Phylogenomics: a Genome Level Approach to Assembling the Bacterial Branches of the Tree of Life

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Phylogenomics: A Genome Level Approach to Assembling the Bacterial Branches of the Tree of Life Jonathan A. Eisen Naomi Ward Karen E. Nelson Frank T. Robb Jonathan H. Badger QuickTimeª and a TIFF (LZW) decompressor James Sakwa are needed to see this picture. Martin Wu Dongying Wu Kevin Penn Elizabeth M. O’Connor Julie Enticknap Tim Steppe http://www.tigr.org/tol TIGTIGRR Background I: rRNA Tree • Phenotype not very useful for bacterial phylogeny • Most molecular studies QuickTimeª and a TIFF (LZW) decompressor are needed to see this picture. based on 16s rRNA sequence analysis • Studies of other genes do not always agree with rRNA, especially for deep branches TIGTIGRR Background II: Most Bacteria Have Never Been Cultured • Microscopic and molecular studies show that <1% of the microbes in most environments have been grown in pure culture • True in terms of #s and phylogenetic diversity • This means we know little about their biology TIGTIGRR Background III: Genomics Has Revolutionized Bacteriology • Predictions of biology • Drug design, vaccine development • Functional genomic studies • Evolutionary reconstructions – Whole genome phylogeny – Lateral gene transfer – Population genomics TIGTIGRR Biased Sampling of Bacterial Genomes Hugenholtz 2002 TIGTIGRR Automated Whole Genome Phylogeny TIGTIGRR TIGR Tree of Life Project • Major goal – Increase phylogenetic diversity of genome sequences • Three sub-goals – Resolve relationships among the phyla – Launch experimental studies of these phyla – Inform environmental studies of uncultured microbes • The Players – TIGR (Jonathan Eisen, Naomi Ward, Karen Nelson et al.) – COMB (Frank Robb et al.) TIGTIGRR Proteobacteria TM6 OS-K Acidobacteria Termite Group OP8 Nitrospira CFB Chlorobi Fibrobacteres Marine GroupA WS3 Gemmimonas Firmicutes Fusobacteria Actinobacteria This project OP9 Cyanobacteria Published Synergistes In progress Deferribacteres Chrysiogenetes Uncultured lineage NKB19 Verrucomicrobia Chlamydia OP3 Planctomycetes Spriochaetes 0.1 Coprothermobacter OP10 Thermomicrobia Chloroflexi TM7 Deinococcus-Thermus Dictyoglomus Aquificacae Tree based on Thermodesulfobacteria Thermotogae Hugenholtz (2002) OP1 with some TIGTIGRR OP11 modifications. Genome Sequencing Progress Phylum Species selected Growth, Libraries Shotgun Estimated # of Auto- DNA Coverage Genome Contigs Annotated isolation Size (Mb) Chrysiogenes Chrysiogenes arsenatis + + 4x 2.5 155 + Coprothermobacter Coprothermobacter proteolyticus (CP) + + 8x 1.38 3 + Dictyoglomi Dictyoglomus thermophilum (DT) + + 8x 2.0 9 + Thermodesulfobacteria Thermodesulfobacterium commune (TC) + + 8x 1.78 26 + Nitrospirae Thermodesulfovibrio yellowstonii (TY) + + 8x 1.98 27 + Thermomicrobia Thermomicrobium roseum + + 8x 3.4 82 + Deferribacteres Selecting from + In Deferribacter thermophilus, progress Geovibrio thiophilus, Flexistipes sinusarabici Synergistes Selecting from + In Synergistes jonesii, progress Aminobacter colombiense, Thermanaerovibrio acidaminovorans, Aminomonas paucivorans , Dethiosulfovibrio peptidovorans Type Strain or Species Selected When Possible TIGTIGRR Goal I: Relationships Among Phyla TIGTIGRR Concatenated Alignment ML Tree TIGTIGRR Proteobacteria TIGTIGRR Green Non Sulfur Bacteria TIGTIGRR Goal II: Biology of These Phyla TIGTIGRR QuickTimeª and a TIFF (LZW) decompressor are needed to see this picture. TIGTIGRR Goal III: Uncultured Microbes TIGTIGRR Key Issues in Uncultured Microbes • Questions – 1. Who is out there? – 2. What are they doing? – 3. Need to connect 1 and 2. • Answers – 1. Phylogenetic anchors – 2. Genomics – 3. Linking anchors to genomics contigs TIGTIGRR Phylogenetic Anchors and the Sargasso Sea Shotgun Sequencing Warner BBrothers, Inc. shotgun sequence TIGTIGRR rRNA as a Phylogenetic Anchor TIGTIGRR Venter et al., 2004 Shotgun Sequencing Allows Use of Alternative Anchors (e.g., RecA) TIGTIGRR Venter et al., 2004 Biased Sampling of Bacterial Genomes Hugenholtz 2002 TIGTIGRR Our Tree of Life Genomes Allow Anchoring of 100s of clones from Yellowstone Mats QuickTimeª and a TIFF (LZW) decompressor are needed to see this picture. TIGTIGRR Tree of GYOAP59TF TIGTIGRR Blast of GYOAP59TF >ORF02612-TG_gtr_857 rho transcription termination factor Rho {Thermomicrobium_roseum_DSM5159} Length = 426 Score = 1177 (419.4 bits), Expect = 2.9e-119, P = 2.9e-119 Identities = 232/232 (100%), Positives = 232/232 (100%) Query: 1 VAPIGRGQRGLIVSPPKAGKTVLLKHIANGITTNYKDIHLIVLLIGERPEEVTDMRRSVD 60 VAPIGRGQRGLIVSPPKAGKTVLLKHIANGITTNYKDIHLIVLLIGERPEEVTDMRRSVD Sbjct: 191 VAPIGRGQRGLIVSPPKAGKTVLLKHIANGITTNYKDIHLIVLLIGERPEEVTDMRRSVD 250 Query: 61 GEVISSTFDEPVEDHIRVAEMTLERAKRLVECGMDVVILLDSITRLARAYNLSVPPSGRT 120 GEVISSTFDEPVEDHIRVAEMTLERAKRLVECGMDVVILLDSITRLARAYNLSVPPSGRT Sbjct: 251 GEVISSTFDEPVEDHIRVAEMTLERAKRLVECGMDVVILLDSITRLARAYNLSVPPSGRT 310 Query: 121 LSGGIDPVALYPPKRFFGAARNIEGGGSLTIIATCLVDTGSRMDDVIYEEFKGTGNMELH 180 LSGGIDPVALYPPKRFFGAARNIEGGGSLTIIATCLVDTGSRMDDVIYEEFKGTGNMELH Sbjct: 311 LSGGIDPVALYPPKRFFGAARNIEGGGSLTIIATCLVDTGSRMDDVIYEEFKGTGNMELH 370 Query: 181 LDRKLAERRIFPAIDIQRSGTRREELLLDEQTLRQVWTMRRMVSMLGGTDGT 232 LDRKLAERRIFPAIDIQRSGTRREELLLDEQTLRQVWTMRRMVSMLGGTDGT Sbjct: 371 LDRKLAERRIFPAIDIQRSGTRREELLLDEQTLRQVWTMRRMVSMLGGTDGT 422 TIGTIGRR Broader Impact • Genome sequence data released to TIGR web site • Genome Users Workshop to be held at TIGR in 2005 • Project used as model for evolution teaching in talks to HHMI, MD Science Teachers Assocation, and Montgomery County high school science teachers • Project promoted to public through radio and print media TIGTIGRR Training • Student involvement – Kevin Penn, technician at TIGR – Temylope Adeyefa-Olasupo, U. Md Undergrad working at COMB – Rebecca Brocato, high school intern, COMB – Joseph Wister, TIGR Summer Fellow with Karen Nelson – Ryan Corces-Zimmerman, high school intern working at TIGR • Teaching using this project – MBL Molecular Evolution Workshop – MBL Genomics Workshop TIGTIG–RRJackson Lab Genomics Workshop Future Issues • New estimates suggests > 100 bacterial phyla • Someone needs to cover Archaeal diversity • Need DNA repository TIGTIGRR.
Recommended publications
  • The Influence of Probiotics on the Firmicutes/Bacteroidetes Ratio In

    The Influence of Probiotics on the Firmicutes/Bacteroidetes Ratio In

    microorganisms Review The Influence of Probiotics on the Firmicutes/Bacteroidetes Ratio in the Treatment of Obesity and Inflammatory Bowel disease Spase Stojanov 1,2, Aleš Berlec 1,2 and Borut Štrukelj 1,2,* 1 Faculty of Pharmacy, University of Ljubljana, SI-1000 Ljubljana, Slovenia; [email protected] (S.S.); [email protected] (A.B.) 2 Department of Biotechnology, Jožef Stefan Institute, SI-1000 Ljubljana, Slovenia * Correspondence: borut.strukelj@ffa.uni-lj.si Received: 16 September 2020; Accepted: 31 October 2020; Published: 1 November 2020 Abstract: The two most important bacterial phyla in the gastrointestinal tract, Firmicutes and Bacteroidetes, have gained much attention in recent years. The Firmicutes/Bacteroidetes (F/B) ratio is widely accepted to have an important influence in maintaining normal intestinal homeostasis. Increased or decreased F/B ratio is regarded as dysbiosis, whereby the former is usually observed with obesity, and the latter with inflammatory bowel disease (IBD). Probiotics as live microorganisms can confer health benefits to the host when administered in adequate amounts. There is considerable evidence of their nutritional and immunosuppressive properties including reports that elucidate the association of probiotics with the F/B ratio, obesity, and IBD. Orally administered probiotics can contribute to the restoration of dysbiotic microbiota and to the prevention of obesity or IBD. However, as the effects of different probiotics on the F/B ratio differ, selecting the appropriate species or mixture is crucial. The most commonly tested probiotics for modifying the F/B ratio and treating obesity and IBD are from the genus Lactobacillus. In this paper, we review the effects of probiotics on the F/B ratio that lead to weight loss or immunosuppression.
  • Genomics 98 (2011) 370–375

    Genomics 98 (2011) 370–375

    Genomics 98 (2011) 370–375 Contents lists available at ScienceDirect Genomics journal homepage: www.elsevier.com/locate/ygeno Whole-genome comparison clarifies close phylogenetic relationships between the phyla Dictyoglomi and Thermotogae Hiromi Nishida a,⁎, Teruhiko Beppu b, Kenji Ueda b a Agricultural Bioinformatics Research Unit, Graduate School of Agricultural and Life Sciences, University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan b Life Science Research Center, College of Bioresource Sciences, Nihon University, Fujisawa, Japan article info abstract Article history: The anaerobic thermophilic bacterial genus Dictyoglomus is characterized by the ability to produce useful Received 2 June 2011 enzymes such as amylase, mannanase, and xylanase. Despite the significance, the phylogenetic position of Accepted 1 August 2011 Dictyoglomus has not yet been clarified, since it exhibits ambiguous phylogenetic positions in a single gene Available online 7 August 2011 sequence comparison-based analysis. The number of substitutions at the diverging point of Dictyoglomus is insufficient to show the relationships in a single gene comparison-based analysis. Hence, we studied its Keywords: evolutionary trait based on whole-genome comparison. Both gene content and orthologous protein sequence Whole-genome comparison Dictyoglomus comparisons indicated that Dictyoglomus is most closely related to the phylum Thermotogae and it forms a Bacterial systematics monophyletic group with Coprothermobacter proteolyticus (a constituent of the phylum Firmicutes) and Coprothermobacter proteolyticus Thermotogae. Our findings indicate that C. proteolyticus does not belong to the phylum Firmicutes and that the Thermotogae phylum Dictyoglomi is not closely related to either the phylum Firmicutes or Synergistetes but to the phylum Thermotogae. © 2011 Elsevier Inc.
  • Exploring Antibiotic Susceptibility, Resistome and Mobilome Structure of Planctomycetes from Gemmataceae Family

