Anti-UBE2M Monoclonal Antibody, Clone 2H0 (DCABH-13894) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use

Total Page：16

File Type：pdf, Size：1020Kb

Anti-UBE2M monoclonal antibody, clone 2H0 (DCABH-13894) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin. Immunogen UBE2M (AAH58924, 1 a.a. ~ 183 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype IgG1 Source/Host Mouse Species Reactivity Human Clone 2H0 Conjugate Unconjugated Applications Western Blot (Recombinant protein); Sandwich ELISA (Recombinant protein); ELISA Sequence Similarities MIKLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICP DEGFYKSGKFVFSFKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYG LQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK Size 1 ea Buffer In 1x PBS, pH 7.4 Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Gene Name UBE2M ubiquitin-conjugating enzyme E2M [ Homo sapiens ] Official Symbol UBE2M Synonyms UBE2M; ubiquitin-conjugating enzyme E2M; ubiquitin conjugating enzyme E2M (homologous to yeast UBC12) , ubiquitin conjugating enzyme E2M (UBC12 homolog, yeast); NEDD8-conjugating enzyme Ubc12; hUbc12; UBC12; yeast UBC12 homolog; NEDD8 protein ligase; NEDD8 carrier protein; ubiquitin-protein ligase M; ubiquitin carrier protein M; ubiquitin-conjugating enzyme E2M (UBC12 homolog, yeast); UBC-RS2; Entrez Gene ID 9040 Protein Refseq NP_003960 UniProt ID A0A024R4T4 Chromosome Location 19q13.43 Pathway Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Class I MHC mediated antigen processing & presentation, organism-specific biosystem; Immune System, organism-specific biosystem; Ubiquitin mediated proteolysis, organism-specific biosystem. Function ATP binding; NEDD8 ligase activity; acid-amino acid ligase activity; ligase activity; nucleotide binding; protein binding; ribosomal S6-glutamic acid ligase activity; ubiquitin-protein ligase activity; ubiquitin-protein ligase activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.

Copy Link

Recommended publications

UBE2M (Mouse; Full Length), Pab
UBE2M (mouse; full length), pAb Alternate Names: Nedd8-conjugating enzyme, Ubc12, UBC-RS2, UBC12. Cat. No. 68-0025-100 Quantity: 100 µg Lot. No. 30262 Storage: -20˚C FOR RESEARCH USE ONLY NOT FOR USE IN HUMANS CERTIFICATE OF ANALYSIS Page 1 of 2 This antibody was developed and Physical Characteristics validated by the Medical Research Council Protein Phosphorylation and Quantity: 100 μg Formulation: phosphate-buffered Ubiquitylation Unit (University of saline Dundee, Dundee, UK). Concentration: to be provided on shipping Specificity:detects Ube2M at ~22 kDa Source: sheep polyclonal antibody Reactivity: mouse; other species not Background tested. Immunogen: mouse Ube2M (residues 1-183) [GST-tagged] Stability/Storage: 12 months at The enzymes of the NEDDylation pathway -20˚C; aliquot as required play a pivotal role in a number of cellular Purification:affinity-purified using processes including the indirect regula- immobilized immunogen tion and targeting of substrate proteins for proteasomal degradation. Three classes of enzymes are involved in the process of NEDDylation; the ubiquitin-like activating Research Applications and Quality Assurance enzyme APP-BP1/Uba3 (E1), the ubiquitin- Western Immunoblotting: Immunoprecipitation: like conjugating enzymes (E2s) and pro- Use 0.5 µg/ml Not tested tein ligases (E3s). UBE2M is a member of the E2 conjugating enzyme family and the gene for human UBE2M was first de- scribed by Osaka et al. (1998) and shares Dot Blotting Analysis: By dot blot assay the specific 42% sequence identity with yeast UBE2M. recognition of recombinant A trapped ubiquitin like activation complex Ube2M protein was observed has been described for the NEDD8 pathway under native and denaturing comprising, the E1 APP-BP1/Uba3, two conditions when probed with NEDD8 molecules, UBE2M and MgATP.
