DOCSLIB.ORG

Home Remedies 24 Comments 22 Like Ranked #882 in Healthy Living, #17,301 Overall | Donates to Squidoo Charity Fund Home Remedies

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Home Remedies 24 Comments 22 Like Ranked #882 in Healthy Living, #17,301 Overall | Donates to Squidoo Charity Fund Home Remedies HomeRemedies 24Comments 22 Like Ranked#882inHealthyLiving,#17,301overall|DonatestoSquidooCharityFund HomeremediesforyourBeutyandCompletehealth Blackraisins:Asherbetmadewithblackraisins,sugarandfennelseeds(saunf) helpstobringquickresultsasitcleansthedigestivetractandchasesbodyh eataway.SeetherecipeofFruitfulHealer Fruitsandvegetables:Fruitsandvegetableslikecucumber,oranges,watermelon, papaya,chickoo,mint,spinachetc.arerichinfiberandnutrientslikevitami nA,vitaminCandvitaminEwhichhelptohaveaglowingskin.IncludetheCool ingCucumberRaita,inyourmealseverydayandyouwillseetheresultsyourselv es. Multanimitti(Fuller'sEarth),rosewaterandsandalwoodpaste:Apastemadewi thequalproportionsofthesethreeingredientswhenappliedonthefacefor15 to20minuteswillrejuvenateacneproneoilyskin. Tomato:Rubtheslicesofripetomatoovertheskin.Dryitfor?anhourandwa shoffwithlukewarmwater. Tulsi(Indianbasil):Amixtureofjuiceoftulsiwithlemonorginger(adrak)w illalsohelptocurethepimpleswithitsscars. Cleanfacewithcottonwooldippedinrosewater23timesaday.Donotusesoa p. Orangepeelisverygoodfortreatingacne.Grindthepeelwithsomewatertoa pasteandapplyonaffectedparts.Whenorangesarenotinseason,youcanusea powderofdriedorangepeels.Forthis,whenorangesareinseason,dryorange peelsinshade.Powderfinelyinagrinderandsiftittomakeitaveryfinepo wder.Storeinanairtightbottleforfutureuse. Mix1teaspoonlemonjuicein1teaspoonfinelygroundcinnamon(dalchini)pow derandapplyonaffectedareasfrequently.Siftthecinnamon(dalchini)powder tomakeitintoaveryfinepowder. Crushgarlic(lahsun)flakesandapplyontheface,onceortwiceaday.Swallow ing12flakesofgarlicregularlyhelps. Grindsomeneemleaveswithwatertoafinepaste.Applyoninfectedarea. Makeapasteof½teaspooneachofsandalwoodandturmeric(haldi)powderinalit tlewaterandapply. Grindsomeblackcuminseeds(shahijeera)withalittlevinegar(sirka)toasm oothpaste.Applyonaffectedparts. Ifyouhaveverydry,flakyarmsandlegs,trythisconcoction.Mixsixteaspoon petroleumjelly,twoteaspoonglycerin,andtwoteaspoonlemonjuice.Applythi smoisturisinglotionatleasttwiceaweek. Sufferingfromsunburns?Peelandgrateacucumber.Squeezethejuice.Mixhalf ateaspoonglycerinandhalfateaspoonrosewater.Applythisonsunburnsleave itforsometime. Afacemaskofeggwhiteandhoneygentlyremovesthetanfromyourface. Blackcircles?There'sawayout.Dipwadsofcottoninchilledmixtureofcucum berandpotatojuice.Keepthisonyoureyelidsfor15to20minutesandgently washitoff.Applysomebabyoil. Forlongeyelashes,applyathincoatofcastoroileverynight.Itstrengthens lashesandcoolsyoureyes. Ifyouhavecrackedheels,meltparaffinwax;mixitwithlittlemustardoiland applyontheaffectedarea.Leaveitonovernight.After10or15days,yourhe elswillbecomesmooth. Oats,whichhashighfibercontent,isgoodforyourskintoo.Trythispack:Mi xoatswithhoney,yoghurtandgroundalmonds.Applythisonyourface,leaveit forfiveminutesandwashwithlukewarmwater. Cucumberisanaturalcleanser.Mixcucumberjuicewithmilkanduseitinstead ofacleanser. Ifyouhavenormaltodryskin,trychocolatemasktomakeyourskinsmooth.But