DOCSLIB.ORG

The$Interferon$System$

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
The$Interferon$System$ The$Interferon$System$ Takashi$Fujita$ Ins5tute$for$Virus$Research$ Kyoto$University$ Days$aFer$influenza$virus$infec5on Fields$Virology:pp1402$ Fever $ $ Neutralizing$an5body$ Nasal$wash$ Interferon Virus Neutralizing$an5body$ Serum Days Infec5ous$Diseases Pathogen Human$(Animal) Human$(Animal) Bacteria Parasites Viruses others Virions Vaccinia Herpes Adeno Papilloma Reo Sindbis Polio Influenza VIRAL$ENTRY outside cytoplasm nucleus Fields$VIROLOGY VIRAL$EXIT nucleus cytoplasm outside Fields$VIROLOGY Yasuichi$Nagano$ Yasuhiko$Kojima Interfering$Factor$(1954)$ Alick$Isaacs Jean$Lindenmann Interferon$(1957)$ VIRUS$INFECTION VIRUS$INFECTION INTERFERON0 REPLICATION$$ OF$$ PICORNAVIRUS dsRNA$ $(Replica5ve$Intermediate) dsRNA$ $(Replica5ve$Form) Fields$VIROLOGY ]IFN,$+EMCV$infec5on$ +IFN,$+EMCV$infec5on$ EMCV:&Non*enveloped,&+strand&RNA&virus& CELLS$INFECTED$$ WITH$$ RABIES$VIRUS VIRION$OF$$RABIES$VIRUS REPLICATION$OF$RHABDOVIRUS RdRP dsRNA$ Transla5on Fields$VIROLOGY 1000$U/ml$Interferon]β Vesicular$Stoma55s$Virus Vesicular$Stoma55s$Virus An:viral&Effect&of&Interferon How$Interferon$Works? Action of Interferon Interferon JAK0 JAK0 STAT0 STAT0 STATSTAT0 0 IRF*90 An5viral$State ISGs0IFN0genes0ISGs0 ISGs:&Interferon&S:mulated&Genes Viruses$ PENETRATION$ UNCOATING$ Antiviral Proteins$ TRANSCRIPTION$ PKR OAS Tetherin Etc. TRANSLATION$ ASSEMBLY $ RELEASE OF PROGENY VIRUSES$ Antiviral State$ Tetherin/BST]2/CD137 How$Interferon$is$Produced? Production of Interferon VIRUS$ Interferon Viral&Replica:on& Viral&RNA& Viral0RNA0Sensors0 IRF63,0IRF670 NF6κB0 Interferon0Genes0 Regulatory&Sequences&& for&IFN&and&IFN*inducible&genes$ IFN Regulatory Factor ATF-2/c-jun (IRF) NF-κB IFN genes ATF/CREB PRDII PRDIII PRDI -110 -100 -90 -80 -70 -60 IFN-β gene: AAAATGTAAATGACATAGGAAAACTGAAAGGGAGAAGTGAAAGTGGGAAATTCCTCTGAAT IFN-α1 gene: GAGTGCATGAAGGAAAGCAAAAACAGAAATGGAAAGTGGCCCAGAA -100 -90 -80 -70 GAAAGTGAAAGTG TG IFN-inducible genes 2’-5’AS : AGGAAA-CGAAACCA PKR : GGGAAAACGAAACAG GBP-1 : ATGAAACTGAAAGTA ISG15 : GGGAAACCGAAACTG ANGAAANNGAAACT G Studies$in$late$1980’s ISRE Interferon&Regulatory&Factors&(IRFs)& DNA&Binding&Domain& N& C& IRF*1&& Ac5vator,$Ubiquitous$ $$$$$$$$]]]Immunomodula5on,$$Tumor$suppressor]like$ IRF*2& Repressor,$Ubiquitous$ $$$$$$$$]]]$Immunomodula5on,$$Oncogenic$func5on$ IRF*4&(Pip/LSIRF)& Ac5vator,$Lymphoid$specific$ $$$$$$$]]]$Lymphocyte$development,$Oncogenic$func5on$ IRF*8&(ICSBP)& Repressor/Ac5vator,$Lymphoid$specific$ $$$$$$$]]]$Lymphocyte$development,$Tumor$suppressor]like$ IRF*9&(ISGF3γ)& Ac5vator$(DNA$binding$subunit$of$ISGF3),$Ubiquitous$ $$$$$$$]]]$IFN]signaling$ IRF*3& Ac5vator,$Ubiquitous$ $$$$$$$$]]]$Induc5on$of$IFN]α/β$genes$ IRF*7& Ac5vator,$Ubiquitous,$IFN]inducible$ $$$$$$$]]]$Induc5on$of$IFN]α/β$genes$ IRF*5& Ac5vator?,$IFN]inducible?