[Show full text]
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
[Show full text]
Uncovering Ubiquitin and Ubiquitin-Like Signaling Networks Alfred C
REVIEW pubs.acs.org/CR Uncovering Ubiquitin and Ubiquitin-like Signaling Networks Alfred C. O. Vertegaal* Department of Molecular Cell Biology, Leiden University Medical Center, Albinusdreef 2, 2333 ZA Leiden, The Netherlands CONTENTS 8. Crosstalk between Post-Translational Modifications 7934 1. Introduction 7923 8.1. Crosstalk between Phosphorylation and 1.1. Ubiquitin and Ubiquitin-like Proteins 7924 Ubiquitylation 7934 1.2. Quantitative Proteomics 7924 8.2. Phosphorylation-Dependent SUMOylation 7935 8.3. Competition between Different Lysine 1.3. Setting the Scenery: Mass Spectrometry Modifications 7935 Based Investigation of Phosphorylation 8.4. Crosstalk between SUMOylation and the and Acetylation 7925 UbiquitinÀProteasome System 7935 2. Ubiquitin and Ubiquitin-like Protein Purification 9. Conclusions and Future Perspectives 7935 Approaches 7925 Author Information 7935 2.1. Epitope-Tagged Ubiquitin and Ubiquitin-like Biography 7935 Proteins 7925 Acknowledgment 7936 2.2. Traps Based on Ubiquitin- and Ubiquitin-like References 7936 Binding Domains 7926 2.3. Antibody-Based Purification of Ubiquitin and Ubiquitin-like Proteins 7926 1. INTRODUCTION 2.4. Challenges and Pitfalls 7926 Proteomes are significantly more complex than genomes 2.5. Summary 7926 and transcriptomes due to protein processing and extensive 3. Ubiquitin Proteomics 7927 post-translational modification (PTM) of proteins. Hundreds ff fi 3.1. Proteomic Studies Employing Tagged of di erent modi cations exist. Release 66 of the RESID database1 (http://www.ebi.ac.uk/RESID/) contains 559 dif- Ubiquitin 7927 ferent modifications, including small chemical modifications 3.2. Ubiquitin Binding Domains 7927 such as phosphorylation, acetylation, and methylation and mod- 3.3. Anti-Ubiquitin Antibodies 7927 ification by small proteins, including ubiquitin and ubiquitin- 3.4.
[Show full text]
UBE2M Recombinant Protein Cat
UBE2M Recombinant Protein Cat. No.: 92-178 UBE2M Recombinant Protein Specifications SPECIES: Human SOURCE SPECIES: E. coli SEQUENCE: Met1-Lys183 FUSION TAG: Tag Free TESTED APPLICATIONS: APPLICATIONS: This recombinant protein can be used for biological assays. For research use only. PREDICTED MOLECULAR 20.9 kD WEIGHT: Properties Greater than 95% as determined by reducing SDS-PAGE. PURITY: Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. PHYSICAL STATE: Liquid Supplied as a 0.2 um filtered solution of 50mM HEPES,pH 7.5,2mM DTT,150mM BUFFER: NaCl,10%glycerol . It is not recommended to reconstitute to a concentration less than 100 ug/ml. September 29, 2021 1 https://www.prosci-inc.com/ube2m-recombinant-protein-92-178.html Store at -20˚C, stable for 6 months after receipt. STORAGE CONDITIONS: Please aliquot the reconstituted solution to minimize freeze-thaw cycles. Additional Info OFFICIAL SYMBOL: UBE2M NEDD8-conjugating enzyme Ubc12, NEDD8 carrier protein, NEDD8 protein ligase, ALTERNATE NAMES: Ubiquitin-conjugating enzyme E2 M, UBC12, UBE2M ACCESSION NO.: P61081 GENE ID: 9040 Background and References UBE2M is a member of the E2 ubiquitin-conjugating enzyme family. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin- conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This protein is linked with a ubiquitin-like protein, NEDD8, which can be conjugated to cellular proteins, such as Cdc53/culin. UBE2M accepts the ubiquitin-like protein NEDD8 from the UBA3-NAE1 E1 BACKGROUND: complex and catalyzes its covalent attachment to other proteins. The specific interaction with the E3 ubiquitin ligase RBX1, but not RBX2, suggests that the RBX1-UBE2M complex neddylates specific target proteins, such as CUL1, CUL2, CUL3 and CUL4.
[Show full text]
Monoclonal Anti-Human Adipon
monocl AAD0602 Monoclonal anti-adiponectin antibody (clone 1G12) 100ul 311-Eur ATGen onal monocl AAD0602 Monoclonal anti-adiponectin antibody (clone 1G12) 50ul 227-Eur ATGen onal monocl AAD0614 Monoclonal anti-human adiponectin antibody (clone 5H7) 100ul 311-Eur ATGen onal monocl AAD0614 Monoclonal anti-human adiponectin antibody (clone 5H7) 50ul 227-Eur ATGen onal monocl AAK0604 Monoclonal anti-human AK3 antibody (clone SJB3-36) 100ul 354-Eur ATGen onal monocl AAK0604 Monoclonal anti-human AK3 antibody (clone SJB3-36) 50ul 252-Eur ATGen onal monocl AAP0501 Monoclonal anti-human ANGPTL3 antibody (clone 1D10 ) 100ul 284-Eur ATGen onal monocl AAP0501 Monoclonal anti-human ANGPTL3 antibody (clone 1D10 ) 50ul 191-Eur ATGen onal monocl AAP0501 Monoclonal anti-human ANGPTL3 antibody (clone 1D10) 100ul 311-Eur ATGen onal monocl AAP0501 Monoclonal anti-human ANGPTL3 antibody (clone 1D10) 50ul 227-Eur ATGen onal monocl AAP0836 Monoclonal anti-human APP antibody (clone J4H9) 100ul 311-Eur ATGen onal monocl AAP0836 Monoclonal anti-human APP antibody (clone J4H9) 50ul 227-Eur ATGen onal monocl ABH0708 Monoclonal anti-human BHMT antibody (clone 3D6 ) 100ul 284-Eur ATGen onal monocl ABH0708 Monoclonal anti-human BHMT antibody (clone 3D6 ) 50ul 191-Eur ATGen onal monocl ABH0708 Monoclonal anti-human BHMT antibody (clone 3D6) 100ul 311-Eur ATGen onal monocl ABH0708 Monoclonal anti-human BHMT antibody (clone 3D6) 50ul 227-Eur ATGen onal monocl ABI0923 Monoclonal anti-human BID antibody (clone 4D3) 100ul 284-Eur ATGen onal monocl ABI0923 Monoclonal anti-human
[Show full text]
Human Induced Pluripotent Stem Cell–Derived Podocytes Mature Into Vascularized Glomeruli Upon Experimental Transplantation
BASIC RESEARCH www.jasn.org Human Induced Pluripotent Stem Cell–Derived Podocytes Mature into Vascularized Glomeruli upon Experimental Transplantation † Sazia Sharmin,* Atsuhiro Taguchi,* Yusuke Kaku,* Yasuhiro Yoshimura,* Tomoko Ohmori,* ‡ † ‡ Tetsushi Sakuma, Masashi Mukoyama, Takashi Yamamoto, Hidetake Kurihara,§ and | Ryuichi Nishinakamura* *Department of Kidney Development, Institute of Molecular Embryology and Genetics, and †Department of Nephrology, Faculty of Life Sciences, Kumamoto University, Kumamoto, Japan; ‡Department of Mathematical and Life Sciences, Graduate School of Science, Hiroshima University, Hiroshima, Japan; §Division of Anatomy, Juntendo University School of Medicine, Tokyo, Japan; and |Japan Science and Technology Agency, CREST, Kumamoto, Japan ABSTRACT Glomerular podocytes express proteins, such as nephrin, that constitute the slit diaphragm, thereby contributing to the ﬁltration process in the kidney. Glomerular development has been analyzed mainly in mice, whereas analysis of human kidney development has been minimal because of limited access to embryonic kidneys. We previously reported the induction of three-dimensional primordial glomeruli from human induced pluripotent stem (iPS) cells. Here, using transcription activator–like effector nuclease-mediated homologous recombination, we generated human iPS cell lines that express green ﬂuorescent protein (GFP) in the NPHS1 locus, which encodes nephrin, and we show that GFP expression facilitated accurate visualization of nephrin-positive podocyte formation in
[Show full text]
UBE2M (Ubc12) [Untagged] E2 – NEDD8 Conjugating Enzyme
UBE2M (Ubc12) [untagged] E2 – NEDD8 Conjugating Enzyme Alternate Names: Nedd8-conjugating enzyme Ubc12, UBC-RS2, UBC12. Cat. No. 62-0068-020 Quantity: 20 µg Lot. No. 1542 Storage: -70˚C FOR RESEARCH USE ONLY NOT FOR USE IN HUMANS CERTIFICATE OF ANALYSIS Page 1 of 2 Background Physical Characteristics The enzymes of the NEDDylation Species: human Protein Sequence: pathway play a pivotal role in a number GPGSPEFPGVDSKAAAMIKLFSLKQQKKEEE of cellular processes including the in- Source: E. coli expression SAGGTKGSSKKASAAQLRIQKDINELN direct regulation and targeting of sub- LPKTCDISFSDPDDLLNFKLVICPDE strate proteins for proteasomal degra- Quantity: 20 μg GFYKSGKFVFSFKVGQGYPHDPPKVKCET MVYHPNIDLEGNVCLNILREDWKPVLTIN dation. Three classes of enzymes are Concentration: 1 mg/ml SIIYGLQYLFLEPNPEDPLNKEAAEVLQN involved in the process of NEDDyla- NRRLFEQNVQRSMRGGYIGSTYFERCLK tion; the ubiquitin-like activating en- Formulation: 50 mM HEPES pH 7.5, zyme APP-BP1/Uba3 (E1), the ubiq- 150 mM sodium chloride, 2 mM The residues underlined remain after cleavage and removal uitin-like conjugating enzymes (E2s) dithiothreitol, 10% glycerol of the purification tag. UBE2M (regular text): Start bold italics (amino acid residues and protein ligases (E3s). UBE2M 1-183) is a member of the E2 conjugating Molecular Weight: ~22 kDa Accession number: AAH58924 enzyme family and the cDNA for hu- man UBE2M was first described by Purity: >98% by InstantBlue™ SDS-PAGE Osaka et al. (1998) and shares 42% Stability/Storage: 12 months at -70˚C; sequence identity with yeast UBE2M. aliquot as required A trapped ubiquitin like activation complex has been described for the NEDD8 pathway comprising, the E1 Quality Assurance APP-BP1/Uba3, two NEDD8 mole- cules, UBE2M and MgATP. Thioester Purity: Protein Identification: linkage of NEDD8 to APP-BP1-Uba3 4-12% gradient SDS-PAGE Confirmed by mass spectrometry.
[Show full text]
Antigens STAT1, 1-712Aa, Human, His Tag, E.Coli, Recombinant Monoclonal Antibody Anti-CD34 Polyclonal Antibody Anti-Decorin
Antigens STAT1, 1-712aa, Human, His tag, E.coli, 01-0102 Recombinant 10 193-Eur ARP 01-0395M Monoclonal antibody Anti-CD34 200 μl 237-Eur ARP 01-1001G Polyclonal antibody Anti-Decorin, Mouse 200 237-Eur ARP 01-1001M Monoclonal antibody Anti-Decorin, human 50 270-Eur ARP 01-1002 Antigens Decorin, mouse 100 237-Eur ARP 01-1002R Monoclonal antibody Anti-Decorin, Mouse 200 270-Eur ARP 01-1244 Polyclonal antibody Anti-Presenilin 1, C-terminal 100 237-Eur ARP 01-1245 Polyclonal antibody Anti-Presenilin 1, N-terminal 200 237-Eur ARP Polyclonal antibody Anti- Hepatocyte Growth Factor alpha 01-1358 (HGF alpha) 200 237-Eur ARP 01-1541 Polyclonal antibody Anti-SHMT1 (Cytoplasma) 200 237-Eur ARP Antigens Thiosulfate sulfurtransferase, 1-297 aa, Human, 01-1742 E.coli, Recombinant 50 215-Eur ARP Antigens GAMT, 1-236aa, Human, His tag, E.coli, 01-1743 Recombinant 20 193-Eur ARP Antigens Stress-induced-phosphoprotein 1, 1- 01-1744 543aa,Human, His tag, E.coli, Recombinant 10 215-Eur ARP 01-1745 Antigens SKP1, 1- 160aa, Human, E.coli, Recombinant 20 193-Eur ARP Antigens Alcohol dehydrogenase, 1-325aa, Human, E.coli, 01-1746 Recombinant 10 193-Eur ARP Antigens ATOX1, 1-68aa, Human, His tag, E.coli, 01-1747-1 Recombinant 10 193-Eur ARP Antigens Ketohexokinase, 1-298aa, Human, E.coli, 01-1748 Recombinant 20 193-Eur ARP Antigens BAALC, 1-145aa, Human, His tag, E.coli, 01-1749 Recombinant 20 281-Eur ARP 01-1750 Antigens CAPG, 1-348aa, Human, E.coli, Recombinant 10 193-Eur ARP 01-1751-1 Antigens BAG1, 1-230aa, Human, E.coli, Recombinant 10 226-Eur ARP Antigens
[Show full text]
Comparative Analysis of the Ubiquitin-Proteasome System in Homo Sapiens and Saccharomyces Cerevisiae
Comparative Analysis of the Ubiquitin-proteasome system in Homo sapiens and Saccharomyces cerevisiae Inaugural-Dissertation zur Erlangung des Doktorgrades der Mathematisch-Naturwissenschaftlichen Fakultät der Universität zu Köln vorgelegt von Hartmut Scheel aus Rheinbach Köln, 2005 Berichterstatter: Prof. Dr. R. Jürgen Dohmen Prof. Dr. Thomas Langer Dr. Kay Hofmann Tag der mündlichen Prüfung: 18.07.2005 Zusammenfassung I Zusammenfassung Das Ubiquitin-Proteasom System (UPS) stellt den wichtigsten Abbauweg für intrazelluläre Proteine in eukaryotischen Zellen dar. Das abzubauende Protein wird zunächst über eine Enzym-Kaskade mit einer kovalent gebundenen Ubiquitinkette markiert. Anschließend wird das konjugierte Substrat vom Proteasom erkannt und proteolytisch gespalten. Ubiquitin besitzt eine Reihe von Homologen, die ebenfalls posttranslational an Proteine gekoppelt werden können, wie z.B. SUMO und NEDD8. Die hierbei verwendeten Aktivierungs- und Konjugations-Kaskaden sind vollständig analog zu der des Ubiquitin- Systems. Es ist charakteristisch für das UPS, daß sich die Vielzahl der daran beteiligten Proteine aus nur wenigen Proteinfamilien rekrutiert, die durch gemeinsame, funktionale Homologiedomänen gekennzeichnet sind. Einige dieser funktionalen Domänen sind auch in den Modifikations-Systemen der Ubiquitin-Homologen zu finden, jedoch verfügen diese Systeme zusätzlich über spezifische Domänentypen. Homologiedomänen lassen sich als mathematische Modelle in Form von Domänen- deskriptoren (Profile) beschreiben. Diese Deskriptoren können wiederum dazu verwendet werden, mit Hilfe geeigneter Verfahren eine gegebene Proteinsequenz auf das Vorliegen von entsprechenden Homologiedomänen zu untersuchen. Da die im UPS involvierten Homologie- domänen fast ausschließlich auf dieses System und seine Analoga beschränkt sind, können domänen-spezifische Profile zur Katalogisierung der UPS-relevanten Proteine einer Spezies verwendet werden. Auf dieser Basis können dann die entsprechenden UPS-Repertoires verschiedener Spezies miteinander verglichen werden.
[Show full text]
UBE2M (Ubc12) [GST-Tagged] E2 - NEDD8 Conjugating Enzyme
UBE2M (Ubc12) [GST-tagged] E2 - NEDD8 Conjugating Enzyme Alternate Names: Nedd8-conjugating enzyme Ubc12, UBC-RS2, UBC12 Cat. No. 62-0088-100 Quantity: 100 µg Lot. No. 1840 Storage: -70˚C FOR RESEARCH USE ONLY NOT FOR USE IN HUMANS CERTIFICATE OF ANALYSIS Page 1 of 2 Background Physical Characteristics The enzymes of the NEDDylation Species: human Protein Sequence: pathway play a pivotal role in a number MSPILGYWKIKGLVQPTRLLLEYLEEKYEEH of cellular processes including the in- Source: E. coli expression LYERDEGDKWRNKKFELGLEFPNLPYYIDGD VKLTQSMAIIRYIADKHNMLGGCPKERAEISMLE direct regulation and targeting of sub- Quantity: 100 μg GAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEM strate proteins for proteasomal degra- LKMFEDRLCHKTYLNGDHVTHPDFMLYDALDV dation. Three classes of enzymes are Concentration: 1 mg/ml VLYMDPMCLDAFPKLVCFKKRIEAIPQIDKY involved in the process of NEDDyla- LKSSKYIAWPLQGWQATFGGGDHPPKSDLEV LFQGPLGSPGIPGSTRAAAMIKLFSLKQQKKEEE tion; the ubiquitin-like activating en- Formulation: 50 mM HEPES pH 7.5, SAGGTKGSSKKASAAQLRIQKDINELNLPKTCD zyme APP-BP1/Uba3 (E1), the ubiq- 150 mM sodium chloride, 2 mM ISFSDPDDLLNFKLVICPDEGFYKSGKFVFS uitin-like conjugating enzymes (E2s) dithiothreitol, 10% glycerol FKVGQGYPHDPPKVKCETMVYHPNIDLEGNVCL and protein ligases (E3s). UBE2M is NILREDWKPVLTINSIIYGLQYLFLEPNPED a member of the E2 conjugating en- Molecular Weight: ~49 kDa PLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTY zyme family and the cDNA for Hu- FERCLK man UBE2M was first described by Purity: >98% by InstantBlue™ SDS-PAGE Tag (bold text): N-terminal GST Osaka et al. (1998) and shares 42% Protease cleavage site: PreScission™ (LEVLFQ▼GP) Stability/Storage: 12 months at -70˚C; sequence identity with yeast UBE2M. UBE2M (regular text): Start bold italics (amino acid residues aliquot as required 1-183) A trapped ubiquitin like activation Accession number: AAH58924 complex has been described for the NEDD8 pathway comprising, the E1 Quality Assurance APP-BP1/Uba3, two NEDD8 mole- cules, UBE2M and MgATP.