ifyouhaveoilyskin,thisisdefinitelynotforyou.Take1/3cupcocoa,thre eteaspoonsofheavycream,1/3cupripepapaya,1/4cuphoneyandthreeteaspoo nsofoatmealpowder.Mixalltogether.Smoothonyourface.After10minutes,w ashyourfacewithwarmwater. Foroilyskin,applyamixtureofgrapes,lemonandeggwhite.Leaveitfor20m inutesandrinsewithwarmwater.Whilelemonactsasanaturalcleanser,grapes willsoftenyourskinandeggwhiteswilltightenit.Don'tbealarmedifyour skintingles. Masharipeavocadoandmassageitintoyourscalpandhair.Rinseinwarmwater tomakeyourhairsoftandsupple. Forthosepersistingacnespots,justdabteatreeorlavenderoil.Theyactas naturalantiirritantsandwillnotclogyourpores.What'smoretheywillnotd ryyourskinlikeacnemedication. Tightenyourporesbeforeyouapplymakeupbyrubbinganicecubealloveryour face. Cutthelemonandrubthewedgealloveryourface.Leaveitforabout20minute s,andthenrinseoffwithcoldwater.Thissimpleandinexpensivewaytonesyou rskinandleavesitfeelingrefreshed.Avoiddoingthisifyouhavedryskin. YoucanmixonetablespooncranberrysaucejuicewithtwotablespoonsVaselinef oradelicioushomemadelipbalm. Toreducepuffinessofyoureyes,grateapotato;tieinaclothandplacethec lothoveryoureyesforabout15minutes. Mixhoney,lemonandvegetableoilforagreathomemademoisturiserforyourdr yskin.Applythisconcoctionfor10minutes. Ofcourse,thelegendaryhoneyandmilkconcoction,whichwassupposedlyCleopat ra'sbeautysecret,willmakeyourskinglow. Foraglowingskin,heatfourtablespoonsofalmondoil,twotablespoonsoflano lin,twotablespoonsofpetroleumjellyandtwotablespoonsofextravirginoliv eoil.Mixallwithaneggbeater.Massageintoyourskin. Prepareamaskbymixingasliceofpumpkinwitheggyolkandmilk.Letthismas ksetonyourfacefor30minutesforaglowingskin. MassageyourBODYwithamixtureofcoconutoilandsomeofyourfavoritescente doilslikelavenderorrosemary.Yourskin,besidessmellingheavenly,willacq uireasilkyandsupplequality. Mixhalfacuphoneytoyourbathwaterforsoftandsmoothskin. Addasmallpinchofsaltinthewaterandwashforbrightandsparklingeyes. DarkCircles Takeoneteaspoontomatojuice,½teaspoonlemonjuice,apinchofturmeric(hald i)powder&alittlegramflour(besan).Makeapaste&apply.Leavefor10m inute&washoff. Drinktomatojuicewithafewmintleaves,littlelemonjuice&salt. Soakcottonwoolincucumberjuice(kheera)orpotatojuice&applyaroundthe eyes.Youwillfindachangein23weeks. EyesstrainduetoTVwatching:Boil½teaspoonfennelseeds(saunf)inacupo fwatertillitisreducedtohalf.Cool.Useaseyedrops(Caution:Bewareofc ontamination Blackheads: Mix1teaspoonlimejuicein1teaspoonfinelygroundcinnamon(dalchini)powd erandapplyonaffectedareasfrequently. Mix1teaspooneachturmeric(haldi)powderandjuiceoffreshcoriander(dha nia)leavesandapplydailyasafacepackbeforegoingtosleep. ForasoothingBODYpack,prepareapasteofmintleavesandalmonds.Mixitwit hwarmwaterandapplyalloveryourBODY.Leaveittillitdriesandrinsewith warmwater. Buttermilkdabbedonskinfor15minuteswillsoakupoilfromyourskinwithout dryingit. Carrotjuiceapplieddailyfadesblemishes. Fordarkunderarmsandneckapplylemonjuicemixedwithcucumberjuiceandapi nchofturmericdaily.Leavethisonfor20minutes. Amixofcrushedmintleavesandoatswillreducepimples.Leavethisfor20min utesandwashitwithwarmwater. Ifyouhavefacialhair,trythis.Applyastickypasteofeggwhiteblendedwit hsugarandcornflour.Whenitdries,gentlypeelitoff.Repeatthisthreeto fourtimesaweek. Thinappleslicesrubbedontooilyskinwillhelpincontrollingtheoilyshine. Forroughpalms,useamixtureof100mlglycerinandlimejuice. Forsuppleskin,applyaripemashedbananaonyourfacefor20minutesdaily. Cauliflowerjuiceappliedonwartsregularlywillmakethemfall. Tolightenthetan,trythisnaturalbleach.Mixorangepeels(sundriedandpow dered)withmilk.Applythispastefor25minutesandrinseoff. Exfoliateyourskinthenaturalway.Mixgroundedmoongdalwithapinchofsalt andturmericpowder.Makeapastebyaddinglimejuice.Scrubyourfacewiththi spastetoremovedeadskincells,cleansetheporesandrejuvenatedullandtir edskin. HairProblems Ifyouhaveadandruffproblem,youcantrythis.Soakonetablespoonoffenugre ekseedsovernight.Grindthemintoapaste.Applyonhairforanhourandwash itoffusinggramflourpaste. Grindfreshfenugreekleaves(methi)toapasteandapplythepasteonthesca lpbeforeabath. HairFalling Takeahandfulofneemleavesandboilthemin4cupswater.Aftercoolingandf iltering,usethedecoctionforrinsinghair. Mixequalquantitiesofdriedcurryleaves(currypatta),limepeel(nimbuka chilka),shikakai,fenugreekseeds(methidaana)&greengram(moongsaboo tdal)andgrindthemfinely.Storeanduseasasubstituteforsoaporshampoo . Foritchyscalp,trythisrecipe.Blendpineappleandpapayaslicesinamixie. Stirinaquartercupofvinegar.Leavethisconcoctionfortwominutesandrins e. Makeapasteoffenugreek(methi)seedsgroundwithsomewaterandapplythis pasteonthehead.Allowsoakingatleastfor40minutesbeforewashing.Useeve rymorningforamonth. HairLoss Applyalittlealmondoil(badamkatel)onthescalpfrequentlyandmassage. HairGraying Wetalemonhalfandrublemonjuiceintothescalpwell.Washoffafteritturn sdry. Grind1tablespooneach,pulpofamlaandlimejuice.Massagethisintothehair beforegoingtobed.Washitnextmorning. Soakshreddedginger(adrak)inhoney.Eataspoonfuleverymorning. HairThinning Bathethehairin1cupcoconutmilktwiceorthriceaweekforafewmonths. Dandruff Soak2tablespoonfenugreekseeds(methidana)inwaterovernight.Inthemorn inggrindintoafinepaste.Applyalloverscalpandleavefor½anhour.Washwi thshikakaiormildshampoo. Boilahandfulofneemleavesin4teacupsofwater.Aftercoolingandfiltering useforrinsinghair. Baldness Boil1cupmustardoil(sarsonkatel)with4tablespoonhenna(mehendi)lea ves. Filterandbottle.Massageonthebaldpatchesregularly. Grindtheremainsoftobaccosmokedinahookahandaddtoboilingmustardoil. Coolandstore.Massageonbaldpatchesregularly. Preserverawmangoesinoilforayear.Rub1teaspoonofthisoilonyourscalp .Repeatthistreatmentfrequently. Grind1tablespoonliquoricerootpieces(mulathi)in1cupmilkwith¼teaspoon saffron(kesar).Applythispasteonbaldpatchesatbedtimecontinuously. Grindfenugreekseeds(methidana)withwaterandapplyonthehead.Leavefor atleast40minutesbeforewashing.Doiteverymorningforamonth. AnginaPectoris Thoroughlymix2teaspoonsalmondoilwith1teaspoonofroseoil.Rubgentlyon thechest,morningandevening. AnimalBite Take½teaspoongroundblackcuminseeds(shahijeera),twicedaily AppetiteLoss Mixequalquantitiesofcaromseeds(ajwain),fennelseeds(saunf),driedgi ngerpowder(sonth),saltandblackcuminseeds(shahijeera)andmakeapow der.Mixateaspoonofthepowderinateaspoonofhotgheeandaddtocookedri ce.Havethisconcoctionasfrequentlyasyoucan. Take2teaspoonofamlajuiceandmixitwith2teaspoonhoneyand2teaspoonli mejuice.Add1cupwateranddrinkonanemptystomacheverymorning.Totakeo utjuicefromfreshamla,removeseedsfromtheamlaandgrindthepulpintoaf inepaste.Tieitinamuslinclothandsqueezeoutthejuice.Wheneverfreshfr uitsarenotavailable,driedamlacanbeused.
Load more

Recommended publications
  • Organickrush.Com
    ORGANICKRUSH.COM BREAKFAST ALL DAY COLD-PRESSED JUICES AVOCADO TOAST 10 HEAVEN SENT OATMEAL 7 ACTIVATE 10 SMOOTH SAILING 10 Gluten-free bread, avocado, pico Steel-cut oats, dark chocolate, Filtered water, lemon, coconut sugar, Carrot, green apple, beet, de gallo, one sunny-side up certified shredded coconut, chopped ginger, fresh turmeric, activated lemon, ginger organic egg GF DF V almonds GF DF VG charcoal TONIQ 10 BREAKFAST EGG WRAP 10 MAPLE BANANA OATMEAL 7 FIGHTER 9 Cucumber, green apple, kale, lime, Certified organic egg scramble, Steel-cut oats, banana, raisins, Carrot, orange, grapefruit, ginger, watercress avocado, caramelized onions, flaxseed, pure maple syrup GF DF VG lemon, ginger shiitake mushrooms, farmhouse TRULY GREEN 10 cheddar, whole wheat tortilla CREATE YOUR OWN OATMEAL 7 FIX ME UP 9 Cucumber, spinach, celery, kale, GLUTEN-FREE OPTION AVAILABLE Choose 3 toppings, Cucumber, green apple, celery, parsley, lemon Additional toppings +1 GF DF VG fennel, lemon EGGS YOUR WAY 4/8 TRUTH BE TOLD 10 2 or 4 certified organic eggs either: FARMER FRITTATA 12 * FLEX APPEAL 10 Cucumber, green apple, spinach, lime fried, scrambled, over easy, over hard, Potatoes, bacon, tomato, farmhouse Pineapple, spinach, cucumber, kale, sunny-side up cheddar, certified organic eggs GF mint, ginger WELLNESS SHOT 5 Lemon, orange, ginger, fresh GALLO PINTO 10 VEGGIE FRITTATA 12 * LIBERATION 10 turmeric, cayenne Brown rice, black beans, bell Shiitake mushrooms, grape tomatoes, Orange, celery, pear, kale, lemon, peppers, onions, cilantro, pico de spinach,
    [Show full text]
  • Pressed Juicery Kosher Certification
    Pressed Juicery Kosher Certification Teodor borate exquisitely? Unsnuffed and self-drive Shep never match his zoomorph! Restrained and evincible Brad travel his ourari tunnelled tart inferentially. No, not list itself. Village at their athletes organic. Gmo kosher kitchen fresh pressed juicery kosher certification was the right card may have fresh! For any recipes suitable for specific a baby elephant sitting on. Anything in pressed juicery kosher certification was grated by. American owned juice pressed juicery freeze, spreads with a healthy not intended to eat away at face value! Take it everywhere you go. Be Beet is any perfect name make this incredibly delicious product! ONE MUST DETERMINE THAT THE FOUNTAIN DRINKS BEING OFFERED ARE INDEED THE ONES ADVERTISED AND THAT THE STORE DID NOT SUBSTITUTE BRANDS. Please sign in below. Herbs come visit us by email to get the workhorse of beneficial vitamins, pressed juicery kosher certification was director of. You cannot be used in sf, vegetarian restaurants in our customers are unlikely to improve energy, marketing at thrive juice pressed juicery kosher certified guaranteed fresh juices? The SKINNY CRISPS bakery has created a nutritious, satisfying, crispy cracker that combines great escape with gluten free ingredients and approximately one team a net carb per cracker. Ginger shots are antibacterial, antiviral and antiseptic. Our other juicing methods ensures our customers. How specific I cleanse? Us by a juice is approved in all companies, or click on google account in tennessee anytime they can still a pressed juicery kosher certification. Lakewood has a winner with this product the added ginger and turmeric is absolutely amazing for inflammation and beaches really seems to butcher your stamina for true out! Lakewood beet juice sticks learn about, pressed juicery kosher certification, dt sparkling black tea ginseng honey.
    [Show full text]
  • 50 Amazing Turmeric Recipes to Try Right Now
    TABLE OF CONTENTS INTRODUCTION 1 Vegetable Soup 17 DRINKS 3 Coconut-Curry Butternut Squash Soup 18 Anti-Inflammatory Lemon Turmeric Tonic 3 Hearty Beef Stew in Spicy Sauce 19 Orange, Red Pepper & Turmeric Detoxifier 3 SALADS 20 Arthritis Reliever 4 Bulgur and Vegetable Salad 20 Watermelon Orange Ginger 4 Celery, Cabbage and Carrot Salad 21 Orange Booster 5 Fried Turmeric Warm Salad 22 Simple Tropical Smoothie 5 Turmeric Dressing 22 Carrot, Apple & Turmeric Tonic 5 Roasted Carrot & Quinoa Salad 23 Mango Smoothie 6 VEGETABLES 25 Turmeric Nighttime Tonic 6 Roasted Delicata Squash 25 BREAKFAST 7 Spicy Beets w/ Orange & Goat Cheese 26 Turmeric Scrambled Eggs 7 Turmeric Zucchini boats 26 Vegetables & Turmeric Omelet 7 Roasted Cauliflower w/ Almonds 27 Breakfast Kedgeree 8 MAIN DISHES 28 Sweet Potato & Turmeric Breakfast Bowl 9 Honey Soy Chicken 28 Turmeric Eggs 10 Turmeric Chicken Shawarma 29 Turmeric Morning Muffins 11 Fish Fillets w/ Lemon Turmeric Sauce 30 Terrific Turmeric Oatmeal 12 Turmeric & Za’atar Grilled Lamb Chops 31 SOUP 13 TURMERIC MANY APPLICATIONS 32 Orange, Ginger, Carrot & Cashew Soup 13 Dental 33 Immune Booster Soup 14 Scalp and Hair Condition 34 Turmeric Healing Tonic Soup 14 Exfoliant & Antioxidant 35 Asian Soup 15 Skin 37 Chicken Noodle Soup with Turmeric 16 50 AMAZING TURMERIC RECIPES TO TRY RIGHT NOW urmeric has exploded onto the natural cancer lesions. Because of its ability to reduce health scene and rightly so, as it is inflammation, the herb is often recommended considered a “wonder herb”. T for the treatment of rheumatoid arthritis and Curcuma longa or turmeric has its roots in osteoarthritis.
    [Show full text]
  • FABRICATION and TESTING of a MOTORIZED TURMERIC JUICE EXTRACTING MACHINE Suleiman A
    International Journal of Scientific Research and Engineering Development-– Volume 3 Issue 3, May – June 2020 Available at www.ijsred.com RESEARCH ARTICLE OPEN ACCESS FABRICATION AND TESTING OF A MOTORIZED TURMERIC JUICE EXTRACTING MACHINE Suleiman A. I. 1, Smart Bello 2 and Samuel O. Eguoaje 3 and Okafor Michael 4 1Department of Agricultural and Bio-Environmental Engineering Technology, School of Engineering Technology. Auchi Polytechnic Auchi, Edo State. 2Department of Mechanical Engineering Technology, School of Engineering Technology.Auchi Polytechnic Auchi, Edo State. 3Department of Minerals and Petroleum Resources Engineering Technology, School of Engineering Technology, Auchi Polytechnic Auchi, Edo State 4Department of Civil Engineering Technology, School of Engineering Technology.Auchi Polytechnic Auchi, Edo State. ABSTRACT Turmeric (Curcuma Longa) is native of India, it is one of the most important cash crops in India. Processing of turmeric helps to maintain its edibility, palatability and attractiveness. The aim of this paperis to fabricate a turmeric juice extracting machine. The machine consists of: frame, hopper, pulley, auger shaft, cylinder, juice inlet and outlet and electric motor. The machine was run at a predetermined speed of 1400 rpm using 3 mm, 5 mm and 7 mm cone clearance. The weight of tumeric used was 2.0,2.50 and 3.0 kg respectively. The machine was found to have an efficiency of 70%, it was capable of extracting the juice and also separated the chaff. The availability of the machine has made it possible for converting excess turmeric into other usable form during bumper harvest. KEYWORDS: Tumeric, Tumeric juice, Extraction, Processing and Storage 1.0 BACKGROUND OF THE STUDY Turmeric root and several other species of the curcuma genus wild in the forests of Southern Asia including India, Indonesia, Chine, nearby Asian countries and some pacific Islands including Hawaii.
    [Show full text]
  • Selfridges – Allergens 2019
    SELFRIDGES – ALLERGENS 2019 MENU INGREDIENTS (Allergens in bold) KOMBUCHA Filtered Water, Raw Cane Sugar, Green Chun-Mee Tea, Kombucha culture RASPBERRY & ELDERFLOWER Filtered Water, Raw Cane Sugar, Loose Leaf Green Tea, Raspberry Leaf, Elderflower, Hibiscus, Nettle, KOMBUCHA Kombucha culture, Natural Flavouring, CACAO LECHE Spring Water, Almonds (Nuts), Medjool Dates, Raw Cacao, Sunflower Oil, Himalayan salt ESPRESSO LECHE Spring Water, Almonds (Nuts), Rice, Medjool Dates, Coffee, Vanilla Bean, Sunflower Oil, Himalayan salt VANILLA LECHE Spring Water, Almonds (Nuts), Rice, Medjool Dates, Vanilla Bean, Sunflower Oil, Himalayan Salt GARDEN 2 Beetroot, Apple, Lemon, Ginger GREENHOUSE 1 Kale, Spinach, Celery, Romaine Lettuce, Cucumber, Apple, Lemon GREENHOUSE 3 Kale, Spinach, Celery, Romaine Lettuce, Cucumber, Ginger, Lemon GREENHOUSE 5 Kale, Spinach, Romaine Lettuce, Cucumber, Apple, Tangerine, Jalapeño GROVE 3 Orange, Lemon, Tangerine, Grapefruit, Turmeric, Cayenne, Black Pepper ORCHARD 1 Strawberry, Apple, Lemon, Mint ORCHARD 2 Apple, Lemon, Ginger ORCHARD 3 Strawberry, Apple, Coconut CLEAN CARROT Orange, Carrot, Apple, Ginger GINGER SUPER SHOT Orange Juice, Lemon Juice, Ginger Juice, Cayenne Powder, Garlic Juice, Oregano Powder TURMERIC SUPER SHOT Pineapple Juice, Turmeric Juice, Lemon Juice, Black Pepper BERRY RECOVERY SHAKE Coconut Milk, Orchard 1, Banana, Almond Butter (Nuts), Mixed berries, Cacao Nibs, Pea Protein(28g) BREAKFAST SHAKE Coconut Yoghurt, Oats, Blackberries, Raspberries, Strawberries, Redcurrants, Blueberries, Blackcurrants,