$ IRF*6& Repressor?$ Studies$in$1990’s Ectopic&Expression&of&IRF*3&Augments&& IFN*α,&*β&Promoter&Ac:vity& 80 60 40 20 0 NDV: cont. IRF-3 cont. IRF-3 cont. IRF-3 cont. IRF-3 cont. IRF-3 p-55Luc p-125Luc pαLuc p-55C1BLuc p-55A2Luc (control) (IFN- β) (IFN- α) (PRDI) 8 (PRDII) 3 . L929 DNA&binding&Complex&Induced&by&Virus&Infec:on . (HA-IRF-3) F5 VA-IRF ISGF3 controlControl$ αAn5$IRF]3$IRFー3 αAn5$HA$HA αAn5$p300$p300 αAn5$CBP$CBP An5$p300+CBPαp300 + αCBP Anitibodies $ NDV F5 (HA-IRF-3) cells VA-IRF ISGF3 control Control$ αAn5$IRF]3$IRFー3 αAn5$p300$p300 αAn5$CBP$CBP An5$p300+CBPαp300 + αCBP HEC-1 (IFNR VA-IRF - ) Time&course&of&polyI:C*induced&Nuclear&Transloca:on&& of&Endogenous&IRF*3&and&NF*κB&in&HeLa&Cells& IRF-3 PolyI:C 0' 10' 20' 30' 60' NF-κB (p50) IFN gene regulation by IRF-3$ vector$IRF]3$ ]$ +$ ]$ +$ :NDV:$ ]$ +$ Western$ dimer$ IRF]3$ IRF]3$ 32P$ monomer$ mock$ NDV$ Na5ve/Western$ Signal p300/CBP IFN genes IRF-3 Crystal$Strucuture$of$IRF]3$ Graduate School of Pharmaceutical Sciences Hokkaido University & CREST/JST, Kawaguchi Kiyohiro Takahasi Nobuo N. Suzuki Masataka Horiuchi Hiroaki Terasawa & Fuyuhiko Inagaki Potential phosphorylation sites in IRF-3 regulatory domain� IRF-3 N C WT:$ LVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES 374& 385&386& 427& 386A:$LVEMARVGGASALENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGES →No$ac5va5on$ P 5D:$ LVEMARVGGASSLENTVDLHIDNDHPLDLDDDQYKAYLQDLVEGMDFQGPGES →Cons5tu5ve$ac5ve$ 5A:$ LVEMARVGGASSLENTVDLHIANAHPLALAADQYKAYLQDLVEGMDFQGPGES →Virus]inducible$ac5va5on$ Purifica:on&of&&recombinant&IRF*3&from&E.Coli& (A)$ IPTG� (B)$ +GroE� +Trx� S: 200� I$: M� S� I� S� I� S� I� S� I� 116� 116� 66� GroEL� 66� 42� His - ΔIRF3 � 42� 30� 175-427� His]ΔIRF3$ 30� 17� GroES� $$$$$$175]427$ CBB Trx� 5� 6� 7� 8� 17� CBB αHis His - ΔIRF3 � 175-427� IRF]3$Regulatory$Domain Smad$Regulatory$Domain Quasi&dimer&in&the&crystal& R211 K360 R213 S386 G212 R361 L387 SRR-loop HLR-pocket S385 F209 W345 Ser386 L299 IRF*3& Smad& Ac:va:on&of&IRF*3&and&Smad& at&Low&Resolu:on& TBK]1,$IKK]i(ε)!p]IRF]3,$p]IRF]7$ $ IKK(α, β, γ)!p]IκB$ Regula5on$of$An5viral$Innate$ Immunity$by$RIG]I]Like$Receptors$ Takashi$Fujita$ Ins5tute$for$Virus$Research$ Kyoto$University$ Virus- and IFN-induced Signals Virus dsRNA IFNs IFN Receptor RIG*I cytoplasm IFN-α genes IRF*3 IRF*3 IFN-β gene IFN inducible genes nuclear Antivirus activities Helicase Domain: Conformational Change ? Signaling Domain RNA Binding Domain Conserved helicase motifs CARD 1 a 925 RIG-I: * T55I K270 : ATP Binding 23 35 41 % % % 1025 1 MDA5: 31 % 1 678 LGP2: RNA Binding Domain RIG*I*Like&Receptor&(RLR) [kDa] 116 input polyI:C-pulldown competitor: polyI:C polyA:U polyA dsDNA RIG-I RIG]I$Binds$to$dsRNA$but$not$ssRNA$or$dsDNA$ Ac5va5on$of$RLRExposure$of$CARD