeveless outer garment made from aba cloth.
DOWN 1. Acid gritty-textured fruit. 2. The twelfth month of the civil year. 3. A woman's large folded hooped hood. 4. A heavy silvery toxic univalent and bivalent metallic element. 5. A white linen liturgical vestment with sleeves. 6. A shelter with perches for fowl or other birds. 7. English writer (born in Scotland) of children's stories (1859-1932). 8. A genus of Mustelidae. 9. (Greek mythology) A maiden seduced by Zeus. 10. A state exercising a degree of dominion over a dependent state especially in its foreign affairs. 11. A very poisonous metallic element that has three allotropic forms. 12. Essential oil or perfume obtained from flowers. 13. Fallow deer. ACROSS 14. Two items of the same kind. 1. (of champagne) Moderately dry. 19. A member of an extinct North American Indian people who lived in 4. A city in northwestern Somalia. the Pit river valley in northern California. 12. A condition (mostly in boys) characterized by behavioral and learn- 21. Relating to modern Greece or its inhabitants or its language. ing disorders. 23. A Bantu language spoken by the Kamba people in Kenya. 15. Leaf or strip from a leaf of the talipot palm used in India for writing 25. Any warm-blooded vertebrate having the skin more or less covered paper. with hair. Yesterday’s Solution 16. Having or deserving or conferring glory. 28. The sense organ for hearing and equilibrium. 17. The 19th letter of the Greek alphabet. 30. Used especially in treating bruises. 18. Neat and tidy. 32. The sound made by a horse. 20. Old World wild swine having a narrow body and prominent tusks 34. A device (trade name Aqua-Lung) that lets divers breathe under from which most domestic swine come. water. 22. Offering little or no hope. 35. West Indian tree having racemes of fragrant white flowers and 24. A painful emotion resulting from an awareness of inadequacy or yielding a durable timber and resinous juice. guilt. 36. A port city in southwestern Iran. 26. Toward the mouth or oral region. 39. The content of cognition. 27. A stiff chitinous seta or bristle especially of an annelid worm. 42. Corrupt morally or by intemperance or sensuality. 29. The biblical name for ancient Syria. 43. A steep rugged rock or cliff. 31. Type genus of the Anhimidae. 45. Antacid (trade name Prilosec) that suppresses acid secretion in the 33. Small bitter fruit of the marasca cherry tree from whose juice stomach. maraschino liqueur is made. 46. Slightly open. 37. Towards the side away from the wind. 51. Sluggish tailless Australian arboreal marsupial with gray furry ears 38. Soft creamy white cheese. and coat. 40. (British) A minicar used as a taxicab. 52. A persistently annoying person. 41. Of or relating to the stomach and intestines. 53. Failing in what duty requires. 44. Look at with amorous intentions. 55. A written agreement (or property or money) delivered to a third 47. Having undesirable or negative qualities. party or put in trust by one party to a contract to be returned after ful- 48. A gonadotropic hormone that is secreted by the anterior pituitary. fillment of some condition. 49. A Hindu prince or king in India. 56. The atomic weight of an element that has the same combining 50. Jordan's port. capacity as a given weight of another element. 54. American novelist (1909-1955). 59. Swiss mathematician (1707-1783). 57. An associate degree in nursing. 61. A member of a Turkic people of Uzbekistan and neighboring areas. 58. Any of several herbs of the genus Dipsacus native to the Old World 62. The capital and largest city of Bangladesh. having flower heads surrounded by spiny bracts. 64. Acute ulceration of the mucous membranes of the mouth or geni- 60. A smallest army unit. tals. 63. (Greek) A benevolent spirit. 65. The 2nd letter of the Greek alphabet. 66. A region of central Europe rich in deposits of coal and iron ore. 67. Someone who works (or provides workers) during a strike. 69. 3 to 30 kilohertz. 68. God of love and erotic desire. 70. A compound that exists in forms having different arrangements of 71. A unit of length equal to one thousandth of an inch. atoms but the same molecular weight. 75. A silvery soft waxy metallic element of the alkali metal group.
Daily SuDoku Yesterday’s Solution Yesterday’s Solution SPORTS SATURDAY, AUGUST 8, 2015 Cardinals win, Angels edge Indians
CINCINNATI: Matt Carpenter tied it with a solo DODGERS 4, PHILLIES 3 fifth career grand slam and 24th home run of the Eaton singled and stole second base and homer in the eighth, and Randal Grichuk connect- Yasiel Puig hit a three-run home run, Brett season. Encarnacion made it 9-3 with a three-run advanced to third when catcher Curt Casali’s ed in the 13th in the St. Louis Cardinals’ 4-3 victory Anderson allowed one run in six innings and Los drive off reliever J.R. Graham in the fourth, his throw struck shortstop Asdrubal Cabrera in the over the Cincinnati Reds in Major League Baseball Angeles beat Philadelphia. Howie Kendrick had 20th. The second-deck drive traveled an estimat- ear, knocking him to the ground. Cabrera left the on Wednesday. Grichuk was moved up to second three hits to help the Dodgers win for the fifth ed 462 feet. LaTroy Hawkins finished for his third game later in the inning. Boxberger then inten- in the Cardinals’ struggling batting order. He dou- time in six games. Jeff Francoeur homered for save. tionally walked Jose Abreu and Melky Cabrera to bled home a run in the sixth inning and hit his Philadelphia. The Phillies lost for only the fourth load the bases with one out before walking 15th homer in the 13th off Dylan Axelrod (0-1), time in their last 17 games. They still have the RED SOX 2, YANKEES 1 Garcia.Chicago closer David Robertson (5-3) had Cincinnati’s eighth pitcher. Seth Maness (4-1) worst record in baseball at 42-66. Steven Wright handcuffed a torrid New York four strikeouts in two hitless innings. Evan gave up a pair of walks in two innings. Anderson (6-6) won for the first time since July ineup with his steady supply of knuckleballs, and Longoria homered for the Rays. Manager Mike Matheny changed the batting 1. He allowed four hits, struck out five and walked David Ortiz hit a colossal home run for Boston. order - Grichuk went from batting eighth on two. Kenley Jansen struck out the side in a 1-2-3 A costly throwing error by third baseman ORIOLES 7, ATHLETICS 3 Tuesday to second - to try to spark his struggling ninth for his 20th save in his 21st opportunity. Chase Headley helped spoil the debut of prized Chris Davis hit his second grand slam in 12 offense, but the Cardinals didn’t get much going Philadelphia starter Aaron Harang (5-12) was the Yankees pitching prospect Luis Severino, who days with one out in the 10th inning to lead until late in the game. Left-hander David loser. yielded only two hits over five impressive Baltimore past Oakland. Davis hit his 28th home Holmberg allowed two runs, including Grichuk’s innings. run and third in four games on a 3-2 pitch from RBI double off the top of the wall in center that GIANTS 6, BRAVES 1 Koji Uehara retired pinch-hitter Brian McCann Arnold Leon (0-1). It came two batters after cut it to 3-2 in the sixth. Madison Bumgarner pitched into the eighth with two on for his 24th save. Alejandro De Aza Gerardo Parra was intentionally walked to load