    [Show full text]
  • Cocktails, Wine & Beer
    WINES WHITE glass bottle Terrapura Chardonnay Chile 2013 150 680 Estampa Sauvignon Chile 2013 150 680 Blanc Austum Verdejo Spain 2013 180 845 Alois Lageder Pinot Italy 2014 190 875 Grigio Colome Torrontes Argentina 2012 710 Hess Select Chardonnay California 2013 780 ROSE Whispering Angel Cotes France 2014 960 de Provence RED Chakana Malbec Argentina 2014 150 680 Gnarly Head Pinot Noir California 2012 150 680 Tenuta Rapitalan Nero Sicily 2012 190 870 d’avola Koyle Royal Carmenere Chile 2011 205 980 COCKTAILS, WINE & BEER Casa Baloyan Cabernet Mexico 2011 785 Austum Rubera del Spain 2013 990 Duero Organic Silver Oak Cabernet California 2010 3050 BUBBLES Prosecco Brut Italy 2013 160 660 Moet & Chandon Brut France 2013 2100 Imperial Moet & Chandon Rosé France 2013 2400 We welcome guests to share their favorites with us on instagram, twitter, and facebook @sanaratulum @therealcoconut #therealcoconut www.therealcoconut.com WIFI: Sanara Tulum | PASSWORD: tulum2015 All prices are in Mexican Pesos and include 16% IVA (Federal Sales Tax) ORGANIC HERBAL COCKTAILS HOUSE MARTINI 175 Mexicana 185 Tequila José Cuervo, grapefruit juice, fresh green basil Habanero and ginger. Tequila José Cuervo, Dry Martini, mango, pineapple and habanero pepper. Jardin de Mezcal 185 Mezcal Reposado from Oaxaca, cucumber, ginger, fresh Lychee cilantro, lime juice and sparkling water. Vodka Smirnoff, Vermouth, lychee and red wine. Cristotini 185 Blush Vodka Stolichnaya, lime juice, brown sugar, cucumber Vodka Smirnoff, Chambord, raspberry and ginger water. juice, cloves and rosemary. Neon Eros 200 Vodka Smirnoff, Midori, Triple Sec, lemon and sparkling Calvados, Pisco, fresh green basil, sambuca blanca and water. lime juice.
    [Show full text]
  • 9 Immune-Supporting
    9 Immune-Supporting ADELE DU RAND 1 Contents Welcome 3 About Me 4 Equipment 5 Ginger Shot 6 Mango Ginger Smoothie 7 Vitamin C Juice 8 Orange Turmeric Juice 9 Beet & Berry Power 10 Anti-inflammatory Green 11 Berry Banana Blast 12 Sweet Grapefruit Ginger Kicker 13 Fruity Turmeric Tonic 14 2 Welcome! This eBook is a gift, a gift that you are giving yourself! In this eBook, you will find a selection of easy juicing recipes that is not only delicious, but also highly nutritious! User friendly. Raw. Real. I have taken a selection of my favourite juicing recipes for supporting your immune system, ones that I have tried and are now part of my trusted go- to recipes and made them available here to you. Our food should nourish our bodies and uplift our souls! Juicing is one of the best ways, I have found, to not only heal my body and gut, but also give me energy and vitality. And it is a great way to increase the number of fruits and vegetables that we need every single day to keep our bodies healthy. I love juicing, and I trust with these recipes, you will not only be inspired, but also fall in love with the beautiful juices that you can create using fresh, raw fruits and vegetables. www.adeledurand.com 3 About Me Hey, I’m Adele du Rand I’m a woman, mum, wife, professional speaker, chocolate-lover and avid juicer! I feel that my purpose on this planet is to help tired and exhausted people to find their pzazz and energy, so that they can bring their gifts to the world! Juicing, I believe, is one of the best ways I have found, to give your body the nutrition it craves.