CTD CTD 3 OFF 3 OFF 1 2 1 2 CARD CARD ON CARD Analysis&of&RIG*I*/*&and&MDA5*/*&mice& & Kato, H., Sato, S., Yoneyama, M., Yamamoto, M., Uematsu, S., Matsui, K., Tsujimura, T., Takeda, K., Fujita, T., Takeuchi, O., and Akira, S. Immunity 23, 19-28, (2005) Kato, H., Takeuchi, O., Sato, S., Yoneyama, M., Yamamoto, M., Matsui, K., Uematsu, S., Jung, A., Kawai, T., Ishii, K. J., Yamaguchi, O., Otsu, K., Tsujimura, T., Koh, C-S., Reis e Sousa, C., Matsuura, Y., Fujita, T. and Akira, S. Nature 441, 101-105 (2006) IFN$gene$induc5on$by$MEFs$from$KO$mice$ JEV$challenge$to$KO$mice$ EMCV$challenge$to$KO$mice$ Differen5al$Func5ons$of$RIG]I$Family$ Helicases$ NDV,$Sendai$virus,$ RIG]I$ Posi5ve$ Influenza$virus,$VSV,$JEV,$ Regulator$ WN,$etc.$$ MDA5$ Posi5ve$ Picorna$viruses,$WN,$ Regulator$ etc.$$ LGP2$ Posi5ve$Regulator$ EMCV,$VSV$ A B WT kbp 10 RIG-I-/- MDA5-/- 7.7 8 4.2 RIG-I -/- MDA5 -/- * Not detected 1.3 6 (ng/ml) β 4 0.3 IFN- 2 * * * * * * * * * * * * 0 M 0 1 5 10 30 60 M mock 0 60 180 RNaseIII treatment (min) RNaseIII treatment (min) C D WT RIG-I-/- MDA5-/- 100 RNaseA Bal31 hydrolysis 80 8 WT 3 60 MDA5-/- 1.6 (ng/ml) 6 RIG-I -/- β 2 40 IFN- 4 0.8 Relative induction (%) Relative induction 20 1 2 0 0 1 5 10 30 60 0 0 0 RNaseIII treatment (min) Kato,$H.$et$al,$JEM,$2008$ RNA$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$structure$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$RLR$ pp$ Short$poly$I:C$ pp$ RIG]I$ $$$$(~300$bp)$ $ $ $ pp$ MDA5$ Long$poly$I:C$ pp$ $$$$(>$4$kbp)$ $ $ $ RIG]I$ in$vitro$T7$transcript$ ppp$ $$(with$copyback)$ $ $ $ $ $ $ ppp$ (polyU,$UC)n$ RIG]I HCV$RNA$ $ $ $ $ $ $$p$ RNaseL$cleavage$product$ p$ RIG]I $$(RNA$of$host/virus)$ (MDA5)$ $ $ Viral$genomic$RNA$ $ (with$panhandle$structure)$ ppp$ RIG]I $ $ $ $ RNA$of$DI$par5cle$ $ $$$$$$$(copyback)$ ppp$ Uniden5fied$ $ $ $ $ High$molecular$weight$RNA$ MDA5 $$$$$(RNA$web)$ $ ? $ $ Helicase Domain: Conformational Change ? Signaling Domain RNA Binding Domain Conserved helicase motifs CARD Repression 1 a Domain 925 RIG-I: * T55I K270 : ATP Binding 23 35 41 % % % 1025 1 MDA5: 31 % 1 678 LGP2: RNA Binding Domain Repression RIG-I Like Receptors (RLR) Domain CTD 3 1 2 RIG*I CARD dsRNA CARD CARD RIG]I$func5ons$as$double]stranded$RNA$sensor/signaling$switch Intracellular$localiza5on$of$RIG]I$$ and$an5viral$innate$immunity Viral$Transcrip5on RIG6I Viral$RNA$ Viral$Transla5on $ (dsRNA) Viral$Protein Virion$Packaging REPLICATION$ $OF$$ INFLUENZA$VIRUS 1 8 2 6 5 7$Nucleocapsid 4 3 Fields$VIROLOGY Non]structural$Protein$1:$$ $$$$$$$$$$$$$$$$$$$$$$$$$Strong$Antagonist$of$Interferon$System 5’ ppp- 3’ “Panhandle”$Structure$ Natural0Ligand0for0RIG6I Genomic$RNA$of$Influenza$A$virus IAV PR8 IAV deltaNS1 0h 3h 6h 9h 12h 0h 3h 6h 9h 12h IRF-3 RIG-I PKR phospho PKR (Thr446) phospho eIF2α (Ser51) NP actin RIG-I Flu NP TIAR RIG-I Flu NP TIAR 0h 0h 3h 3h 6h 6h 9h 9h 12h 12h IAV PR8 IAV ΔNS1 Stress$Signals$ (Virus$Infec5on,$heat$shock$etc.)