[Show full text]
Therapeutic Strategies Within the Ubiquitin Proteasome System
Cell Death and Differentiation (2010) 17, 4–13 & 2010 Macmillan Publishers Limited All rights reserved 1350-9047/10 $32.00 www.nature.com/cdd Review Therapeutic strategies within the ubiquitin proteasome system AG Eldridge1 and T O’Brien*,1 The ubiquitin-dependent proteolysis system (UPS) is the main driver of regulated protein degradation in all eukaryotic cells, and it is becoming increasingly clear that defects within this pathway drive a large number of human pathologies. Recent success in the use of proteasome inhibitors in the treatment of hematological malignancies validates the UPS as a viable therapeutic pathway, and substantial effort is now focused on the development of both second-generation proteasome inhibitors as well as novel strategies for the inhibition of upstream UPS enzymes. In this review we discuss the potential ‘druggability’ of key nodes within the UPS and summarize recent advances within the ﬁeld. Cell Death and Differentiation (2010) 17, 4–13; doi:10.1038/cdd.2009.82; published online 26 June 2009 It is now widely appreciated that the UPS plays a critical role through ubiquitin Lys48 target the ubiquitinated substrate for in regulating a wide variety of cellular pathways, including destruction at the proteasome, a multi-subunit barrel-shaped cell growth and proliferation,1 apoptosis,2 protein quality cellular protease containing activities that recognize and control,3,4 DNA repair,5 transcription,6 and immune response.7,8 unfold proteolytic targets as well as mediate their degradation. Moreover, defects in these
[Show full text]
Cascade Profiling of the Ubiquitin-Proteasome System in Cancer Anastasiia Rulina
Cascade profiling of the ubiquitin-proteasome system in cancer Anastasiia Rulina To cite this version: Anastasiia Rulina. Cascade profiling of the ubiquitin-proteasome system in cancer. Agricultural sciences. Université Grenoble Alpes, 2015. English. NNT : 2015GREAV028. tel-01321321 HAL Id: tel-01321321 https://tel.archives-ouvertes.fr/tel-01321321 Submitted on 25 May 2016 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. THÈSE Pour obtenir le grade de DOCTEUR DE L’UNIVERSITÉ GRENOBLE ALPES Spécialité : Biodiversite du Developpement Oncogenese Arrêté ministériel : 7 août 2006 Présentée par Anastasiia Rulina Thèse dirigée par Maxim Balakirev préparée au sein du Laboratoire BIOMICS dans l'École Doctorale Chimie et Sciences du Vivant Profilage en cascade du système ubiquitine- protéasome dans le cancer Thèse soutenue publiquement le «17/12/2015», devant le jury composé de : M. Damien ARNOULT Docteur CR1, CNRS, Rapporteur M. Matthias NEES Professor Adjunct, University of Turku, Rapporteur M. Philippe SOUBEYRAN Docteur, INSERM, Membre Mme. Jadwiga CHROBOCZEK Directeur de recherche DR1, CNRS, Membre M. Xavier GIDROL Directeur de laboratoire, CEA, Président du jury M. Maxim BALAKIREV Docteur, CEA, Membre, Directeur de Thèse 2 Я посвящаю эту научную работу моей маме, Рулиной Людмиле Михайловне, с любовью и благодарностью.
[Show full text]