Anti-UBE2M monoclonal antibody, clone 2H0 (DCABH-13894) This product is for research use only and is not intended for diagnostic use.
PRODUCT INFORMATION
Antigen Description The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin.
Immunogen UBE2M (AAH58924, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype IgG1
Source/Host Mouse
Species Reactivity Human
Clone 2H0
Conjugate Unconjugated
Applications Western Blot (Recombinant protein); Sandwich ELISA (Recombinant protein); ELISA
Sequence Similarities MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICP DEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYG LQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Size 1 ea
Buffer In 1x PBS, pH 7.4
Preservative None
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
GENE INFORMATION
45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]
Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Gene Name UBE2M ubiquitin-conjugating enzyme E2M [ Homo sapiens ]
Official Symbol UBE2M
Synonyms UBE2M; ubiquitin-conjugating enzyme E2M; ubiquitin conjugating enzyme E2M (homologous to yeast UBC12) , ubiquitin conjugating enzyme E2M (UBC12 homolog, yeast); NEDD8-conjugating enzyme Ubc12; hUbc12; UBC12; yeast UBC12 homolog; NEDD8 protein ligase; NEDD8 carrier protein; ubiquitin-protein ligase M; ubiquitin carrier protein M; ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast); UBC-RS2;
Entrez Gene ID 9040
Protein Refseq NP_003960
UniProt ID A0A024R4T4
Chromosome Location 19q13.43
Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem; Ubiquitin mediated proteolysis, organism-specific biosystem.
Function ATP binding; NEDD8 ligase activity; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding; ribosomal S6-glutamic acid ligase activity; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity;
45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected]
Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved