ENSA Monoclonal Antibody (M02), Clone 1H7

Total Page：16

File Type：pdf, Size：1020Kb

ENSA monoclonal antibody (M02), clone 1H7 Catalog # : H00002029-M02 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a full length recombinant Western Blot (Cell lysate) Description: ENSA. Immunogen: ENSA (AAH00436, 1 a.a. ~ 121 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MSQKQEEENPAEETGEEKQDTQEKEGILPERAEEAKLKAKYPSLGQKP GGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGD enlarge HIPTPQDLPQRKSSLVTSKLAGGQVE Western Blot (Recombinant protein) Host: Mouse Sandwich ELISA (Recombinant Reactivity: Human protein) Isotype: IgG2b Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge ELISA Western Blot detection against Immunogen (39.05 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Cell lysate) Page 1 of 3 2016/5/20 ENSA monoclonal antibody (M02), clone 1H7 Western Blot analysis of ENSA expression in K-562 ( Cat # L009V1 ). Protocol Download Western Blot (Recombinant protein) Protocol Download Sandwich ELISA (Recombinant protein) Detection limit for recombinant GST tagged ENSA is approximately 0.1ng/ml as a capture antibody. Protocol Download ELISA Gene Information Entrez GeneID: 2029 GeneBank BC000436 Accession#: Protein AAH00436 Accession#: Gene Name: ENSA Gene Alias: MGC4319,MGC78563,MGC8394 Gene endosulfine alpha Description: Omim ID: 603061 Gene Ontology: Hyperlink Gene Summary: The protein encoded by this gene belongs to a highly conserved cAMP- regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP Page 2 of 3 2016/5/20 channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq Other OTTHUMP00000032931,OTTHUMP00000032932,OTTHUMP00000034 Designations: 001,OTTHUMP00000034003,OTTHUMP00000034004,OTTHUMP00000 034005,OTTHUMP00000034006 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 3 of 3 2016/5/20.

Copy Link

Recommended publications

Alternating Hypoglycemia and Hyperglycemia in a Toddler with a Homozygous P.R1419H ABCC8 Mutation: an Unusual Clinical Picture
J Pediatr Endocr Met 2015; 28(3-4): 345–351 Patient report Open Access Shira Harel, Ana S.A. Cohen, Khalid Hussain, Sarah E. Flanagan, Kamilla Schlade-Bartusiak, Millan Patel, Jaques Courtade, Jenny B.W. Li, Clara Van Karnebeek, Harley Kurata, Sian Ellard, Jean-Pierre Chanoine and William T. Gibson* Alternating hypoglycemia and hyperglycemia in a toddler with a homozygous p.R1419H ABCC8 mutation: an unusual clinical picture Abstract Results: A 16-month-old girl of consanguineous descent manifested hypoglycemia. She had dysregulation of Background: Inheritance of two pathogenic ABCC8 alleles insulin secretion, with postprandial hyperglycemia fol- typically causes severe congenital hyperinsulinism. We lowed by hypoglycemia. Microarray revealed homozygo- describe a girl and her father, both homozygous for the sity for the regions encompassing KCNJ11 and ABCC8. Her same ABCC8 mutation, who presented with unusual father had developed diabetes at 28 years of age. Sequenc- phenotypes. ing of ABCC8 identified a homozygous missense mutation, Methods: Single nucleotide polymorphism microarray p.R1419H, in both individuals. Functional studies showed and Sanger sequencing were performed. Western blot, absence of working KATP channels. rubidium efflux, and patch clamp recordings interrogated Conclusion: This is the first description of a homozygous the expression and activity of the mutant protein. p.R1419H mutation. Our findings highlight that homozy- gous loss-of-function mutations of ABCC8 do not neces- sarily translate into early-onset severe hyperinsulinemia. *Corresponding author: William T. Gibson, Child and Family Research Institute, Department of Medical Genetics, British Keywords: ABCC8; diabetes; hyperglycemia; hyperinsu- Columbia Children’s Hospital, 950 West 28th Avenue, Vancouver, linism; hypoglycemia. BC, V5Z 4H4, Canada, Phone: +1-604-875-2000 ext.
[Show full text]
Genome-Wide Identification, Characterization and Phylogenetic Analysis of ATP-Binding Cassette (ABC) Transporter Genes in Common Carp (Cyprinus Carpio)
RESEARCH ARTICLE Genome-Wide Identification, Characterization and Phylogenetic Analysis of ATP-Binding Cassette (ABC) Transporter Genes in Common Carp (Cyprinus carpio) Xiang Liu1,2☯, Shangqi Li1☯, Wenzhu Peng1, Shuaisheng Feng1, Jianxin Feng3, Shahid Mahboob4,5, Khalid A. Al-Ghanim4, Peng Xu1,6* 1 CAFS Key Laboratory of Aquatic Genomics and Beijing Key Laboratory of Fishery Biotechnology, Centre for Applied Aquatic Genomics, Chinese Academy of Fishery Sciences, Beijing, China, 2 Department of Aquaculture, College of Animal Sciences, Shanxi Agriculture University, Taigu, Shanxi, China, 3 Henan Academy of Fishery Sciences, Zhengzhou, China, 4 Department of Zoology, College of Science, King Saud University, Riyadh, Saudi Arabia, 5 Department of Zoology, GC University, Faisalabad, Pakistan, 6 College of Ocean & Earth Science, Xiamen University, Xiamen, China ☯ These authors contributed equally to this work. * [email protected] OPEN ACCESS Citation: Liu X, Li S, Peng W, Feng S, Feng J, Mahboob S, et al. (2016) Genome-Wide Identification, Characterization and Phylogenetic Abstract Analysis of ATP-Binding Cassette (ABC) Transporter Genes in Common Carp (Cyprinus carpio). PLoS The ATP-binding cassette (ABC) gene family is considered to be one of the largest gene ONE 11(4): e0153246. doi:10.1371/journal. families in all forms of prokaryotic and eukaryotic life. Although the ABC transporter genes pone.0153246 have been annotated in some species, detailed information about the ABC superfamily and Editor: Anthony M. George, University of Technology the evolutionary characterization of ABC genes in common carp (Cyprinus carpio) are still Sydney, AUSTRALIA unclear. In this research, we identified 61 ABC transporter genes in the common carp Received: January 12, 2016 genome.
[Show full text]
Transcriptional and Post-Transcriptional Regulation of ATP-Binding Cassette Transporter Expression
Transcriptional and Post-transcriptional Regulation of ATP-binding Cassette Transporter Expression by Aparna Chhibber DISSERTATION Submitted in partial satisfaction of the requirements for the degree of DOCTOR OF PHILOSOPHY in Pharmaceutical Sciences and Pbarmacogenomies in the Copyright 2014 by Aparna Chhibber ii Acknowledgements First and foremost, I would like to thank my advisor, Dr. Deanna Kroetz. More than just a research advisor, Deanna has clearly made it a priority to guide her students to become better scientists, and I am grateful for the countless hours she has spent editing papers, developing presentations, discussing research, and so much more. I would not have made it this far without her support and guidance. My thesis committee has provided valuable advice through the years. Dr. Nadav Ahituv in particular has been a source of support from my first year in the graduate program as my academic advisor, qualifying exam committee chair, and finally thesis committee member. Dr. Kathy Giacomini graciously stepped in as a member of my thesis committee in my 3rd year, and Dr. Steven Brenner provided valuable input as thesis committee member in my 2nd year. My labmates over the past five years have been incredible colleagues and friends. Dr. Svetlana Markova first welcomed me into the lab and taught me numerous laboratory techniques, and has always been willing to act as a sounding board. Michael Martin has been my partner-in-crime in the lab from the beginning, and has made my days in lab fly by. Dr. Yingmei Lui has made the lab run smoothly, and has always been willing to jump in to help me at a moment’s notice.
[Show full text]
CFTR Modulators: Shedding Light on Precision Medicine for Cystic Fibrosis
fphar-07-00275 September 1, 2016 Time: 16:39 # 1 REVIEW published: 05 September 2016 doi: 10.3389/fphar.2016.00275 CFTR Modulators: Shedding Light on Precision Medicine for Cystic Fibrosis Miquéias Lopes-Pacheco* Institute of Biophysics Carlos Chagas Filho, Federal University of Rio de Janeiro, Rio de Janeiro, Brazil Cystic fibrosis (CF) is the most common life-threatening monogenic disease afflicting Caucasian people. It affects the respiratory, gastrointestinal, glandular and reproductive systems. The major cause of morbidity and mortality in CF is the respiratory disorder caused by a vicious cycle of obstruction of the airways, inflammation and infection that leads to epithelial damage, tissue remodeling and end-stage lung disease. Over the past decades, life expectancy of CF patients has increased due to early diagnosis and improved treatments; however, these patients still present limited quality of life. Many attempts have been made to rescue CF transmembrane conductance regulator (CFTR) expression, function and stability, thereby overcoming the molecular basis of CF. Edited by: Gene and protein variances caused by CFTR mutants lead to different CF phenotypes, Frederic Becq, University of Poitiers, France which then require different treatments to quell the patients’ debilitating symptoms. In Reviewed by: order to seek better approaches to treat CF patients and maximize therapeutic effects, Valerie Chappe, CFTR mutants have been stratified into six groups (although several of these mutations Dalhousie University, Canada Paola Vergani, present pleiotropic defects). The research with CFTR modulators (read-through agents, University College London, UK correctors, potentiators, stabilizers and amplifiers) has achieved remarkable progress, *Correspondence: and these drugs are translating into pharmaceuticals and personalized treatments for Miquéias Lopes-Pacheco CF patients.
[Show full text]
Interindividual Differences in the Expression of ATP-Binding
Supplemental material to this article can be found at: http://dmd.aspetjournals.org/content/suppl/2018/02/02/dmd.117.079061.DC1 1521-009X/46/5/628–635$35.00 https://doi.org/10.1124/dmd.117.079061 DRUG METABOLISM AND DISPOSITION Drug Metab Dispos 46:628–635, May 2018 Copyright ª 2018 by The American Society for Pharmacology and Experimental Therapeutics Special Section on Transporters in Drug Disposition and Pharmacokinetic Prediction Interindividual Differences in the Expression of ATP-Binding Cassette and Solute Carrier Family Transporters in Human Skin: DNA Methylation Regulates Transcriptional Activity of the Human ABCC3 Gene s Tomoki Takechi, Takeshi Hirota, Tatsuya Sakai, Natsumi Maeda, Daisuke Kobayashi, and Ichiro Ieiri Downloaded from Department of Clinical Pharmacokinetics, Graduate School of Pharmaceutical Sciences, Kyushu University, Fukuoka, Japan (T.T., T.H., T.S., N.M., I.I.); Drug Development Research Laboratories, Kyoto R&D Center, Maruho Co., Ltd., Kyoto, Japan (T.T.); and Department of Clinical Pharmacy and Pharmaceutical Care, Graduate School of Pharmaceutical Sciences, Kyushu University, Fukuoka, Japan (D.K.) Received October 19, 2017; accepted January 30, 2018 dmd.aspetjournals.org ABSTRACT The identification of drug transporters expressed in human skin and levels. ABCC3 expression levels negatively correlated with the methylation interindividual differences in gene expression is important for understanding status of the CpG island (CGI) located approximately 10 kilobase pairs the role of drug transporters in human skin. In the present study, we upstream of ABCC3 (Rs: 20.323, P < 0.05). The reporter gene assay revealed evaluated the expression of ATP-binding cassette (ABC) and solute carrier a significant increase in transcriptional activity in the presence of CGI.
[Show full text]
Whole-Exome Sequencing Identifies Novel Mutations in ABC Transporter
Liu et al. BMC Pregnancy and Childbirth (2021) 21:110 https://doi.org/10.1186/s12884-021-03595-x RESEARCH ARTICLE Open Access Whole-exome sequencing identifies novel mutations in ABC transporter genes associated with intrahepatic cholestasis of pregnancy disease: a case-control study Xianxian Liu1,2†, Hua Lai1,3†, Siming Xin1,3, Zengming Li1, Xiaoming Zeng1,3, Liju Nie1,3, Zhengyi Liang1,3, Meiling Wu1,3, Jiusheng Zheng1,3* and Yang Zou1,2* Abstract Background: Intrahepatic cholestasis of pregnancy (ICP) can cause premature delivery and stillbirth. Previous studies have reported that mutations in ABC transporter genes strongly influence the transport of bile salts. However, to date, their effects are still largely elusive. Methods: A whole-exome sequencing (WES) approach was used to detect novel variants. Rare novel exonic variants (minor allele frequencies: MAF < 1%) were analyzed. Three web-available tools, namely, SIFT, Mutation Taster and FATHMM, were used to predict protein damage. Protein structure modeling and comparisons between reference and modified protein structures were performed by SWISS-MODEL and Chimera 1.14rc, respectively. Results: We detected a total of 2953 mutations in 44 ABC family transporter genes. When the MAF of loci was controlled in all databases at less than 0.01, 320 mutations were reserved for further analysis. Among these mutations, 42 were novel. We classified these loci into four groups (the damaging, probably damaging, possibly damaging, and neutral groups) according to the prediction results, of which 7 novel possible pathogenic mutations were identified that were located in known functional genes, including ABCB4 (Trp708Ter, Gly527Glu and Lys386Glu), ABCB11 (Gln1194Ter, Gln605Pro and Leu589Met) and ABCC2 (Ser1342Tyr), in the damaging group.
[Show full text]
1. Introduction
PROTEIN INTERACTIONS AND DISEASE PHENOTYPES IN THE ABC TRANSPORTER SUPERFAMILY LIBUSHA KELLY1,2,3,!, RACHEL KARCHIN2, 3 AND ANDREJ SALI2, 3 1Program in Biological and Medical Informatics, 2Departments of Biopharmaceutical Sciences and Pharmaceutical Chemistry, and 3California Institute for Quantitative Biomedical Research, University of California at San Francisco QB3 at Mission Bay, Office 503B, 1700 4th Street, San Francisco, CA 94158, USA. ABC transporter proteins couple the energy of ATP binding and hydrolysis to substrate transport across a membrane. In humans, clinical studies have implicated mutations in 19 of the 48 known ABC transporters in diseases such as cystic fibrosis and adrenoleukodystrophy. Although divergent in sequence space, the overall topology of these proteins, consisting of two transmembrane domains and two ATP-binding cassettes, is likely to be conserved across diverse organisms. We examine known intra-transporter domain interfaces using crystallographic structures of isolated and complexed domains in ABC transporter proteins and find that the nucleotide binding domain interfaces are better conserved than interfaces at the transmembrane domains. We then apply this analysis to identify known disease-associated point and deletion mutants for which disruption of domain-domain interfaces might indicate the mechanism of disease. Finally, we suggest a possible interaction site based on conservation of sequence and disease-association of point mutants. 1. Introduction ATP-binding cassette (ABC) transporters are membrane-spanning proteins that transport a wide variety of small molecule substrates and ions across cell membranes. Examples include the multidrug transporter P-gp, associated with drug resistance phenotypes in cancer therapy [1], and the cystic fibrosis transmembrane conductance regulator (CFTR) that transports chloride ions [2].
[Show full text]
Mosaic Paternal Uniparental Isodisomy and an ABCC8 Gene Mutation in a Patient with Permanent Neonatal Diabetes and Hemihypertrophy Julian P.H
ORIGINAL ARTICLE Mosaic Paternal Uniparental Isodisomy and an ABCC8 Gene Mutation in a Patient With Permanent Neonatal Diabetes and Hemihypertrophy Julian P.H. Shield,1 Sarah E. Flanagan,2 Deborah J. Mackay,3,4 Lorna W. Harries,2 Peter Proks,5 Christophe Girard,5 Frances M. Ashcroft,5 I. Karen Temple,3,4 and Sian Ellard2 OBJECTIVE—Activating mutations in the KCNJ11 and ABCC8 developments have highlighted the importance of ion genes encoding the Kir6.2 and SUR1 subunits of the pancreatic channel mutations (“channelopathies”) in the etiology ATP-sensitive Kϩ channel are the most common cause of perma- of both permanent and transient forms of this condition nent neonatal diabetes. In contrast to KCNJ11, where only (3–5). The pancreatic ␤-cell ATP-sensitive Kϩ channel dominant heterozygous mutations have been identiﬁed, reces- (KATP channel) is composed of four inward rectifying sively acting ABCC8 mutations have recently been found in some Kϩ channel (Kir6.2) subunits, encoded by the gene patients with neonatal diabetes. These genes are co-located on chromosome 11p15.1, centromeric to the imprinted Beckwith- KCNJ11, and four sulfonylurea receptor (SUR1) sub- Wiedemann syndrome (BWS) locus at 11p15.5. We investigated a units encoded by ABCC8. Its role is to control insulin male with hemihypertrophy, a condition classically associated release in response to glucose metabolism within the with neonatal hyperinsulinemia and hypoglycemia, who devel- ␤-cell, through alterations in adenine nucleotide avail- oped neonatal diabetes at age 5 weeks. ability and binding (6). Inactivating mutations in either KCNJ11 or ABCC8 cause persistent hyperinsulinemic RESEARCH DESIGN AND METHODS—The KCNJ11 and ABCC8 genes and microsatellite markers on chromosome 11 hypoglycemia of infancy (7,8).
[Show full text]
Whole Exome Sequencing Analysis of ABCC8 and ABCD2 Genes Associating with Clinical Course of Breast Carcinoma
Physiol. Res. 64 (Suppl. 4): S549-S557, 2015 Whole Exome Sequencing Analysis of ABCC8 and ABCD2 Genes Associating With Clinical Course of Breast Carcinoma P. SOUCEK1,2, V. HLAVAC1,2,3, K. ELSNEROVA1,2,3, R. VACLAVIKOVA2, R. KOZEVNIKOVOVA4, K. RAUS5 1Biomedical Center, Faculty of Medicine in Pilsen, Charles University in Prague, Pilsen, Czech Republic, 2Toxicogenomics Unit, National Institute of Public Health, Prague, Czech Republic, 3Third Faculty of Medicine, Charles University in Prague, Prague, Czech Republic, 4Department of Oncosurgery, Medicon, Prague, Czech Republic, 5Institute for the Care for Mother and Child, Prague, Czech Republic Received September 17, 2015 Accepted October 2, 2015 Summary Charles University in Prague, Alej Svobody 76, 323 00 Pilsen, The aim of the present study was to introduce methods for Czech Republic. E-mail: [email protected] exome sequencing of two ATP-binding cassette (ABC) transporters ABCC8 and ABCD2 recently suggested to play Introduction a putative role in breast cancer progression and prognosis of patients. We performed next generation sequencing targeted at Breast cancer is the most common cancer in analysis of all exons in ABCC8 and ABCD2 genes and surrounding women and caused 471,000 deaths worldwide in 2013 noncoding sequences in blood DNA samples from 24 patients (Global Burden of Disease Cancer Collaboration 2015). with breast cancer. The revealed alterations were characterized A number of cellular processes that in some cases lead to the by in silico tools. We then compared the most frequent tumor resistance limits efficacy of breast cancer therapy. functionally relevant polymorphism rs757110 in ABCC8 with Multidrug resistance (MDR) to a variety of chemotherapy clinical data of patients.
[Show full text]
Role of Genetic Variation in ABC Transporters in Breast Cancer Prognosis and Therapy Response
International Journal of Molecular Sciences Article Role of Genetic Variation in ABC Transporters in Breast Cancer Prognosis and Therapy Response Viktor Hlaváˇc 1,2 , Radka Václavíková 1,2, Veronika Brynychová 1,2, Renata Koževnikovová 3, Katerina Kopeˇcková 4, David Vrána 5 , Jiˇrí Gatˇek 6 and Pavel Souˇcek 1,2,* 1 Toxicogenomics Unit, National Institute of Public Health, 100 42 Prague, Czech Republic; [email protected] (V.H.); [email protected] (R.V.); [email protected] (V.B.) 2 Biomedical Center, Faculty of Medicine in Pilsen, Charles University, 323 00 Pilsen, Czech Republic 3 Department of Oncosurgery, Medicon Services, 140 00 Prague, Czech Republic; [email protected] 4 Department of Oncology, Second Faculty of Medicine, Charles University and Motol University Hospital, 150 06 Prague, Czech Republic; [email protected] 5 Department of Oncology, Medical School and Teaching Hospital, Palacky University, 779 00 Olomouc, Czech Republic; [email protected] 6 Department of Surgery, EUC Hospital and University of Tomas Bata in Zlin, 760 01 Zlin, Czech Republic; [email protected] * Correspondence: [email protected]; Tel.: +420-267-082-711 Received: 19 November 2020; Accepted: 11 December 2020; Published: 15 December 2020 Abstract: Breast cancer is the most common cancer in women in the world. The role of germline genetic variability in ATP-binding cassette (ABC) transporters in cancer chemoresistance and prognosis still needs to be elucidated. We used next-generation sequencing to assess associations of germline variants in coding and regulatory sequences of all human ABC genes with response of the patients to the neoadjuvant cytotoxic chemotherapy and disease-free survival (n = 105).