    Exploring Antibiotic Susceptibility, Resistome and Mobilome Structure of Planctomycetes from Gemmataceae Family

    sustainability Article Exploring Antibiotic Susceptibility, Resistome and Mobilome Structure of Planctomycetes from Gemmataceae Family Anastasia A. Ivanova *, Kirill K. Miroshnikov and Igor Y. Oshkin Research Center of Biotechnology of the Russian Academy of Sciences, Winogradsky Institute of Microbiology, 119071 Moscow, Russia; [email protected] (K.K.M.); [email protected] (I.Y.O.) * Correspondence: [email protected] Abstract: The family Gemmataceae accomodates aerobic, chemoorganotrophic planctomycetes with large genome sizes, is mostly distributed in freshwater and terrestrial environments. However, these bacteria have recently also been found in locations relevant to human health. Since the antimi- crobial resistance genes (AMR) from environmental resistome have the potential to be transferred to pathogens, it is essential to explore the resistant capabilities of environmental bacteria. In this study, the reconstruction of in silico resistome was performed for all nine available gemmata genomes. Furthermore, the genome of the newly isolated yet-undescribed strain G18 was sequenced and added to all analyses steps. Selected genomes were screened for the presence of mobile genetic elements. The flanking location of mobilizable genomic milieu around the AMR genes was of particular in- terest since such colocalization may appear to promote the horizontal gene transfer (HGT) events. Moreover the antibiotic susceptibility profile of six phylogenetically distinct strains of Gemmataceae planctomycetes was determined. Citation: Ivanova, A.A.; Keywords: planctomycetes; Gemmataceae; antibiotic resistance profile; resistome; mobilome Miroshnikov, K.K.; Oshkin, I.Y. Exploring Antibiotic Susceptibility, Resistome and Mobilome Structure of Planctomycetes from Gemmataceae 1. Introduction Family. Sustainability 2021, 13, 5031. Several decades ago humanity faced the global issue of growing antibiotic resistance https://doi.org/10.3390/su13095031 of bacterial pathogens in clinic [1–5].
  • Ninety-Nine De Novo Assembled Genomes from the Moose (Alces Alces) Rumen Microbiome Provide New Insights Into Microbial Plant Biomass Degradation

    Ninety-Nine De Novo Assembled Genomes from the Moose (Alces Alces) Rumen Microbiome Provide New Insights Into Microbial Plant Biomass Degradation

    The ISME Journal (2017) 11, 2538–2551 © 2017 International Society for Microbial Ecology All rights reserved 1751-7362/17 www.nature.com/ismej ORIGINAL ARTICLE Ninety-nine de novo assembled genomes from the moose (Alces alces) rumen microbiome provide new insights into microbial plant biomass degradation Olov Svartström1, Johannes Alneberg2, Nicolas Terrapon3,4, Vincent Lombard3,4, Ino de Bruijn2, Jonas Malmsten5,6, Ann-Marie Dalin6, Emilie EL Muller7, Pranjul Shah7, Paul Wilmes7, Bernard Henrissat3,4,8, Henrik Aspeborg1 and Anders F Andersson2 1School of Biotechnology, Division of Industrial Biotechnology, KTH Royal Institute of Technology, Stockholm, Sweden; 2School of Biotechnology, Division of Gene Technology, KTH Royal Institute of Technology, Science for Life Laboratory, Stockholm, Sweden; 3CNRS UMR 7257, Aix-Marseille University, 13288 Marseille, France; 4INRA, USC 1408 AFMB, 13288 Marseille, France; 5Department of Pathology and Wildlife Diseases, National Veterinary Institute, Uppsala, Sweden; 6Division of Reproduction, Department of Clinical Sciences, Swedish University of Agricultural Sciences, Uppsala, Sweden; 7Luxembourg Centre for Systems Biomedicine, University of Luxembourg, Esch-sur-Alzette, Luxembourg and 8Department of Biological Sciences, King Abdulaziz University, Jeddah, Saudi Arabia The moose (Alces alces) is a ruminant that harvests energy from fiber-rich lignocellulose material through carbohydrate-active enzymes (CAZymes) produced by its rumen microbes. We applied shotgun metagenomics to rumen contents from six moose to obtain insights into this microbiome. Following binning, 99 metagenome-assembled genomes (MAGs) belonging to 11 prokaryotic phyla were reconstructed and characterized based on phylogeny and CAZyme profile. The taxonomy of these MAGs reflected the overall composition of the metagenome, with dominance of the phyla Bacteroidetes and Firmicutes.
  • Detection of a Bacterial Group Within the Phylum Chloroflexi And