Carpenter tied it with a homer in the eighth inning, Kelby Tomlinson drove in three runs and hit an RBI double with two outs in the second - the bases. Caleb Joseph and Manny Machado led off J.J. Hoover, only the third that the reliever has San Francisco beat Atlanta. immediately following Headley’s 18th error of off the inning with singles. Closer Zach Britton (2- allowed this season. It was Carpenter’s fifth Matt Duffy added a two-run double and the season. Ortiz connected on a 96 mph 2-0 fast- 0) pitched a season-high 2 1-3 scoreless innings homer in his last six games. Hunter Pence had an RBI single for San Francisco. ball leading off the fourth, launching a drive that for the victory. The Giants have won 16 of 21. landed more than halfway up the elevated con- ANGELS 4, INDIANS 3 Bumgarner (12-6), last year’s World Series crete bleachers in right field. That was enough for PIRATES 7, CUBS 5 CJ Cron hit a tying two-run single with two Most Valuable Player and a three-time All-Star, Wright (5-4). Gregory Polanco and Andrew McCutchen out and the bases loaded in the ninth inning homered and Pittsburgh beat Chicago to end the against Cleveland closer Cody Allen and pinch- Cubs’ season-best winning streak at six games. runner Taylor Featherston scored on a wild pitch, Polanco led off the first inning with a home giving the Los Angeles Angels a 4-3 victory run off Dan Haren, who was making his Cubs’ Wednesday. debut. He then hit an RBI single to break a 4-4 tie Allen (1-4), coming in to protect a 3-1 lead for in a decisive two-run sixth. McCutchen hit a solo Danny Salazar, was charged with his third blown homer in the third and added a sacrifice fly in the save in 25 chances after giving up a one-out sin- sixth to make it 6-4. Francisco Cervelli and Aramis gle to Albert Pujols and two-out walks to Erick Ramirez each had two hits to help the Pirates win Aybar and Conor Gillaspie. Cron lined an 0-1 for the 12th time in their last 15 home games at pitch to center to tie it, and Allen uncorked his PNC Park. fourth wild pitch of the season and second of the inning with pinch-hitter David DeJesus at the ROCKIES 7, MARINERS 5 plate. Michael McKenry hit a two-out, two-run homer The Angels came in 0-44 when trailing after in the 11th inning in Colorado’s comeback victory eight. Cam Bedrosian (1-0), the son of 1987 Cy over Seattle. McKenry hit Mayckol Gauipe’s 2-2 Young Award-winning closer Steve Bedrosian, curveball into the left-field seats for his fourth pitched a perfect ninth for his first career victory. home run of the season and the first walk-off hit in Jose Ramirez and Ryan Raburn hit leadoff homers his career. in the sixth and seventh innings Angels Seattle’s Nelson Cruz doubled and singled to starterHector Santiago. extend his hitting streak to 16 games, but failed to homer for the first time in six games. Franklin METS 8, MARLINS 6 Gutierrez homered for the Mariners. Closer Jeurys Familia finally got the last out The Rockies’ winning rally started with Ben and New York halted Miami’s furious six-run rally Paulsen’s one-out single off Guaipe (0-3). Yohane in the ninth inning, holding off the Marlins for its Flande (2-1) pitched the 11th for the victory. sixth straight victory. Ahead 8-0 going into the ninth, the NL East-leading Mets saw the Marlins CINCINNATI: Reds’ Jason Bourgeois (left) jumps back to first base as St. Louis BREWERS 8, PADRES 5 actually bring the potential winning run to the Cardinals’ Brandon Moss makes the catch from the pitcher in the eighth inning of Rookie Taylor Jungmann struck out a career- plate. Familia retired Christian Yelich on a a baseball game. —AP high eight and allowed six hits without a walk over grounder with two runners on to end it. Juan seven innings in Milwaukee’s victory over San Uribe hit a three-run homer and Lucas Duda allowed seven hits, one run and struck out nine in RANGERS 4, ASTROS 3 Diego. drove in three runs, giving Matt Harvey (10-7) a 7 1-3 innings. Just two baserunners made it into Chris Gimenez hit the deciding home run and Jungmann (6-3) has allowed two earned runs huge lead. Harvey pitched seven dominant scoring position against the left-hander. Williams Texas held on to complete a three-game sweep of or fewer in eight straight starts and in all but one innings, giving up two hits and striking out six Perez (4-2) surrendered 10 hits, two walks and six AL West-leading Houston. this season. Jonathan Lucroy, Shane Peterson and without a walk. Mets relievers Eric O’Flaherty, runs in six plus innings for the Braves, who have After Texas scored three unearned runs in the Jean Segura each drove in two runs to help acquired Tuesday from Oakland, Hansel Robles lost 11 of 14. first off Scott Kazmir (6-6), the Rangers’ second Milwaukee record back-to-back wins for the first and Familia all struggled in the ninth. Familia started with Gimenez homering to straightaway time in 15 games. gave up two hits, but got Yelich for his 29th save BLUE JAYS 9, TWINS 7 center for a 4-0 lead. All three Houston runs were After San Diego scored three runs in the ninth in 34 chances. David Phelps (4-8) was the loser. Jose Bautista hit a grand slam, Edwin scored by players who reached on a walk. off Corey Knebel, Francisco Rodriguez recorded Encarnacion and Josh Donaldson homered and The Rangers have won four in a row and seven the final out for his 25th save in as many chances. DIAMONDBACKS 11, NATIONALS 4 Toronto beat Minnesota for its fourth straight of eight, moving within five games of the division Padres starter Ian Kennedy (6-10) gave up four Washington reliever Aaron Barrett threw away win. lead, the closest they have been since June 30. earned runs on seven hits in seven innings. a bunt in the sixth inning and Arizona quickly Encarnacion hit a three-run drive and Texas starter Nick Martinez (7-6), the right-han- broke away, handing the Nationals their fifth loss Donaldson added a two-run shot. Toronto has der pitching on his 25th birthday, walked three TIGERS 2, ROYALS 1 in six games. homered in 17 of 18 games since the All-Star and struck out one while throwing 86 pitches in a Matt Boyd pitched seven strong innings in his Down 11-2 in the ninth, the pitching-rich Game break, with 10 multihomer games in that game that started with the temperature at 100 Detroit debut and Anthony Gose and Ian Kinsler Nationals resorted to putting utilityman Tyler span. degrees. hit key triples in the Tigers’ victory over Kansas Moore on the mound. He retired the first batter Miguel Sano homered and had three RBIs for Sam Dyson, the sixth Rangers pitcher, worked City. Acquired last week from Toronto in the David he faced, Arizona star Paul Goldschmidt, on an RBI the Twins. Sano hit an RBI single and Trevor the ninth for his second career save - both since Price trade, Boyd (1-2) only allowed one run on groundout. Plouffe doubled home two runs as the Twins being acquired in a trade with Miami on Friday. seven hits and didn’t walk a batter in a career-long Goldschmidt, Ender Inciarte and A.J. Pollock jumped out to a 3-0 lead in the first against Drew seven innings. each got three of Arizona’s 17 hits. Welington Hutchison (10-2). Toronto answered in the bot- WHITE SOX 6, RAYS 5 The Tigers broke a scoreless tie in the third Castillo added his sixth homer in nine games. tom half against right-hander