[Show full text]
Family Member Testing
Patient: DoB: 1 / 3 Family Member Testing REFERRING HEALTHCARE PROFESSIONAL NAME HOSPITAL PATIENT NAME DOB AGE GENDER ORDER ID 36 Female PRIMARY SAMPLE TYPE SAMPLE COLLECTION DATE CUSTOMER SAMPLE ID DNA FMT TEST INFO FAMILY MEMBER TEST INDEX ORDER ID 2 mutations TEST RESULT A heterozygous ABCC8 c.4478G>T, p.(Arg1493Leu) -variant was detected in this individual. ABCC8 c.689A>G, p.(Tyr230Cys) -variant was not detected in this individual. Genetic counselling is recommended. Blueprint Genetics Oy, Tukholmankatu 8, Biomedicum 2U, 00290 Helsinki, Finland 1 / 3 VAT number: FI22307900, CLIA ID Number: 99D2092375, CAP Number: 9257331 Patient: DoB: 2 / 3 STATEMENT DESCRIPTION This individual is a 36-year-old sister of index patient. She has symptoms consistent to hypoglycemia. Previous genetic testing has identified ABCC8 c.4478G>T, p. (Arg1493Leu) and ABCC8 c.689A>G, p.(Tyr230Cys) variants in the family (index ID: ). The ABCC8 c.4478G>T, p.(Arg1493Leu) variant is classified as likely pathogenic. The ABCC8 c.689A>G, p.(Tyr230Cys) variant is classified as a variant of uncertain significance (VUS). Targeted variant testing was requested. These two variants in ABCC8: c.4478G>T, p.(Arg1493Leu) and c.689A>G, p.(Tyr230Cys) are missense mutations. There are 2 individuals heterozygous for ABCC8 c.4478G>T, p.(Arg1493Leu) in the datasets of Exome Aggregation Consortium (n>60,000 exomes, ExAC) and Genome Aggregation Database (n>120,000 exomes and >15,000 genomes, gnomAD). The variant is predicted deleterious by in silico tools. To our knowledge, the ABCC8c.4478G>T, p.(Arg1493Leu) has not been reported in the literature or in HGMD or ClinVar databases.
[Show full text]
ABCC8 Mrna Expression Is an Independent Prognostic Factor For
www.nature.com/scientificreports OPEN ABCC8 mRNA expression is an independent prognostic factor for glioma and can predict chemosensitivity Kaijia Zhou1, Yanwei Liu1, Zheng Zhao1, Yinyuan Wang1, Lijie Huang1, Ruichao Chai1, Guanzhang Li1 & Tao Jiang1,2,3,4* Glioma is the most common primary intracranial tumor and is associated with very low survival rates. The development of reliable biomarkers can help to elucidate the molecular mechanisms involved in glioma development. Here the expression of ABCC8 mRNA, clinical characteristics, and survival information based on 1893 glioma samples from four independent databases were analyzed. The expression patterns of ABCC8 mRNA were compared by a Chi square test. The overall survival rate of gliomas was evaluated according to the expression level of ABCC8 mRNA. The prognostic value of this marker in gliomas was tested using Cox single factor and multi factor regression analyses. We found patients with low WHO grade, oligodendrocytoma, low molecular grade, IDH mutation, and 1p19q combined deletion had high ABCC8 mRNA expression. The patients with high expression of ABCC8 mRNA had longer survival. ABCC8 mRNA expression was a new independent prognostic index for glioma. Temozolomide chemotherapy was an independent index to prolong overall survival in high ABCC8 mRNA expression glioma patients, whereas in patients with low expression, there was no signifcant diference. So ABCC8 mRNA expression could be an independent prognostic indicator for glioma patients and could predict the sensitivity of glioma to temozolomide. Glioma is the most common primary intracranial tumor, accounting for 81% of malignant brain tumors1. World Health Organization (WHO) grade 4 glioblastoma is the most malignant form of glioma with a 5-year relative survival rate of 5%2.
[Show full text]