    Detection of a Bacterial Group Within the Phylum Chloroflexi And

    Microbes Environ. Vol. 21, No. 3, 154–162, 2006 http://wwwsoc.nii.ac.jp/jsme2/ Detection of a Bacterial Group within the Phylum Chloroflexi and Reductive-Dehalogenase-Homologous Genes in Pentachlorobenzene- Dechlorinating Estuarine Sediment from the Arakawa River, Japan KYOSUKE SANTOH1, ATSUSHI KOUZUMA1, RYOKO ISHIZEKI2, KENICHI IWATA1, MINORU SHIMURA3, TOSHIO HAYAKAWA3, TOSHIHIRO HOAKI4, HIDEAKI NOJIRI1, TOSHIO OMORI2, HISAKAZU YAMANE1 and HIROSHI HABE1*† 1 Biotechnology Research Center, The University of Tokyo, 1–1–1 Yayoi, Bunkyo-ku, Tokyo 113–8657, Japan 2 Department of Industrial Chemistry, Faculty of Engineering, Shibaura Institute of Technology, Minato-ku, Tokyo 108–8548, Japan 3 Environmental Biotechnology Laboratory, Railway Technical Research Institute, 2–8–38 Hikari-cho, Kokubunji-shi, Tokyo 185–8540, Japan 4 Technology Research Center, Taisei Corporation, 344–1 Nase, Totsuka-ku, Yokohama 245–0051, Japan (Received April 21, 2006—Accepted June 12, 2006) We enriched a pentachlorobenzene (pentaCB)-dechlorinating microbial consortium from an estuarine-sedi- ment sample obtained from the mouth of the Arakawa River. The sediment was incubated together with a mix- ture of four electron donors and pentaCB, and after five months of incubation, the microbial community structure was analyzed. Both DGGE and clone library analyses showed that the most expansive phylogenetic group within the consortium was affiliated with the phylum Chloroflexi, which includes Dehalococcoides-like bacteria. PCR using a degenerate primer set targeting conserved regions in reductive-dehalogenase-homologous (rdh) genes from Dehalococcoides species revealed that DNA fragments (approximately 1.5–1.7 kb) of rdh genes were am- plified from genomic DNA of the consortium. The deduced amino acid sequences of the rdh genes shared sever- al characteristics of reductive dehalogenases.
  • Distribution and Diversity of Members of the Bacterial Phylum Fibrobacteres in Environments Where Cellulose Degradation Occurs

    Distribution and Diversity of Members of the Bacterial Phylum Fibrobacteres in Environments Where Cellulose Degradation Occurs

    Aberystwyth University Distribution and diversity of members of the bacterial phylum Fibrobacteres in environments where cellulose degradation occurs. Ransom-Jones, Emma; Jones, Davey L.; Edwards, Arwyn; McDonald, J. E. Published in: Systematic and Applied Microbiology DOI: 10.1016/j.syapm.2014.06.001 Publication date: 2014 Citation for published version (APA): Ransom-Jones, E., Jones, D. L., Edwards, A., & McDonald, J. E. (2014). Distribution and diversity of members of the bacterial phylum Fibrobacteres in environments where cellulose degradation occurs. Systematic and Applied Microbiology, 37(7), 502-509. https://doi.org/10.1016/j.syapm.2014.06.001 General rights Copyright and moral rights for the publications made accessible in the Aberystwyth Research Portal (the Institutional Repository) are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from the Aberystwyth Research Portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain • You may freely distribute the URL identifying the publication in the Aberystwyth Research Portal Take down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim. tel: +44 1970 62 2400 email: [email protected] Download date: 28. Sep. 2021 G Model SYAPM-25635; No. of Pages 8 ARTICLE IN PRESS Systematic and Applied Microbiology xxx (2014) xxx–xxx Contents lists available at ScienceDirect Systematic and Applied Microbiology j ournal homepage: www.elsevier.de/syapm Distribution and diversity of members of the bacterial phylum Fibrobacteres in environments where cellulose degradation occurs a b c a, Emma Ransom-Jones , David L.
  • Expanding the Chlamydiae Tree