$ PKR$(dsRNA)$ GCN2$(aa.$Starva5on)$ HRI$(oxida5on)$ PERK$(ER$stress)$ eIF2α$Phosphoryla5on$(Ser51)$ RLR) TIAR& Forma5on$of$ TIA1& Stress$Granules$ eIF3$ G3BP& HuR$ PABP$ RIG]I G3BP DAPI merge mock IAV$ IFN ⊿NS1$ NaAsO2 NO$IFN Oxida:ve&Stress&Induces&SG&but&not&Interferon vRNA/FISH& NP/IF& Merge& Mock& IAV& ΔNS1& Virus]induced$SG$contains$viral$RNA$$$$$(an5$virus$SG) MDA5 G3BP1 PI DAPI MERGE MOCK EMCV MDA5 TIAR PI DAPI MERGE MOCK EMCV Colocaliza5on$of$MDA5,$SG$markers$and$viral$dsRNA ppp NUCLEUS Influenza$genomic$RNA NS1 PKR& CYTOPLASM RLR) TIAR$ Forma5on$of$ TIA1$ Stress$Granules$ eIF3$ G3BP$ HuR$ PABP$ RLR)ac,va,on) eIF2α$Phosphoryla5on) $(Ser51)$ Virus&infec:on&and&& & Stress)Granule& Stable Stable Transient Transient Alternate Alternate Different)Paterns)of)SG)forma,on)) By)viral)infec,on) A NDV B IAV C D E IAV∆NS1 EMCV SINV **& 100 120 **& 100 100 *& 100 **& 80 80 **& 80 80 60 60 60 60 40 40 40 40 SG Pattern (%) SG Pattern SG Pattern (%) 20 (%) SG Pattern 20 (%) SG Pattern 20 Cells with Cells Distinct 20 Cells with Distinct with Cells Distinct with Cells Distinct N.D. N.D. N.D. N.D. N.D. N.D. N.D. N.D. N.D. N.D. 0 0 0 0 Adeno5∆E1A Adeno5WT F PolioV G SeV H VSV I J 120 120 120 100 120 **& **& **& *& 100 100 100 80 *& 100 80 80 80 80 60 60 60 60 60 40 40 40 40 40 SG Pattern (%) SG Pattern (%) SG Pattern SG Pattern (%) SG Pattern (%) SG Pattern 20 Cells with Distinct Cells with Cells Distinct Cells with Cells Distinct 20 with Cells Distinct 20 20 20 N.D.
Load more

Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Α Are Regulated by Heat Shock Protein 90
    The Levels of Retinoic Acid-Inducible Gene I Are Regulated by Heat Shock Protein 90- α Tomoh Matsumiya, Tadaatsu Imaizumi, Hidemi Yoshida, Kei Satoh, Matthew K. Topham and Diana M. Stafforini This information is current as of October 2, 2021. J Immunol 2009; 182:2717-2725; ; doi: 10.4049/jimmunol.0802933 http://www.jimmunol.org/content/182/5/2717 Downloaded from References This article cites 44 articles, 19 of which you can access for free at: http://www.jimmunol.org/content/182/5/2717.full#ref-list-1 Why The JI? Submit online. http://www.jimmunol.org/ • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average by guest on October 2, 2021 Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2009 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology The Levels of Retinoic Acid-Inducible Gene I Are Regulated by Heat Shock Protein 90-␣1 Tomoh Matsumiya,*‡ Tadaatsu Imaizumi,‡ Hidemi Yoshida,‡ Kei Satoh,‡ Matthew K. Topham,*† and Diana M. Stafforini2*† Retinoic acid-inducible gene I (RIG-I) is an intracellular pattern recognition receptor that plays important roles during innate immune responses to viral dsRNAs.