Tyler Duffey (0-1), Avisail Garcia hit a three-run homer in when Gose’s two-out triple over Lorenzo Cain The Nationals dropped two games behind the who was making his major league debut. Troy Chicago’s five-run first inning and had a bases- brought home Tyler Collins. Johnny Cueto (7-7) New York Mets in the NL East division. Arizona has Tulowitzki walked and Donaldson hit his 29th loaded walk in the 10th to lift the White Sox past couldn’t pick up his first win for Kansas City won nine of 13. Rubby De La Rosa (9-5) went five homer, tying a career high. Tampa Bay. Garcia drew the winning walk off despite only allowing two runs on five hits in sev- innings for the win. Barrett (3-3) was the loser. Bautista made it 6-3 in the second with his closer Brad Boxberger (5-6). In the 10th, Adam en innings. —AP SPORTS SATURDAY, AUGUST 8, 2015 Boks face massive Test against Pumas — Meyer JOHANNESBURG: A Rugby Championship campaign that has gone pear-shaped for South Africa means great significance is being attached to the final-round clash with Argentina in Durban today. “This will be a massive Test for us,” admitted Springboks coach Heyneke Meyer as he looked ahead to a showdown that will decide who finishes bottom of the standings. Australia and title-holders New Zealand have nine points each ahead of a Sydney title decider early today, South Africa a paltry two from losing bonus points and Argentina none. The 2015 Springboks have become the team that cannot put a game to bed, conceding late tries in Brisbane and Johannesburg to fail against the Wallabies and All Blacks. “We will never accept that we lost our last two Tests,” stresses 47-year-old Meyer, who has won 26 Tests, lost 11 and drawn two since taking charge of the green and gold three seasons ago. “On both occasions we were in positions to win and let them slip.” Peter de Villiers, who was succeeded as South Africa coach by Meyer, blames overweight Springboks for the fade-outs. “We need to address the fighting-fit weight of the players so that they can last for 80 minutes,” he says. “The players are carry- ing excess unnatural weight which is why we cannot maintain intensity for full matches. “I believe we bulk up our Springboks instead of making them match-fit.” Although the Springboks have been much more impressive than fellow strugglers the Pumas in the first two Championship rounds, Meyer is wary of the Argentines. This could partly be due to the closeness of the games last year with the Springboks win- ning only 13-6 at home in monsoon-like conditions and scraping a fortunate 33-31 away victory. “It is going to be tough because the Pumas are coming for us, as they have done during the past three seasons,” conceded Meyer. “This is going to be a great challenge for the Springboks and I cannot wait for the kick-off.” After losing both Tests this season and four of the last six, Meyer shelved reported plans to start with little-used utility back Patrick Lambie and fly-half Morne Steyn, and almost-fit scrum-half Fourie du Preez. Of the three starting line-up changes to the side beaten 27- Michael Hooper 20 by New Zealand, two were forced with tighthead prop Jannie du Plessis and flanker Francois Louw injured. South African find-of-the-season Jesse Kriel moves from out- All Blacks dismiss Wallabies side centre to the right wing to accommodate skipper Jean de Villiers, back in the starting line-up nine months after reconstruc- tive knee surgery. The reshuffle means winger Cornal Hendricks tandem tearaway preparation drops out of the matchday 23, and in the pack Vincent Koch comes in for Du Plessis and Marcell Coetzee replaces Louw. SYDNEY: The All Blacks upped the psychological pressure change a lot how we operate,” said McCaw who will have Argentina coach Daniel Hourcade has reacted to a generally on the Wallabies yesterday ahead of their Rugby Jerome Kaino and Kieran Read for support. poor performance when losing 34-9 at home against Australia Championship decider, warning the tandem attack of “I think you realise the breakdown is an area that’s hotly by making 11 changes, one injury-enforced. Michael Hooper and David Pocock could backfire. The bal- contested, whether there’s one or two (of them). “Everyone Veteran play-anywhere back Juan Martin Hernandez makes ance of the Australian side raised a few eyebrows in the has an impact there these days, but those two are certainly his season debut in place of fly-half Nicolas Sanchez, the leading New Zealand camp but not the experiment of putting tear- pretty accurate at that.” 2014 Championship points scorer but an underperformer this aways Hooper and Pocock on the park at the same time to New Zealand coach Steve Hansen said the positive for season. Only two Pumas, skipper and hooker Agustin Creevy and loosehead prop Marcos Ayerza, have been chosen to start gang up on All Blacks skipper Richie McCaw. the All Blacks in the Hooper-Pocock double act was that it all three Championship Tests. It simply opened up other areas to exploit, All Blacks exposed weakness in other areas. Hourcade is a fan of the Springboks: “They are a great team coach Steve Hansen said.At stake in the clash at Sydney’s Of particular interest to the All Blacks was the inclusion who could have won the matches they lost against Australia and ANZ Stadium on Saturday is not just the Rugby of the mobile Dean Mumm at lock in the Wallabies line-up New Zealand. “They play a fast-tempo game and put a lot of Championship crown, which the All Blacks have won for ahead of the more physical Will Skelton, and the benching emphasis on physical contact, so our tackling needs to improve the past three years, but also the chance to strike a mental of centre Matt Toomua. from the last two games.” blow ahead of the World Cup which starts in England next “We’ve just got to make sure we take advantage of The odds lean heavily toward a Springboks victory as they month. those weaknesses and make sure that we don’t allow them have won all eight previous Tests against the Pumas in the New Zealand and Australia go into the final-round to have a field day at the breakdown,” Hansen said. republic. —AFP match as the only unbeaten teams following wins over Away from the pressure cooker breakdown, the focus South Africa and Argentina. will be on how Matt Giteau, who comes in for Toomua, and The Hooper-Pocock double act has been the main talk- fly-half Bernard Foley are able to protect the inside channel. ing point in the build-up, with Wallabies coach Michael All Blacks pivot Dan Carter is under orders to test the Cheika saying both players are in such commanding form defences with Sonny Bill Williams outside him and heading he had no choice but to pair them up for the first time. back to his best with his telling off-loads. Pocock will be at number eight with Hooper wearing If the Wallabies defensive line holds it brings the ball- the number seven jersey and the focus will be on the stealing skills of Hooper and Pocock into play, giving them breakdown where the All Blacks were exposed two weeks the chance to counter with the elusive skills of Israel Folau ago by South Africa who also fielded two specialist open- and Adam Ashley-Cooper. side flankers. Equally, any slip up by the Wallabies, who will not have The 34-year-old McCaw has ruled the collision area for the muscle of the uncompromising Skelton, will give the much of past decade and declared himself unfazed by the All Blacks room to unleash their back three of debutant Wallabies’ challenge. Nehe Milner-Skudder, Julian Savea and Ben Smith. Milner- “Having both out on the field makes sense from their Skudder, with his elusive running skills, was one of the point of view with the way they are playing, so from my most talked about players in Super Rugby this year while point of view I kind of expected it, so it doesn’t really Savea has scored 30 tries in 33 Tests. —AFP Jannie du Plessis SPORTS SATURDAY, AUGUST 8, 2015 Rossi ready for final push at Indy GP
INDIANAPOLIS: Italian superstar Valentino Rossi will begin his final push towards a historic eighth MotoGP world title here tomorrow at the Indianapolis Grand Prix, where the championship resumes after a mid-season break. Nine more races stand between the 36-year-old Yamaha rider and a record eighth world crown, and a refreshed Rossi is brimming with confidence after recharging his batteries with a summer vacation. “I’m ready to start racing again,” Rossi said. “I had a few days of rest, I went on holiday with my friends and I also trained. “There are another nine races waiting for us and each of these will be very important for the championship.” Rossi is locked in a fierce battle at the top of the championship standings with Jorge Lorenzo, lead- ing his Yamaha teammate with 179 points to 166 after nine rounds that have yielded nine podium finishes. However, Indianapolis’s chal- lenging Brickyard circuit has rarely been a happy hunting ground for Rossi, who has posted just one win at the track in his glittering career, way back in 2008. Valentino Rossi in action in this file photo. Last year, Rossi finished third as Spanish Honda rider Marc Marquez took the honors for the fourth con- secutive year. Lorenzo is also brac- ing for another challenging test on Memorial victory elevates the Brickyard. “Usually Indy is not one of my favourite tracks but I’ve won there Lingmerth’s Ryder Cup hopes in the past,” Lorenzo said. “Last year, the tarmac improved a lot but its layout is different to that of oth- AKRON: A breakthrough victory at this year’s “I putted really well there,” said the Swede, Swede, who sits 22nd in the FedExCup stand- er circuits. Memorial Tournament cemented David whose uncle Goran Lingmerth, was a kicker for ings. “We are feeling very positive Lingmerth’s belief that he was “good enough” to the Cleveland Browns in the National Football “Obviously the majors are huge and I want to and hopefully we can fight in the compete at an elite level and the Swede now has League. “I have putted that well before but play in them and contend in them but getting best way possible with Valentino his sights set on next year’s Ryder Cup. maybe not under those circumstances being in into the Tour Championship is also a big deal ... and Marc.” Reigning world cham- Lingmerth has climbed to a career-high 59 in the final group on Saturday and the second-to- getting to play there would get me into a lot of pion Marquez, meanwhile, is gun- the world rankings after a successful PGA Tour last group tomorrow. “It was just good to get tournaments next year. It’s a nice insurance to ning for a fifth consecutive win on season highlighted by three top-10s in 23 starts that feeling that I could make those pressure have.” Lingmerth, who played college golf at the US soil after winning at and he would dearly love to represent Europe for putts. “I haven’t necessarily being putting great University of Arkansas where he was a two-time Indianapolis’s grueling 4.2 kilome- the first time at Hazeltine National in late 2016. since then but when you get that first win and All-American, has established strong roots in the ter circuit for the past four years. “It’s absolutely on my radar,” the 28-year-old you get your confidence up, it can do crazy United States but says he will always be a Swede Marquez, who spent part of his from Tranas told Reuters after carding an even- things with your overall game.” at heart. “I am definitely Swedish, and I’ll always summer break in Ibiza, heads into par 70 in the opening round of this week’s WGC- Lingmerth’s Memorial win, his third top-10 in be Swedish,” smiled Lingmeth, whose wife, the Indy GP buoyed by a victory in Bridgestone Invitational at Firestone Country 23 starts on the 2014-15 PGA Tour, has also led to Megan, is American. “I try to go back to Sweden Germany last month. He is current- Club. him revising his personal objectives for this year. at least once or twice a year to see family and ly languishing well down the “I’m still not a member of the European Tour, “Getting that first win was a big goal but it would stuff like that. But I adjust well to my surround- championship standings, fully 65 which I have to be to get Ryder Cup points, but be huge to get to play in the season-ending Tour ings so I am sure the American culture has set its points adrift of Rossi with 114. I’ve talked to my manager about it. If I become Championship (for the top-30 players),” said the tone in me too.”—Reuters However both Rossi and an affiliate member after the Race to Dubai is Lorenzo are mindful of how over this fall, I can start earning Ryder Cup points. Marquez reeled off 10 straight wins “That’s definitely something I am thinking about at the start of last year’s champi- and I would be very honoured to make that onship and continue to see the European team. It’s one of my big-time goals.” Spaniard as a potential threat. Lingmerth, who clinched the Memorial title in “I think he is able to win a lot of June by beating Justin Rose in a playoff, accepts races in a row as he demonstrated that his playing schedule for next year will need a last year,” Lorenzo said. “With nine lot of tweaking if he plans to compete on both races to the end, he can recover a the European and US circuits. lot of points or we can make mis- “It would definitely change but just having takes. So for sure he’s one of the that win at the Memorial and having a free year, favorites.” Marquez also bullishly so to speak, here on the PGA Tour makes me a believes the deficit is not insur- feel a lot better about trying to pursue that Ryder mountable. Cup team,” said the Swede. “So I’m going to give “Of course 65 points are a lot, it a go.” but you know I lose the first part of the season-maybe they will lose SUPERB PUTTING the second part of the season,” he Lingmerth extended his fully-exempt status said, referring to Rossi and Lorenzo. on the PGA Tour until the end of the 2016-17 “I know it is a big distance but we season with his Memorial triumph, a break- will try to focus like the last two through victory that was underpinned by a races.” —AFP superb display that week on the greens. David Lingmerth SPORTS SATURDAY, AUGUST 8, 2015
NOTTINGHAM: Australia’s Chris Rogers (upper centre left) hits a catch to Joe Root off the bowling of Mark Wood (lower centre) only to be recalled after the bowler is penalised for a no ball on the second day of the fourth Ashes Test cricket match between England and Australia. — AP England close in on Ashes victory
NOTTINGHAM: Ben Stokes took five wickets 130, Mark Wood for 28 and Jos Buttler for 12. to put England on the verge of a famous vic- Josh Hazlewood snared Stokes for five and tory that would win back the Ashes as Johnson removed Moeen Ali for 38 thanks to SCOREBOARD Australia finished on 241 for seven after a a superb catch by Smith, only a fine ninth- compelling second day of the fourth test at wicket partnership of 58 between Moeen and Trent Bridge yesterday. Broad saving England from complete col- NOTTINGHAM, United Kingdom: Scoreboard at stumps on the second day of the fourth The touring side, bowled out for 60 on the lapse. Warner, on 10, was badly dropped by Ashes Test between England and Australia at Trent Bridge yesterday: first morning of the match, fought back to Cook at first slip off Broad and Ian Bell spilled trail by 90 runs but England should finish a harder chance off Stokes. Australia 1st Innings 60 (S Broad 8-15) Australia 2nd Innings them off on the third day to clinch the series. Rogers, caught by Root off Wood on 47, C. Rogers c Root b Stokes 52 Adam Voges was 48 not out with Mitchell was reprieved when television replays England 1st Innings (overnight: 274-4) D. Warner c Broad b Stokes 64 A. Lyth c Nevill b Starc 14 Starc on nought at the close. Australia took showed the bowler had over-stepped the S. Smith c Stokes b Broad 5 A. Cook lbw b Starc 43 S. Marsh c Root b Stokes 2 five wickets in the morning before England crease but five runs later he was brilliantly tak- I. Bell lbw b Starc 1 M. Clarke c Bell b Wood 13 declared on 391 for nine and the touring en by Root. J. Root c Nevill b Starc 130 side’s openers, Chris Rogers and David Warner skied Stokes to Broad at wide mid- J. Bairstow c Rogers b Hazlewood 74 A. Voges not out 48 Warner, added 113 runs to give their side a on, Marsh edged the right-armer to Root at M. Wood b Starc 28 P. Nevill lbw b Stokes 17 foothold in the match. The pair batted third slip and Smith flayed Broad to cover B. Stokes c Nevill b Hazlewood 5 M. Johnson c Cook b Stokes 5 through most of the afternoon session before point where Stokes held a fine low catch. J. Buttler b Starc 12 M. Starc not out 0 Stokes inspired England to take four wickets Clarke scratched around gamely for 13 M. Ali c Smith b Johnson 38 Extras (b16, lb15, w1, nb3) 35 and end the Australia fightback. runs in nearly an hour but he never looked S. Broad not out 24 Total (7 wkts, 62.2 overs, 279 mins) 241 Stokes dismissed Rogers for 52, Warner for comfortable and edged Wood into the slips S. Finn not out 0 To bat: J Hazlewood, N Lyon 64 and Shaun Marsh for two before taking a where Cook juggled the ball before knocking Extras (b14, lb2, w2, nb4) 22 Fall of wickets: 1-113 (Rogers), 2-130 (Warner), Total (9 wkts dec, 85.2 overs, 390 mins) 391 brilliant catch off Broad’s bowling to send it up for Ian Bell to pouch it. 3-136 (Marsh), 4-136 (Smith), 5-174 (Clarke), 6- Fall of wickets: 1-32 (Lyth), 2-34 (Bell), 3-96 back Steven Smith for five and leave Australia Voges and Nevill added 50 for the sixth 224 (Nevill), 7-236 (Johnson) reeling at 138 for four at tea. England wicket, Nevill surviving after being caught by (Cook), 4-269 (Bairstow), 5-297 (Root), 6-306 Bowling: Broad 16-5-36-1; Wood 12.2-0-63-1 removed Michael Clarke (13), Peter Nevill (17) Cook off a Finn no ball. But he fell in the final (Wood), 7-320 (Buttler), 8-332 (Stokes), 9-390 (2nb, 1w); Finn 12-4-42-0 (1nb); Stokes 16-4- and Mitchell Johnson (five) in a tense final ses- session, trapped lbw by Stokes as he tried to (Ali) sion. Starc led the Australian fightback in the leave a rapid inswinger and Johnson edged Bowling: Starc 27-2-111-6 (1nb); Hazlewood 35-5; Ali 6-0-34-0. morning, claiming test-best figures of 6-111. Stokes to Cook before bad light ended the 24-4-97-2 (3nb, 1w); Johnson 21.2-2-102-1; Match position: Australia are 90 runs behind The tall left-armer dismissed Joe Root for day’s play. — Reuters Lyon 10-1-47-0; Warner 3-0-18-0 (1w) with three wickets standing.— AFP SPORTS SATURDAY, AUGUST 8, 2015 Mourinho hits back at Martinez over Stones row
COBHAM: Chelsea boss Jose Mourinho has launched a thinly- veiled attack on Roberto Martinez in response to the Everton manager’s accusations that John Terry has “illegally” tapped up John Stones. Mourinho has made Everton defender Stones one of his main transfer targets, but has so far been unable to persuade Martinez to sell the 21-year-old England international. Terry highlighted Chelsea’s interest in the highly-rated youngster when he spoke of how the Premier League champi- ons are “looking to the likes of John Stones for the future, so the club will continue to grow and do well”, prompting an angry response from Martinez, who said what the Chelsea captain did was “wrong” and against “rules and regulations”. But yesterday, Mourinho dismissed those complaints in a clear dig at Martinez, saying: “My feeling is just one and I’m not speaking about Everton or Stones. I’m just speaking in general. “If I could, I would speak with you (the media) once in a month. And there are other people in football who if they could they would have a press conference every day. And I don’t want to say anything else.” Mourinho also claimed he doesn’t know if Diego Costa will be fit to start for Chelsea in their opening Premier League match against Swansea City on Saturday, but does not feel the Spain star’s ongoing hamstring problem will force him to sign another forward. The Portuguese also stated that he would prefer a “top play- er” like Costa who is only occasionally fit, rather than someone always available who does not have the same impact. Costa missed last week’s Community Shield defeat to Arsenal with the injury that plagued much of his 2014-15 campaign and, speaking before Chelsea trained on Friday, Mourinho said he NYON: The Champions League trophy is on display during the draw for the Champions League 2015/16 soc- was waiting to survey the former Atletico Madrid player’s condi- cer play-offs, at the UEFA Headquarters. —AP tion. “I think he’s going to train with the team. His reaction after that and his decision to be confident to play is another story,” Champions League playoff Mourinho said. PERFECT NUMBER Man United face Bruges as Asked whether he felt he needed to buy, Mourinho said no, and insisted Costa does the work of “1.5” forwards when he plays. “I have (Loic) Remy and (Radamel) Falcao. I go with Remy and Falcao like I did in other matches (if Costa isn’t fit), like I did Valencia and Monaco clash last season so many times with Remy and (Didier) Drogba,” he said. “But obviously he’s a top striker. Not just for the goals he NYON: Manchester United were given stage for the second season in a row. Anderson. Skenderbeu, aiming to scores, but the football he produces. “I cannot say I don’t need a troublesome tie against Club Bruges “Belgian football is right at the very become first Albanian team to reach him, but I don’t like to speak about injured players. in the draw for the Champions League top and we have two Belgian players in the group stage, must face Croatian “We brought Falcao because we know that we need three, playoff round yesterday, although it the squad who keep us abreast of champions Dinamo Zagreb and we need protection to this situation. Three is the perfect number could have been worse as they avoided what’s going on there,” said Astana, hoping to become and we have three.” When it was joked that