    Expanding the Chlamydiae Tree

    Digital Comprehensive Summaries of Uppsala Dissertations from the Faculty of Science and Technology 2040 Expanding the Chlamydiae tree Insights into genome diversity and evolution JENNAH E. DHARAMSHI ACTA UNIVERSITATIS UPSALIENSIS ISSN 1651-6214 ISBN 978-91-513-1203-3 UPPSALA urn:nbn:se:uu:diva-439996 2021 Dissertation presented at Uppsala University to be publicly examined in A1:111a, Biomedical Centre (BMC), Husargatan 3, Uppsala, Tuesday, 8 June 2021 at 13:15 for the degree of Doctor of Philosophy. The examination will be conducted in English. Faculty examiner: Prof. Dr. Alexander Probst (Faculty of Chemistry, University of Duisburg-Essen). Abstract Dharamshi, J. E. 2021. Expanding the Chlamydiae tree. Insights into genome diversity and evolution. Digital Comprehensive Summaries of Uppsala Dissertations from the Faculty of Science and Technology 2040. 87 pp. Uppsala: Acta Universitatis Upsaliensis. ISBN 978-91-513-1203-3. Chlamydiae is a phylum of obligate intracellular bacteria. They have a conserved lifecycle and infect eukaryotic hosts, ranging from animals to amoeba. Chlamydiae includes pathogens, and is well-studied from a medical perspective. However, the vast majority of chlamydiae diversity exists in environmental samples as part of the uncultivated microbial majority. Exploration of microbial diversity in anoxic deep marine sediments revealed diverse chlamydiae with high relative abundances. Using genome-resolved metagenomics various marine sediment chlamydiae genomes were obtained, which significantly expanded genomic sampling of Chlamydiae diversity. These genomes formed several new clades in phylogenomic analyses, and included Chlamydiaceae relatives. Despite endosymbiosis-associated genomic features, hosts were not identified, suggesting chlamydiae with alternate lifestyles. Genomic investigation of Anoxychlamydiales, newly described here, uncovered genes for hydrogen metabolism and anaerobiosis, suggesting they engage in syntrophic interactions.
  • Cone-Forming Chloroflexi Mats As Analogs of Conical

    Cone-Forming Chloroflexi Mats As Analogs of Conical

    268 Appendix 2 CONE-FORMING CHLOROFLEXI MATS AS ANALOGS OF CONICAL STROMATOLITE FORMATION WITHOUT CYANOBACTERIA Lewis M. Ward, Woodward W. Fischer, Katsumi Matsuura, and Shawn E. McGlynn. In preparation. Abstract Modern microbial mats provide useful process analogs for understanding the mechanics behind the production of ancient stromatolites. However, studies to date have focused on mats composed predominantly of oxygenic Cyanobacteria (Oxyphotobacteria) and algae, which makes it difficult to assess a unique role of oxygenic photosynthesis in stromatolite morphogenesis, versus different mechanics such as phototaxis and filamentous growth. Here, we characterize Chloroflexi-rich hot spring microbial mats from Nakabusa Onsen, Nagano Prefecture, Japan. This spring supports cone-forming microbial mats in both upstream high-temperature, sulfidic regions dominated by filamentous anoxygenic phototrophic Chloroflexi, as well as downstream Cyanobacteria-dominated mats. These mats produce similar morphologies analogous to conical stromatolites despite metabolically and taxonomically divergent microbial communities as revealed by 16S and shotgun metagenomic sequencing and microscopy. These data illustrate that anoxygenic filamentous microorganisms appear to be capable of producing similar mat morphologies as those seen in Oxyphotobacteria-dominated systems and commonly associated with 269 conical Precambrian stromatolites, and that the processes leading to the development of these features is more closely related with characteristics such as hydrology and cell morphology and motility. Introduction Stromatolites are “attached, lithified sedimentary growth structures, accretionary away from a point or limited surface of initiation” (Grotzinger and Knoll 1999). Behind this description lies a wealth of sedimentary structures with a record dating back over 3.7 billion years that may be one of the earliest indicators of life on Earth (Awramik 1992, Nutman et al.
  • Global Metagenomic Survey Reveals a New Bacterial Candidate Phylum in Geothermal Springs

    Global Metagenomic Survey Reveals a New Bacterial Candidate Phylum in Geothermal Springs

    ARTICLE Received 13 Aug 2015 | Accepted 7 Dec 2015 | Published 27 Jan 2016 DOI: 10.1038/ncomms10476 OPEN Global metagenomic survey reveals a new bacterial candidate phylum in geothermal springs Emiley A. Eloe-Fadrosh1, David Paez-Espino1, Jessica Jarett1, Peter F. Dunfield2, Brian P. Hedlund3, Anne E. Dekas4, Stephen E. Grasby5, Allyson L. Brady6, Hailiang Dong7, Brandon R. Briggs8, Wen-Jun Li9, Danielle Goudeau1, Rex Malmstrom1, Amrita Pati1, Jennifer Pett-Ridge4, Edward M. Rubin1,10, Tanja Woyke1, Nikos C. Kyrpides1 & Natalia N. Ivanova1 Analysis of the increasing wealth of metagenomic data collected from diverse environments can lead to the discovery of novel branches on the tree of life. Here we analyse 5.2 Tb of metagenomic data collected globally to discover a novel bacterial phylum (‘Candidatus Kryptonia’) found exclusively in high-temperature pH-neutral geothermal springs. This lineage had remained hidden as a taxonomic ‘blind spot’ because of mismatches in the primers commonly used for ribosomal gene surveys. Genome reconstruction from metagenomic data combined with single-cell genomics results in several high-quality genomes representing four genera from the new phylum. Metabolic reconstruction indicates a heterotrophic lifestyle with conspicuous nutritional deficiencies, suggesting the need for metabolic complementarity with other microbes. Co-occurrence patterns identifies a number of putative partners, including an uncultured Armatimonadetes lineage. The discovery of Kryptonia within previously studied geothermal springs underscores the importance of globally sampled metagenomic data in detection of microbial novelty, and highlights the extraordinary diversity of microbial life still awaiting discovery. 1 Department of Energy Joint Genome Institute, Walnut Creek, California 94598, USA. 2 Department of Biological Sciences, University of Calgary, Calgary, Alberta T2N 1N4, Canada.
  • Metaproteomics Reveals Differential Modes of Metabolic Coupling Among Ubiquitous Oxygen Minimum Zone Microbes

    Metaproteomics Reveals Differential Modes of Metabolic Coupling Among Ubiquitous Oxygen Minimum Zone Microbes

    Metaproteomics reveals differential modes of metabolic coupling among ubiquitous oxygen minimum zone microbes Alyse K. Hawleya, Heather M. Brewerb, Angela D. Norbeckb, Ljiljana Paša-Tolicb, and Steven J. Hallama,c,d,1 aDepartment of Microbiology and Immunology, cGraduate Program in Bioinformatics, and dGenome Sciences and Technology Training Program, University of British Columbia, Vancouver, BC, Canada V6T 1Z3; and bBiological and Computational Sciences Division, Pacific Northwest National Laboratory, Richland, WA 99352 Edited by Edward F. DeLong, Massachusetts Institute of Technology, Cambridge, MA, and approved June 10, 2014 (received for review November 26, 2013) Marine oxygen minimum zones (OMZs) are intrinsic water column transformations in nonsulfidic OMZs, providing evidence for features arising from respiratory oxygen demand during organic a cryptic sulfur cycle with the potential to drive inorganic carbon matter degradation in stratified waters. Currently OMZs are expand- fixation processes (13). Indeed, many of the key microbial players ing due to global climate change with resulting feedback on marine implicated in nitrogen and sulfur transformations in OMZs, in- ecosystem function. Here we use metaproteomics to chart spatial cluding Thaumarchaeota, Nitrospina, Nitrospira, Planctomycetes, and temporal patterns of gene expression along defined redox and SUP05/ARCTIC96BD-19 Gammaproteobacteria have the gradients in a seasonally stratified fjord to better understand metabolic potential for inorganic carbon fixation (14–19), and
  • Genomic Analysis of Family UBA6911 (Group 18 Acidobacteria)