    [Show full text]
  • Protein Stability: a Crystallographer's Perspective
    IYCr crystallization series Protein stability: a crystallographer’s perspective Marc C. Deller,a* Leopold Kongb and Bernhard Ruppc,d ISSN 2053-230X aStanford ChEM-H, Macromolecular Structure Knowledge Center, Stanford University, Shriram Center, 443 Via Ortega, Room 097, MC5082, Stanford, CA 94305-4125, USA, bLaboratory of Cell and Molecular Biology, National Institute of Diabetes and Digestive and Kidney Diseases (NIDDK), National Institutes of Health (NIH), Building 8, Room 1A03, 8 Center Drive, Bethesda, MD 20814, USA, cDepartment of Forensic Crystallography, k.-k. Hofkristallamt, 91 Audrey Place, Vista, CA 92084, USA, and dDepartment of Genetic Epidemiology, Medical University of Innsbruck, Received 27 November 2015 Schopfstrasse 41, A-6020 Innsbruck, Austria. *Correspondence e-mail: [email protected] Accepted 21 December 2015 ¨ Edited by H. M. Einspahr, Lawrenceville, USA Protein stability is a topic of major interest for the biotechnology, pharmaceutical and food industries, in addition to being a daily consideration Keywords: protein stability; protein for academic researchers studying proteins. An understanding of protein crystallization; protein disorder; crystallizability. stability is essential for optimizing the expression, purification, formulation, storage and structural studies of proteins. In this review, discussion will focus on factors affecting protein stability, on a somewhat practical level, particularly from the view of a protein crystallographer. The differences between protein conformational stability and protein
    [Show full text]
  • RAB-GAP Immunity Signaling by the Tbc1d23 Spatiotemporal Inhibition
    Downloaded from http://www.jimmunol.org/ by guest on September 27, 2021 is online at: average * The Journal of Immunology , 17 of which you can access for free at: 2012; 188:2905-2913; Prepublished online 6 from submission to initial decision 4 weeks from acceptance to publication February 2012; doi: 10.4049/jimmunol.1102595 http://www.jimmunol.org/content/188/6/2905 Spatiotemporal Inhibition of Innate Immunity Signaling by the Tbc1d23 RAB-GAP Lesly De Arras, Ivana V. Yang, Brad Lackford, David W. H. Riches, Rytis Prekeris, Jonathan H. Freedman, David A. Schwartz and Scott Alper J Immunol cites 58 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription http://www.jimmunol.org/content/suppl/2012/02/06/jimmunol.110259 5.DC1 This article http://www.jimmunol.org/content/188/6/2905.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 27, 2021. The Journal of Immunology Spatiotemporal Inhibition of Innate Immunity Signaling by the Tbc1d23 RAB-GAP Lesly De Arras,*,† Ivana V. Yang,†,‡ Brad Lackford,x David W.
    [Show full text]
  • The Role of MDM2–P53 Axis Dysfunction in the Hepatocellular
    Cao et al. Cell Death Discovery (2020) 6:53 https://doi.org/10.1038/s41420-020-0287-y Cell Death Discovery REVIEW ARTICLE Open Access TheroleofMDM2–p53 axis dysfunction in the hepatocellular carcinoma transformation Hui Cao1, Xiaosong Chen2, Zhijun Wang3,LeiWang1,QiangXia2 and Wei Zhang1 Abstract Liver cancer is the second most frequent cause of cancer-related death globally. The main histological subtype is hepatocellular carcinoma (HCC), which is derived from hepatocytes. According to the epidemiologic studies, the most important risk factors of HCC are chronic viral infections (HBV, HCV, and HIV) and metabolic disease (metabolic syndrome). Interestingly, these carcinogenic factors that contributed to HCC are associated with MDM2–p53 axis dysfunction, which presented with inactivation of p53 and overactivation of MDM2 (a transcriptional target and negative regulator of p53). Mechanically, the homeostasis of MDM2–p53 feedback loop plays an important role in controlling the initiation and progression of HCC, which has been found to be dysregulated in HCC tissues. To maintain long-term survival in hepatocytes, hepatitis viruses have lots of ways to destroy the defense strategies of hepatocytes by inducing TP53 mutation and silencing, promoting MDM2 overexpression, accelerating p53 degradation, and stabilizing MDM2. As a result, genetic instability, chronic ER stress, oxidative stress, energy metabolism switch, and abnormalities in antitumor genes can be induced, all of which might promote hepatocytes’ transformation into hepatoma cells. In addition, abnormal proliferative hepatocytes and precancerous cells cannot be killed, because of hepatitis viruses-mediated exhaustion of Kupffer cells and hepatic stellate cells (HSCs) and CD4+T cells by disrupting their MDM2–p53 axis.