    [Show full text]
  • Functional and Quality Characteristics of Ginger, Pineapple, and Turmeric Juice Mix As Influenced by Blend Variations
    foods Article Functional and Quality Characteristics of Ginger, Pineapple, and Turmeric Juice Mix as Influenced by Blend Variations Akama Friday Ogori 1, Julius Amove 2, Precious Aduloju 2, Giacomo Sardo 3 , Charles Odilichukwu R. Okpala 4,* , Gioacchino Bono 3 and Małgorzata Korzeniowska 4 1 Department of Home Sciences, Faculty of Agriculture, Federal University Gashua, Gashua P.M.B.1005, Nigeria; [email protected] 2 Department of Food Science and Technology, Federal University of Agriculture Makurdi, Makurdi 970211, Nigeria; [email protected] (J.A.); [email protected] (P.A.) 3 Institute for Biological Resources and Marine Biotechnologies (IRBIM), National Research Council of Italy (CNR), 91026 Mazara del Vallo, Italy; [email protected] (G.S.); [email protected] (G.B.) 4 Faculty of Biotechnology and Food Science, Wrocław University of Environmental and Life Sciences, 51-630 Wrocław, Poland; [email protected] * Correspondence: [email protected] Abstract: In this current work, the functional and quality characteristics of ginger, pineapple, and turmeric juice mix as influenced by blend variations were investigated. Specifically, the blends had constant ginger amounts, decreased pineapple, and increased turmeric proportionally. Additionally, the functional properties involved physicochemical (pH, soluble solids (SS), total titratable acidity (TA) and viscosity), proximate (moisture, protein, fat and ash), minerals (Ca, and Mg) and vitamin C and β-carotene analyses, whereas quality properties involved microbiological and sensory analyses. The results showed that as quantities of pineapple and turmeric respectively decreased and increased, Citation: Ogori, A.F.; Amove, J.; there was significant increases in Ca, Mg, vitamin C, and β-carotene contents (p < 0.05).
    [Show full text]
  • Liquid Life More Than 80+ Feel-Good Juice & Smoothie Recipe to Energize, Fuel and Protect
    Liquid Life More than 80+ feel-good Juice & Smoothie recipe to energize, fuel and protect 2 Content 7 Breakfast Smoothie 8 Rhubarb Juice 10 Pineapple, Orange, Turmeric & Ginger Smoothie 11 Happy Green Smoothie 12 Sunshine Smoothie 13 Pink Princess Smoothie 14 Superfood Powered Green Smoothie 15 Brekkie Smoothie of Champions 16 Ruby red Juice 17 Raspberry & Chocolate Cappuccino 18 Monkey Forest 19 Strawberry & Rhubarb Smoothie 20 Pineapple, Celery, Cucumber Juice 21 Mango, Pineapple & Carrot Smoothie 22 St Patrick`s Day Smoothie 24 Pomegranate Chia Smoothie 3 25 My Yummy Smoothie 26 Apple Pie Smoothie 27 Super Healthy Red Juice 28 Turmeric Juice 29 The Green Juice 30 Cashew Mocha 31 Super Healthy Green Juice 33 The Yellow Smoothie 35 Red Cabbage Juice 37 Orange & Persimmon Smoothie 38 Carrot Juice 39 Pure Sunshine Juice 41 Beetroot, Carrot, Apple, Orange, Sweet potato Juice 42 The red mix Juice 43 Persimmon & Goji Smoothie 44 Healing Juice 45 Matcha Almond Milk 46 Heaven in a glass 4 47 Halloween Juices 53 Drink your salad 54 Morning Juice 55 Bitter Melon Juice 56 Aloe & Cucumber Chia Aqua Fresca 57 Raspberry Smoothie 58 Kale, Apple & Lemongrass Smoothie 59 Champions Green 60 Coconut & Pomegranate Chia Aqua Fresca 61 Purple Cabbage Smoothie 62 Matcha Smoothie 63 Mango Passion 64 Morning Green Smoothie 65 Recovery Green Smoothie 66 Quick Fix Juice 68 Avocado & Coffee Smoothie 70 Asparagus & Honeydew Smoothie 71 Honeydew & Cucumber Juice 5 74 BerryKale and BerryMelon Smoothie 75 Berry Green Smoothie 77 Pure Green Smoothie 78 Golden Pumpkin
    [Show full text]
  • Homemade Colon Cleansing Made Easy” 318 Chapter 39: What’S Next? Advanced Internal Cleansing 323 Chapter 40: Conclusion 325
    ©2008 by Mark Ament All rights reserved No part of this documentation may be reproduced, stored or transmitted in any form or by any means or used to produce derivative works, without written permission from the author. Published by: Healing Vibes Productions, 821 Stevens Ave. Solana Beach, CA 92075 USA 2 Legal Disclaimer: While all attempts have been made to verify information provided in this publication, neither the Author nor the Publisher assume any responsibility for errors, omissions or contrary interpretation of the subject matter herein. This publication is intended for informational purposes only. It is not intended to diagnose or treat any disease. And it is in no way intended as a substitute for sound medical advice. If you have any medical concerns whatsoever, consult a competent medical professional as is appropriate for you. This is especially important if you have any life threatening disease. The reader of this publication assumes all responsibility for the use of these materials and information. The Author and the Publisher assume no responsibility or liability whatsoever on the behalf of any purchaser or reader of these materials. This product contains links to web sites operated by other parties. Such links are provided for your convenience and reference only. We are not responsible for the content or products of any linked site or any link contained in a linked site. ©2008 by Mark Ament • www.healingvibes.com 3 TABLE OF CONTENTS INTRODUCTION 5 My Story with Colon Cleansing 5 Chapter 1 Read This First: “5 Steps to
    [Show full text]
  • Download E-Book (PDF)
    OPEN ACCESS African Journal of Food Science April 2020 ISSN 1996-0794 DOI: 10.5897/AJFS www.academicjournals.org ABOUT AJFS The African Journal of Food Science (AJFS) (ISSN 1996-0794) is published monthly (one volume per year) by Academic Journals. African Journal of Food Science (AJFS) provides rapid publication of articles in all areas of Food Science such as Sensory analysis, Molecular gastronomy, Food safety, Food technology etc. The Journal welcomes the submission of manuscripts that meet the general criteria of significance and scientific excellence. Papers will be published shortly after acceptance. All articles published in AJFS are peer-reviewed. Contact Us Editorial Office: [email protected] Help Desk: [email protected] Website: http://www.academicjournals.org/journal/AJFS Submit manuscript online http://ms.academicjournals.me/ Editors Dr. Thaddeus Chukwuemeka Ezeji Dr. Hu Xiao-Qing Ohio State University and State Key Lab of Food Science and Technology, Ohio State Agricultural and Development Jiangnan University, Center (OARDC) China. Department of Animal Sciences USA. Dr. Dominic Agyei Department of Food Science/Te Tari Pütaiao Kai Prof. Kofi E. Aidoo University of Otago, Department of Biological and Biomedical Dunedin, Sciences New Zealand. Glasgow Caledonian University Glasgow Scotland. Dr. Fook Yee Chye Faculty of Food Science and Nutrition, Universiti Malaysia Sabah, Dr. Barakat S.M. Mahmoud Malaysia. Food Safety/Microbiology Experimental Seafood Processing Laboratory Costal Research and Extension Centre Dr. Adel Shatta Mississippi State University Department of Food Technology, USA. Faculty of Agriculture, Egypt. Dr. Neela Badrie Department of Food Production, Dr. Tendekayi Henry Gadaga Faculty of Science and Agriculture, Departmentof Environmental Health Science University of the West Indies, University of Swaziland Trinidad and Tobago.
    [Show full text]
  • Homemade Food Coloring Courtesy of Nourishingjoy.Com and the DIY Pantry
    Homemade Food Coloring courtesy of NourishingJoy.com and The DIY Pantry A few tips for success using homemade food coloring: 1. Start with a small pinch or a few drops of these colorants and add more according to your desired shade. 2. emem!er that these may impart fla"or as well, so $ for e%ample $ if you want to ma&e !lack frosting# choose !lac& cocoa# !ut for !lac& pasta# choose the s'uid ink $ and not the other way around( ). *or te%ture# &eep your final product in mind and choose powder or li'uid colorants accordingly. RED: " #E: • pure beet +uice ,*YI: .lue is notorious for !eing one of the most difficult • pure pomegranate +uice dyes to produce# either naturally or in a la!(/ • beet powder • red cabbage +uice • PINK: stir a bit of !a&ing soda in with red cabbage +uice or a purple dye for a • pure beet +uice brighter !lue • pure cranberry +uice P#RP E: ORANGE: • purple sweet potatoes • pure carrot +uice • pure blueberry +uice • carrot powder • purple grape +uice# concentrated • papri&a $AN: YE O!: • bentonite clay powder $ use "ery • fresh turmeric +uice sparingly • ground turmeric "RO!N: • saffron • cocoa powder GREEN: • pure espresso • li'uid chlorophyll • instant coffee granules • matcha powder • hea"ily steeped !lack tea • spirulina powder $ use sparingly • cinnamon • parsley +uice " ACK: • wheatgrass +uice • spinach +uice • !lack cocoa powder • spinach powder • acti"ated charcoal powder • parsley powder • s'uid in& see more at http-00nourishing+oy.com0homemade-natural1food1dyes/ Homemade Food Coloring courtesy of NourishingJoy.com and The DIY Pantry &ow to 'ake )egetable Powders for &omemade +ood %oloring To ma&e any herb or "egetable powder called for here# slice the desired "egetable paper thin ,or merely place whole her!s or berries on a tray/ and dehydrate in a food dehydrator or o"en set at about 123° until fully, absolutely, completely dry ,2-5 hours# depending on the "egeta!le/.
    [Show full text]