    Genomic Analysis of Family UBA6911 (Group 18 Acidobacteria)

    bioRxiv preprint doi: https://doi.org/10.1101/2021.04.09.439258; this version posted April 10, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 2 Genomic analysis of family UBA6911 (Group 18 3 Acidobacteria) expands the metabolic capacities of the 4 phylum and highlights adaptations to terrestrial habitats. 5 6 Archana Yadav1, Jenna C. Borrelli1, Mostafa S. Elshahed1, and Noha H. Youssef1* 7 8 1Department of Microbiology and Molecular Genetics, Oklahoma State University, Stillwater, 9 OK 10 *Correspondence: Noha H. Youssef: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2021.04.09.439258; this version posted April 10, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 11 Abstract 12 Approaches for recovering and analyzing genomes belonging to novel, hitherto unexplored 13 bacterial lineages have provided invaluable insights into the metabolic capabilities and 14 ecological roles of yet-uncultured taxa. The phylum Acidobacteria is one of the most prevalent 15 and ecologically successful lineages on earth yet, currently, multiple lineages within this phylum 16 remain unexplored. Here, we utilize genomes recovered from Zodletone spring, an anaerobic 17 sulfide and sulfur-rich spring in southwestern Oklahoma, as well as from multiple disparate soil 18 and non-soil habitats, to examine the metabolic capabilities and ecological role of members of 19 the family UBA6911 (group18) Acidobacteria.
  • Table S4. Phylogenetic Distribution of Bacterial and Archaea Genomes in Groups A, B, C, D, and X

    Table S4. Phylogenetic Distribution of Bacterial and Archaea Genomes in Groups A, B, C, D, and X

    Table S4. Phylogenetic distribution of bacterial and archaea genomes in groups A, B, C, D, and X. Group A a: Total number of genomes in the taxon b: Number of group A genomes in the taxon c: Percentage of group A genomes in the taxon a b c cellular organisms 5007 2974 59.4 |__ Bacteria 4769 2935 61.5 | |__ Proteobacteria 1854 1570 84.7 | | |__ Gammaproteobacteria 711 631 88.7 | | | |__ Enterobacterales 112 97 86.6 | | | | |__ Enterobacteriaceae 41 32 78.0 | | | | | |__ unclassified Enterobacteriaceae 13 7 53.8 | | | | |__ Erwiniaceae 30 28 93.3 | | | | | |__ Erwinia 10 10 100.0 | | | | | |__ Buchnera 8 8 100.0 | | | | | | |__ Buchnera aphidicola 8 8 100.0 | | | | | |__ Pantoea 8 8 100.0 | | | | |__ Yersiniaceae 14 14 100.0 | | | | | |__ Serratia 8 8 100.0 | | | | |__ Morganellaceae 13 10 76.9 | | | | |__ Pectobacteriaceae 8 8 100.0 | | | |__ Alteromonadales 94 94 100.0 | | | | |__ Alteromonadaceae 34 34 100.0 | | | | | |__ Marinobacter 12 12 100.0 | | | | |__ Shewanellaceae 17 17 100.0 | | | | | |__ Shewanella 17 17 100.0 | | | | |__ Pseudoalteromonadaceae 16 16 100.0 | | | | | |__ Pseudoalteromonas 15 15 100.0 | | | | |__ Idiomarinaceae 9 9 100.0 | | | | | |__ Idiomarina 9 9 100.0 | | | | |__ Colwelliaceae 6 6 100.0 | | | |__ Pseudomonadales 81 81 100.0 | | | | |__ Moraxellaceae 41 41 100.0 | | | | | |__ Acinetobacter 25 25 100.0 | | | | | |__ Psychrobacter 8 8 100.0 | | | | | |__ Moraxella 6 6 100.0 | | | | |__ Pseudomonadaceae 40 40 100.0 | | | | | |__ Pseudomonas 38 38 100.0 | | | |__ Oceanospirillales 73 72 98.6 | | | | |__ Oceanospirillaceae