    [Show full text]
  • Bioinformatics Analysis of the CDK2 Functions in Neuroblastoma
    MOLECULAR MEDICINE REPORTS 17: 3951-3959, 2018 Bioinformatics analysis of the CDK2 functions in neuroblastoma LIJUAN BO1*, BO WEI2*, ZHANFENG WANG2, DALIANG KONG3, ZHENG GAO2 and ZHUANG MIAO2 Departments of 1Infections, 2Neurosurgery and 3Orthopaedics, China-Japan Union Hospital of Jilin University, Changchun, Jilin 130033, P.R. China Received December 20, 2016; Accepted November 14, 2017 DOI: 10.3892/mmr.2017.8368 Abstract. The present study aimed to elucidate the poten- childhood cancer mortality (1,2). Despite intensive myeloabla- tial mechanism of cyclin-dependent kinase 2 (CDK2) in tive chemotherapy, survival rates for neuroblastoma have not neuroblastoma progression and to identify the candidate substantively improved; relapse is common and frequently genes associated with neuroblastoma with CDK2 silencing. leads to mortality (3,4). Like most human cancers, this child- The microarray data of GSE16480 were obtained from the hood cancer can be inherited; however, the genetic aetiology gene expression omnibus database. This dataset contained remains to be elucidated (3). Therefore, an improved under- 15 samples: Neuroblastoma cell line IMR32 transfected standing of the genetics and biology of neuroblastoma may with CDK2 shRNA at 0, 8, 24, 48 and 72 h (n=3 per group; contribute to further cancer therapies. total=15). Significant clusters associated with differen- In terms of genetics, neuroblastoma tumors from patients tially expressed genes (DEGs) were identified using fuzzy with aggressive phenotypes often exhibit significant MYCN C-Means algorithm in the Mfuzz package. Gene ontology and proto-oncogene, bHLH transcription factor (MYCN) amplifi- pathway enrichment analysis of DEGs in each cluster were cation and are strongly associated with a poor prognosis (5).
    [Show full text]
  • Heat Shock Protein 90, a Potential Biomarker for Type I
    HEAT SHOCK PROTEIN 90, A POTENTIAL BIOMARKER FOR TYPE I DIABETES: MECHANISMS OF RELEASE FROM PANCREATIC BETA CELLS Gail Jean Ocaña Submitted to the faculty of the University Graduate School in partial fulfillment of the requirements for the degree Doctor of Philosophy in the Department of Microbiology and Immunology, Indiana University July 2016 Accepted by the Graduate Faculty of Indiana University, in partial fulfillment of the requirements for the degree of Doctor of Philosophy. _____________________________________ Janice S. Blum, Ph.D., Chair Doctoral Committee _____________________________________ Mark H. Kaplan, Ph.D. May 23, 2016 _____________________________________ C. Henrique Serezani, Ph.D. _____________________________________ Jie Sun, Ph.D. ii DEDICATION This work is dedicated to my family and friends for all of your needs and intentions. iii ACKNOWLEDGEMENTS I must start off by thanking my mentor, Dr. Janice Blum. Thank you for taking a chance on me and accepting me into your lab. Thank you also for your exemplary training and guidance. I feel blessed to have gotten the chance to work for such a respectful and understanding mentor who always puts the interests of students above her own. I have learned so much from you about what it takes to be a good scientist, and I hope I can live up to your example in my future career. Thank you also to my committee members Dr. Mark Kaplan, Dr. Henrique Serezani, and Dr. Jie Sun for your helpful feedback, suggestions, and free access to lab equipment and reagents. I am also grateful to my former mentor Dr. Rebecca Shilling for getting me off to a great start in graduate school as well as my former committee member Dr.
    [Show full text]
  • ISG15, a Small Molecule with Huge Implications: Regulation of Mitochondrial Homeostasis
    viruses Review ISG15, a Small Molecule with Huge Implications: Regulation of Mitochondrial Homeostasis Manuel Albert † , Martina Bécares †, Michela Falqui, Carlos Fernández-Lozano and Susana Guerra * Department of Preventive Medicine, Public Health and Microbiology, Universidad Autónoma, E-28029 Madrid, Spain; [email protected] (M.A.); [email protected] (M.B.); [email protected] (M.F.); [email protected] (C.F.-L.) * Correspondence: [email protected]; Tel.: +34-91/497-5440; Fax: +34-91/497-5353 † These authors contributed equally. Received: 26 October 2018; Accepted: 9 November 2018; Published: 13 November 2018 Abstract: Viruses are responsible for the majority of infectious diseases, from the common cold to HIV/AIDS or hemorrhagic fevers, the latter with devastating effects on the human population. Accordingly, the development of efficient antiviral therapies is a major goal and a challenge for the scientific community, as we are still far from understanding the molecular mechanisms that operate after virus infection. Interferon-stimulated gene 15 (ISG15) plays an important antiviral role during viral infection. ISG15 catalyzes a ubiquitin-like post-translational modification termed ISGylation, involving the conjugation of ISG15 molecules to de novo synthesized viral or cellular proteins, which regulates their stability and function. Numerous biomedically relevant viruses are targets of ISG15, as well as proteins involved in antiviral immunity. Beyond their role as cellular powerhouses, mitochondria are multifunctional organelles that act as signaling hubs in antiviral responses. In this review, we give an overview of the biological consequences of ISGylation for virus infection and host defense. We also compare several published proteomic studies to identify and classify potential mitochondrial ISGylation targets.
    [Show full text]
  • Evidence for the ISG15-Specific Deubiquitinase USP18 As an Antineoplastic Target
    Published OnlineFirst January 17, 2018; DOI: 10.1158/0008-5472.CAN-17-1752 Cancer Review Research Evidence for the ISG15-Specific Deubiquitinase USP18 as an Antineoplastic Target Lisa Maria Mustachio1, Yun Lu2, Masanori Kawakami1, Jason Roszik3,4, Sarah J. Freemantle5, Xi Liu1, and Ethan Dmitrovsky1,6 Abstract Ubiquitination and ubiquitin-like posttranslational modifica- and in contrast to its gain decreases cancer growth by destabi- tions (PTM) regulate activity and stability of oncoproteins and lizing growth-regulatory proteins. Loss of USP18 reduced can- tumor suppressors. This implicates PTMs as antineoplastic targets. cer cell growth by triggering apoptosis. Genetic loss of USP18 One way to alter PTMs is to inhibit activity of deubiquitinases repressed cancer formation in engineered murine lung cancer (DUB) that remove ubiquitin or ubiquitin-like proteins from models. The translational relevance of USP18 was confirmed by substrate proteins. Roles of DUBs in carcinogenesis have been finding its expression was deregulated in malignant versus intensively studied, yet few inhibitors exist. Prior work provides a normal tissues. Notably, the recent elucidation of the USP18 basis for the ubiquitin-specific protease 18 (USP18) as an anti- crystal structure offers a framework for developing an inhibitor neoplastic target. USP18 is the major DUB that removes IFN- to this DUB. This review summarizes strong evidence for USP18 stimulated gene 15 (ISG15) from conjugated proteins. Prior work as a previously unrecognized pharmacologic target in oncology. discovered that engineered loss of USP18 increases ISGylation Cancer Res; 78(3); 1–6. Ó2018 AACR. Background stimulated gene 15 (ISG15), the first ubiquitin-like protein dis- covered, is activated by a three-step enzymatic cascade that Growth-regulatory proteins that drive carcinogenesis are engages a specific E1-activating enzyme (UBE1L), E2-conjugating altered by posttranslational modifications (PTM; ref.