Costa’s injuries Lazio, CSKA Moscow and Monaco. Manchester United club secretary John Kazakhstan’s first representatives in mean he only has 2.5 strikers, Mourinho shot back: “The half Lazio will meet Bayer Leverkusen as Alexander, whose club are at home in the competition proper, meet APOEL when he plays is one and a half, so compensates, because he’s a they attempt to return to the group the first leg on Aug. 18. “We go into any of Cyprus. fantastic player. stage for the first time since 2007-08 game with confidence. We’d like to “Dinamo Zagreb are a strong oppo- “There is nobody to blame and that is very important. I can’t while another high profile tie pitted think we can win the competition.” nent and very experienced,” said blame the player, because the player works hard.” Mourinho did Spain’s Valencia against Monaco, who Scottish champions Celtic, European Skenderbeu coach Mirel Josa. “At this again stress that Chelsea would seek to sign a left-back. were quarter-finalists last season. Cup winners in 1967, will play Swedish stage of the tournament every team is “It’s a basic thing. We have only [Cesar] Azpilicueta. We need Portugal’s Sporting will face CSKA counterparts Malmo as they attempt to capable of competing against every- a left-back, the board knows that, we all know that,” he said. “My while Rapid Vienna, who stunned Ajax make up for last season’s disappointing one else. We will be ready.” Champions feeling is that we are going to have one. But obviously there is Amsterdam by beating the four-times playoff round defeat against Maribor. League regulars FC Basel, Swiss cham- not only one left-back in the football world. European champions in the previous Malmo, beaten European Cup final- pions for the last six seasons, face “There are more, there are different options and we’ll decide round, were rewarded with a tie ists in 1979, are hoping to make the Maccabi Tel Aviv and BATE Borisov, when it’s possible to decide.” Mourinho meanwhile said he is against group stage regulars Shakhtar group stage for the second season who have also became familiar faces in not concerned by Chelsea’s failure to win a single 90-minute Donetsk from Ukraine. running. “We had a fantastic season in the group stage with four appearances game in pre-season. “No problem about four or five matches United, fourth in the English Premier the UEFA Champions League last sea- since 2008/09, take on Serbia’s without a victory in 90 minutes,” he said. “If you ask me if I want League last season, will still be uncom- son and it would mean so much to us Partizan. The first legs will be played on to play better, defend better, score more, yes I want to do that. fortable at having to overcome Bruges to make the group stage again,” said August 18/19 and the second legs on “We have more than a week to work. No problem.” —AFP to avoid missing out on the group Malmo sporting director Daniel August 25/26.—Reuters Dortmund face Odds in Europa League playoff
NYON: Borussia Dortmund, in the Champions League qualify- Girondins Bordeaux face a long with Belenenses from Portugal, Champions League finalists two ing round, will face Jablonec from trip to Central Asia to meet having eliminated their compatri- years ago, were paired with the Czech Republic in another of Kazahkstan’s Kairat Almaty and ots Vitoria Guimaraes in the pre- Norwegian side Odds Ballklubb in the 22 playoff ties. Romanian side Astra, who beat vious round. The 22 winners will the draw for the Europa League Athletic Bilbao will play West Ham United in the previous qualify for the group stage along playoff round made yesterday. Slovakians Zilina and Steaua round, face AZ Alkmaar. with 16 teams who have been Four-times European champions Bucharest, who like Dortmund and Austrian side Altach, based in given a bye plus the 10 losers of Ajax Amsterdam, who suffered a Ajax are former European champi- a Tyrolean village with just over the Champions League playoff shock defeat against Rapid Vienna ons, will meet Norway’s Rosenborg. 6,000 inhabitants, were drawn ties.—Reuters SPORTS SATURDAY, AUGUST 8, 2015
Palestinians delay soccer final in dispute over travel
GAZA: The Palestinian Football Federation post- sion can’t leave Gaza without them,” said Ala hurt are the Palestinian public,” it said. poned the final Palestine Cup game between the Shammaly, a member of the media office for the champions from the Gaza Strip and the West Bank Shejaia team. Sunday’s championship was to be a fol- FIFA INTERVENTION after Israel denied entry permits to some of the Gaza low-up of a match on Thursday between Al-Ahly, the Rajoub said on Thursday he had received a letter players, Palestinian sports officials said. top team in the West Bank and Gaza’s champion from FIFA’s President Sepp Blatter saying he would The Shejaia club from the Gaza Strip must pass Shejaia. work to remove obstacles that may hinder the hold- through an Israeli border crossing to reach the occu- The game, which ended in a goalless draw, had ing of the final game. At the annual FIFA Congress pied West Bank city of Hebron, where Sunday’s game been the first such visit since a Palestinian uprising in May, Palestine threatened to call for a vote for was scheduled to be played, and to do so needs broke out in 2000. Whichever team wins the title will Israel’s suspension from world football but it approval from Israel. play in the next Asian Football Confederation (AFC) dropped its motion at the last minute and FIFA Israeli authorities said they had allowed 33 of 37 Cup. “As always the Israeli occupation wanted to spoil agreed to send observers to monitor the situation. players to cross but wanted to ask further questions our happiness,” said Abdel-Salam Haniyeh of the Israel made a commitment to allow freer move- of the remaining four. They were invited for screen- Palestinian Higher Council of Sport. “Effort by the ment of Palestinian sport personnel and Palestinian ing on both Thursday and Friday but refused, an Palestinian FA is continuing to allow the joy that sport officials say such a commitment was now Israeli border affairs spokeswoman said. began in Gaza from reaching out to Hebron.” being tested. “They will be allowed to cross tomorrow after Israel’s Coordinator of Government Activities in “It is time Israel lifts its hand off Palestinian questions,” spokeswoman Hadar Horen said. The bor- the Territories, which handles border crossings and sport,” said Haniyeh. The PFA has complained that der is closed today. The Palestinian federation said permits, said the team’s decision not to cross was Israel restricts the movement of players and officials the game was now delayed until further notice. “another cheap provocation” by the chairman of the to and from the Palestinian territories. Israel cites “It became clear seven people, including four play- Palestinian FA, Jibril Al-Rajoub. “The Palestinians security concerns for the restrictions, although it ers, were not on the list and therefore, the entire mis- make cynical use of sport and in the end the ones says it has eased travel recently. —Reuters
PSG target CL glory with Di Maria PARIS: Paris Saint-Germain are confident Angel di Maria can be the man to help them conquer Europe after completing the signing of the Argentina winger on Thursday. The 27-year-old penned a four-year deal at the Parc des Princes after PSG agreed to pay Manchester United 63 million euros (£44.3m; $68.9m) to make him the second most expensive signing in French football history. Released from the constraints of Financial Fair Play after UEFA relaxed their controversial rules earli- er this summer, the French champions have made their biggest splash in the transfer market since paying 64 million euros to sign Edinson Cavani from Napoli in July 2013. Laurent Blanc’s side’s dominance of the domestic scene was complete last season, when they claimed an unprecedented clean sweep of the domestic honors, winning the treble of Ligue 1, French Cup and League Cup after taking the season-opening Champions Trophy. They have already won the Champions Trophy this season with a comfortable 2-0 win against Lyon, their closest challengers in the last campaign. The squad was already good enough to win more silverware at home, but PSG’s Qatari owners are convinced securing long-time target Di Maria can help them become the first French team since Marseille in 1993 to be champi- ons of Europe. “It is a real honour for the club to finally sign Angel and contin- ue our great European dream. Our great ambition as everyone knows is the Champions League,” said club president Nasser Al- Khelaifi. “We are close to our dream. We will try this year. Angel will real- ly give something extra to the team, especially in the Champions Stuart Armstrong League. I hope he can win it with us.” Paris have reached the Champions League quarter-finals in each of the last three seasons, with two defeats at that stage to Celtic hope to avoid Euro hangover Barcelona sandwiching a loss on away goals to Chelsea in 2014. “There were clubs I could have gone to but my desire to be in this GLASGOW: Celtic midfielder Stuart if we scored it was a huge advantage. you have a lot riding on it and the tem- project and help them to win the Champions League is why I chose Armstrong hopes his side don’t suffer a “It was on the toughest games I have perature and the humidity is so high, to come here,” said Di Maria as he was unveiled to the media in a European hangover as they return to played in, in terms of getting something then it’s a real test.” luxurious Paris hotel, close to the Eiffel Tower. —AFP domestic duty following their midweek out of the game, organisation and keep- Charlie Mulgrew may return for Champions League exertions against ing to a plan, I felt we did that very well. Ronny Deila’s side for the trip to face Qarabag. “It was a tiring game. It was nice to Thistle after missing out on the midweek The Hoops booked their place in the have the water breaks. The second half match through injury. play-off round of Europe’s elite club com- was challenging and the surface wasn’t Elsewhere today, league leaders petition on Wednesday as they held the great either. Dundee welcome Hearts to Dens Park. Azerbaijani champions to a goalless draw “It was fine lines. You had to concen- Paul Hartley’s side got their season off to in Baku to secure a 1-0 aggregate win. trate at all times as you couldn’t rely on a flying start with a 4-0 demolition of The match was played in sweltering the surface and afford to look away Kilmarnock last weekend, but should conditions and Armstrong admitted that before the ball arrived. That was just face stiffer competition from the the encounter had taken its toll on the another factor we had to concentrate Jambos, who defeated St Johnstone in a Celtic players, who now face Partick on. It was very tough on the body. It was 4-3 opening day thriller. Thistle at Firhill on league duty this a very hard match overall, physically and Inverness will hope to make up for Sunday. mentally. their first day loss to Motherwell when “It was a tough game,” the Celtic mid- “You could see the emotion on our they make the trip to McDiarmid Park to fielder said. “We knew they had to come faces when the final whistle sounded, face St Johnstone, while Motherwell out and do something to get back into we were all delighted to get through. “I host Dundee United at Fir Park. the tie. We were happy to keep our team have played in hotter conditions but Kilmarnock will make the long trip north Angel di Maria shape and go on the counter. We knew when it’s such an important game and to take on Aberdeen tomorrow. —AFP SPORTS SATURDAY, AUGUST 8, 2015 Shaw expects Man United new boys to spark title bid
MANCHESTER: Manchester United defender Luke Shaw believes son’s fifth-place finish at United. “They have brought in a lot of good players but we’ve had a the club’s new signings will enable them to mount a sustained Alderweireld, a winner at Old Trafford with Southampton last good pre-season and trained hard so physically we are 100 per challenge for the Premier League title this season. season, is convinced they can make a winning start. “I’ve played cent. Louis van Gaal’s side finished fourth in the Dutchman’s first a lot of big games so I know what to expect. The first game of “We have confidence in ourselves to play football. It’s always campaign in charge, but a pre-season spending spree has bol- the season is always a strange one-everybody is very excited difficult to play at Old Trafford but we have to believe in our- stered United’s hopes of wrestling the title away from Chelsea. and we’re looking forward to it. It’s a big challenge,” the Belgian selves and how we want to play. If we do that, we can get a Netherlands winger Memphis Depay, signed from PSV defender said. good result.” Eindhoven, and experienced Germany midfielder Bastian “We have the opportunity to take a good first step-we are Spurs boss Mauricio Pochettino will check on the fitness of Schweinsteiger, lured from Bayern Munich, are the most eye- confident we can get a good result but we know it will be diffi- striker Roberto Soldado (back) and winger Andros Townsend catching names among those recruited by Van Gaal. cult. (shoulder) ahead of the trip. —AFP And England left-back Shaw has been impressed with impact those two new recruits have already made ahead of United’s opening fixture against Tottenham at Old Trafford on today. “Bastian’s a massive legend,” Shaw said. “For someone with that much experience to come into the team will be vital to help us push for some trophies this season. “He’s one of the most humble guys I’ve come across. He’s not too loud and he’s quite funny at the same time. It’s nice to have a German around in the dressing room. “I’ve also got on well with Memphis. He’s a different character. It’s good for the changing room and he’s confident about his own ability. It’s something new to have but it’s very good to have.” Van Gaal has to decide whether to pick goalkeeper David De Gea, who has been unsettled over speculation which has linked him to Real Madrid during pre-season, for the visit of Spurs. Should the Dutchman decide that De Gea is not in the right frame of mind he will hand a debut to Sergio Romero even though he has not featured in any of the club’s warm-up match- es. The Argentina international joined United at the end of last month on a free transfer, having previously been at Sampdoria. United are without Belgium midfielder Marouane Fellaini, who serves a three-match suspension following his red card in the final game of last season against Hull.
BLOATED SQUAD Tottenham’s efforts in the transfer market have been focused more on trimming a bloated squad with just three new faces- Toby Alderweireld, Kevin Wimmer and Kieran Trippier-arriving at White Hart Lane since the end of last season. Alderweireld, Wimmer and Trippier will all strengthen Spurs defensively, but England striker Harry Kane will be heavily relied on to provide the goal threat for an inconsistent attack. Tottenham’s pre-season produced a mixed bag of results pri- or to this week’s confidence-boosting 2-0 victory over AC Milan. The significance of that result will disappear completely, however, when Spurs begin their efforts to build on last sea- Bastian Schweinsteiger Costa injury woes threaten to Matches on TV hamper Chelsea’s title defence (Local Timings) English Premier League LONDON: Chelsea kick off their Premier League title weekend’s Community Shield prompted fresh concerns in every game they play. “It demands 100 per cent of your defence against Swansea today fretting that Diego Costa’s that the former Atletico Madrid star’s problems have not ability and focus because it is very competitive, very physi- Man United v Tottenham 14:45 injury problems could hamper their bid to remain yet gone away. Chelsea manager Mourinho has stuck by cal and tactical too. beIN SPORTS 1 HD England’s pre-eminent force. his policy of operating with a squad that includes just “Maybe the football philosophy is a little different here Costa’s 20 goals in 26 league appearances were crucial three strikers, with Radamel Falcao arriving on loan from in that it is always about getting the ball forward and there beIN SPORTS 11 HD as Jose Mourinho’s side took an early grip on last season’s Monaco to join Loic Remy as back-up to Costa after Didier is less time when teams are just trying to control the ball Leicester v Sunderland 17:00 Drogba moved to Major League Soccer’s Montreal Impact. and take the heat out of the game.” Other than Falcao, The evidence of pre-season, however, has been that Asmir Begovic is the only other new arrival, brought in beIN SPORTS 5 HD Chelsea’s attacking options appear under-powered com- from Stoke to replace departed goalkeeper Petr Cech, Norwich City v Crystal 17:00 pared to their main rivals and while Mourinho has not although Mourinho is keen to bring in a left-back as back- ruled out the possibility of Costa facing Swansea when the up for Cesar Azpilicueta. The Blues boss doesn’t get many beIN SPORTS 6 HD champions return to action at Stamford Bridge, the things wrong, but if Chelsea’s title defence falters, he will Bournemouth v Aston Villa 17:00 chances appear slim. Mourinho’s team have failed to win find himself accused of failing to build on a side that won any of their warm-up games in 90 minutes and meet the title at a canter. The likely absence of Costa would pro- beIN SPORTS 3 HD Swansea after suffering successive 1-0 defeats, first to vide Garry Monk’s Swansea with a welcome boost ahead Arsenal at Wembley on Sunday and then at home to of one of their most testing fixtures of the season. Everton v Watford 17:00 Fiorentina on Wednesday. And while the usual caveats And Swansea captain Ashley Williams said: “At the beIN SPORTS 1 HD about friendly matches apply, Chelsea have looked alarm- moment I think the most difficult Premier League striker ingly blunt in front of goal, with Falcao—who endured a to play against is Diego Costa, he scored a few goals Chelsea v Swansea City 19:30 miserable loan spell at Manchester United last season- against us last season. “He’s one you don’t look forward to beIN SPORTS 1 HD Diego Costa showing few signs of returning to his best. playing against to be honest. “It seems he might miss Saturday’s game, but you never really know until you get beIN SPORTS 11 HD title race that they never relinquished. But concerns about UNIQUE CHALLENGES to the ground and look at the team-sheet. “Whatever the Spain striker’s fitness became a recurring theme Falcao netted only four goals in 29 appearances for eleven they field is world class so it doesn’t matter too throughout the campaign and it frequently took the bril- United and he acknowledges it isn’t easy to adapt to the much, but obviously if he didn’t play it would be a bonus Supercoppa Italiana liance of Eden Hazard to make up for the side’s diminished unique challenges of the Premier League. “It’s a lot more for us.” Swansea are hoping to build on last season’s suc- attacking threat whenever Costa was absent. physical here than anywhere else in Europe,” Falcao told cess of finishing eighth in Monk’s first full year in charge Juventus v Lazio 15:00 And the sight of Costa limping out of a recent friendly Chelsea’s website. “It’s a very, very competitive league and the arrival of Andre Ayew from Marseille should pro- Abu Dhabi Sports with Barcelona followed by his enforced absence from last where each team gives absolutely everything they’ve got vide an additional attacking threat this year. —AFP England close in on Ashes victory SATURDAY, AUGUST 8, 2015 SATURDAY, SportsSports 44
KAZAN: Australia’s Bronte Campbell (centre) holds her gold medal with her sister and bronze medalist Cate (left) and silver medalist Sweden’s Sarah Sjostrom after winning the women’s 100m freestyle final at the Swimming World Championships. — AP Campbell sisters keep it in the family
KAZAN: The sisters of speed are keeping the had over Cate because she had shoulder sur- 100 free, and last year earned silver at the in 1:54.55. Evgeny Rylov of Russia was third at 100-meter freestyle title all in the family. Bronte gery less than a year ago. I’ve seen her come Commonwealth Games. 1:54.60. Irie, the Olympic silver medalist, faded Campbell led all the way against a strong field back from that and struggle through all the “It wasn’t my year this year but there’s to sixth. Olympic champion Tyler Clary of the at the world championships yesterday, winning rehab, which took forever. I know I wouldn’t be always next year and next year is an Olympic United States was seventh in an event the in 52.52 seconds to take the title away from old- standing on the podium without her, so the year,” Cate said. “I will definitely be back in the Americans have dominated for years. “I might er sister and defending champion Cate medal is really half hers anyway.” pool doing the hard yards and making sure that have (ticked) off a few people this week,” Larkin Campbell. Olympic champion Ranomi Kromowidjojo of I make it as tough for her as possible.” And little said. “They’ll be training really hard for the next “I still can’t believe that,” Bronte said. The 21- the Netherlands was fourth. Heemskerk was sis should forget about taking over at home, 12 months. But it’s a new challenge for me and I year-old Australian sprinter was under world- fifth, followed by Simone Manuel and her US too. “She will not be getting the bigger bed- look forward to it.” record pace at the turn, with Cate in second. teammate Missy Franklin. room nor the walk-in wardrobe,” said Cate, who James Guy rallied Britain to victory over the Bronte held on for gold and Cate settled for Bronte went over the lane line and bypassed is two years and six days older. The Aussies United States on the last lap of the 4x200 bronze. “It’s a fantastic night for the Campbell Sjostrom to find her sister for a watery hug earned a second gold on the night when freestyle relay, an event the Americans had won family and it’s a fantastic night for Australia,” before pumping her right arm. Later, she plant- Mitchell Larkin rallied to win the 200 back- at every worlds since 2005. Cate said. “I couldn’t be more proud of my little ed a playoff kiss on Cate’s cheek. stroke, completing a sweep of the backstroke Ryan Lochte led off and put the Americans sister.” Sarah Sjostrom of Sweden took silver in “She helps keep me calm. She’s sort of like events in Kazan. in front. Conor Dwyer and Reed Malone keep 52.70, a repeat of her finish two years ago in my lucky talisman,” Bronte said. “But when we “The Campbell sisters getting first and third them there until Guy passed inexperienced U.S. Barcelona. get out behind the blocks it’s like every man or was amazing, and that sort of inspired me and anchor Michael Weiss to win in 7:04.33. The Bronte earned the biggest international vic- woman for themselves.” really motivated me,” Larkin said. Americans settled for silver in 7:04.75. Australia tory of her young career with the fastest time in The sisters live and train together, with Cate He trailed Ryosuke Irie after two laps before was third at 7:05.34, earning its fourth medal of the world this year, knocking her sister and having been the dominant swimmer in the surging to the lead on the third lap. Larkin won the night. “We’re going to definitely remember Femke Heemskerk of the Netherlands out of event the last few years. But Bronte has been in 1 minute, 53.58 seconds to go with his title in this,” Lochte said. “Hopefully we’re going to the top spot they shared. “I’ve had a lot of good coming on, and is a medal threat for next year’s the 100 back. train our butts off all next year and hopefully training,” Bronte said. “That’s an advantage I’ve Olympics. In Barcelona, she finished 11th in the Radoslaw Kawecki of Poland finished second not let that happen again in Rio.” — AP