    [Show full text]
  • The Molecular Basis of Ubiquitin-Conjugating Enzymes (E2s) As a Potential Target for Cancer Therapy
    International Journal of Molecular Sciences Review The Molecular Basis of Ubiquitin-Conjugating Enzymes (E2s) as a Potential Target for Cancer Therapy Xiaodi Du, Hongyu Song, Nengxing Shen, Ruiqi Hua and Guangyou Yang * Department of Parasitology, College of Veterinary Medicine, Sichuan Agricultural University, Chengdu 611130, China; [email protected] (X.D.); [email protected] (H.S.); [email protected] (N.S.); [email protected] (R.H.) * Correspondence: [email protected] Abstract: Ubiquitin-conjugating enzymes (E2s) are one of the three enzymes required by the ubiquitin- proteasome pathway to connect activated ubiquitin to target proteins via ubiquitin ligases. E2s determine the connection type of the ubiquitin chains, and different types of ubiquitin chains regulate the stability and activity of substrate proteins. Thus, E2s participate in the regulation of a variety of biological processes. In recent years, the importance of E2s in human health and diseases has been particularly emphasized. Studies have shown that E2s are dysregulated in variety of cancers, thus it might be a potential therapeutic target. However, the molecular basis of E2s as a therapeutic target has not been described systematically. We reviewed this issue from the perspective of the special position and role of E2s in the ubiquitin-proteasome pathway, the structure of E2s and biological processes they are involved in. In addition, the inhibitors and microRNAs targeting E2s are also summarized. This article not only provides a direction for the development of effective drugs but also lays a foundation for further study on this enzyme in the future. Citation: Du, X.; Song, H.; Shen, N.; Keywords: ubiquitin-conjugating enzymes; E2s; cancer; target; NF-κB; inhibitors Hua, R.; Yang, G.
    [Show full text]
  • Discriminating Mild from Critical COVID-19 by Innate and Adaptive Immune Single-Cell Profiling of Bronchoalveolar Lavages
    www.nature.com/cr www.cell-research.com ARTICLE OPEN Discriminating mild from critical COVID-19 by innate and adaptive immune single-cell profiling of bronchoalveolar lavages Els Wauters1,2, Pierre Van Mol 2,3,4, Abhishek Dinkarnath Garg 5, Sander Jansen 6, Yannick Van Herck7, Lore Vanderbeke8, Ayse Bassez3,4, Bram Boeckx3,4, Bert Malengier-Devlies 9, Anna Timmerman3,4, Thomas Van Brussel3,4, Tina Van Buyten6, Rogier Schepers3,4, Elisabeth Heylen 6, Dieter Dauwe 10, Christophe Dooms1,2, Jan Gunst10, Greet Hermans10, Philippe Meersseman11, Dries Testelmans1,2, Jonas Yserbyt1,2, Sabine Tejpar12, Walter De Wever13, Patrick Matthys 9, CONTAGIOUS collaborators, Johan Neyts6, Joost Wauters11, Junbin Qian14 and Diether Lambrechts 3,4 How the innate and adaptive host immune system miscommunicate to worsen COVID-19 immunopathology has not been fully elucidated. Here, we perform single-cell deep-immune profiling of bronchoalveolar lavage (BAL) samples from 5 patients with mild and 26 with critical COVID-19 in comparison to BALs from non-COVID-19 pneumonia and normal lung. We use pseudotime inference to build T-cell and monocyte-to-macrophage trajectories and model gene expression changes along them. In mild + + COVID-19, CD8 resident-memory (TRM) and CD4 T-helper-17 (TH17) cells undergo active (presumably antigen-driven) expansion towards the end of the trajectory, and are characterized by good effector functions, while in critical COVID-19 they remain more + + naïve. Vice versa, CD4 T-cells with T-helper-1 characteristics (TH1-like) and CD8 T-cells expressing exhaustion markers (TEX-like) are 1234567890();,: enriched halfway their trajectories in mild COVID-19, where they also exhibit good effector functions, while in critical COVID-19 they show evidence of inflammation-associated stress at the end of their trajectories.
    [Show full text]
  • Autocrine IFN Signaling Inducing Profibrotic Fibroblast Responses By
    Downloaded from http://www.jimmunol.org/ by guest on September 23, 2021 Inducing is online at: average * The Journal of Immunology , 11 of which you can access for free at: 2013; 191:2956-2966; Prepublished online 16 from submission to initial decision 4 weeks from acceptance to publication August 2013; doi: 10.4049/jimmunol.1300376 http://www.jimmunol.org/content/191/6/2956 A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Autocrine IFN Signaling Feng Fang, Kohtaro Ooka, Xiaoyong Sun, Ruchi Shah, Swati Bhattacharyya, Jun Wei and John Varga J Immunol cites 49 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2013/08/20/jimmunol.130037 6.DC1 This article http://www.jimmunol.org/content/191/6/2956.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2013 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 23, 2021. The Journal of Immunology A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Inducing Autocrine IFN Signaling Feng Fang,* Kohtaro Ooka,* Xiaoyong Sun,† Ruchi Shah,* Swati Bhattacharyya,* Jun Wei,* and John Varga* Activation of TLR3 by exogenous microbial ligands or endogenous injury-associated ligands leads to production of type I IFN.
    [Show full text]