DOCSLIB.ORG

Produktinformation

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Produktinformation Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic PTTG1 monoclonal antibody (M01), clone 1D9 Catalog # : H00009232-M01 規格 : [ 100 ug ] List All Specification Application Image Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Recombinant protein) Description: PTTG1. ELISA Immunogen: PTTG1 (NP_004210, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MATLIYVDKENGEPGTRVVAKDGLKLGSGPSIKALDGRSQVSTPRFGKT FDAPPALPKATRKALGTVNRATEKSVKTKGPLKQKQPSFSAKKMTEKTV KA Host: Mouse Reactivity: Human Isotype: IgG1 Kappa Quality Control Antibody Reactive Against Recombinant Protein. Testing: Western Blot detection against Immunogen (36.74 KDa) . Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Recombinant protein) Protocol Download ELISA Gene Information Entrez GeneID: 9232 Page 1 of 2 2016/5/22 GeneBank NM_004219 Accession#: Protein NP_004210 Accession#: Gene Name: PTTG1 Gene Alias: EAP1,HPTTG,MGC126883,MGC138276,PTTG,TUTR1 Gene pituitary tumor-transforming 1 Description: Omim ID: 604147 Gene Ontology: Hyperlink Gene Summary: The encoded protein is a homolog of yeast securin proteins, which prevent separins from promoting sister chromatid separation. It is an anaphase-promoting complex (APC) substrate that associates with a separin until activation of the APC. The gene product has transforming activity in vitro and tumorigenic activity in vivo, and the gene is highly expressed in various tumors. The gene product contains 2 PXXP motifs, which are required for its transforming and tumorigenic activities, as well as for its stimulation of basic fibroblast growth factor expression. It also contains a destruction box (D box) that is required for its degradation by the APC. The acidic C-terminal region of the encoded protein can act as a transactivation domain. The gene product is mainly a cytosolic protein, although it partially localizes in the nucleus. [provided by RefSeq Other ESP1-associated protein 1,OTTHUMP00000160845,pituitary tumor- Designations: transforming protein 1,securin,tumor-transforming protein 1 Gene Pathway Cell cycle Related Disease Breast cancer Breast Neoplasms Carcinoma, Ductal, Breast Chromosomal Instability Genetic Predisposition to Disease Narcolepsy Ovarian Neoplasms Psoriasis 服務條款 | 隱私權政策 | 著作及商標 | 網站地圖 ©2016 亞諾法生技股份有限公司 Abnova Corporation. 版權所有. Page 2 of 2 2016/5/22.
Load more

Recommended publications
  • Identification of Novel Biomarkers and Candidate Small Molecule Drugs in Non-Small-Cell Lung Cancer by Integrated Microarray Analysis
    OncoTargets and Therapy Dovepress open access to scientific and medical research Open Access Full Text Article ORIGINAL RESEARCH Identification of novel biomarkers and candidate small molecule drugs in non-small-cell lung cancer by integrated microarray analysis This article was published in the following Dove Press journal: OncoTargets and Therapy Qiong Wu1,2,* Background: Non-small-cell lung cancer (NSCLC) remains the leading cause of cancer Bo Zhang1,2,* morbidity and mortality worldwide. In the present study, we identified novel biomarkers Yidan Sun3 associated with the pathogenesis of NSCLC aiming to provide new diagnostic and therapeu- Ran Xu1 tic approaches for NSCLC. Xinyi Hu4 Methods: The microarray datasets of GSE18842, GSE30219, GSE31210, GSE32863 and Shiqi Ren4 GSE40791 from Gene Expression Omnibus database were downloaded. The differential Qianqian Ma5 expressed genes (DEGs) between NSCLC and normal samples were identified by limma Chen Chen6 package. The construction of protein–protein interaction (PPI) network, module analysis and Jian Shu7 enrichment analysis were performed using bioinformatics tools. The expression and prog- Fuwei Qi7 nostic values of hub genes were validated by GEPIA database and real-time quantitative fi Ting He7 PCR. Based on these DEGs, the candidate small molecules for NSCLC were identi ed by the CMap database. Wei Wang2 Results: A total of 408 overlapping DEGs including 109 up-regulated and 296 down- Ziheng Wang2 regulated genes were identified; 300 nodes and 1283 interactions were obtained from the 1 Medical School of Nantong University, PPI network. The most significant biological process and pathway enrichment of DEGs were Nantong 226001, People’s Republic of China; 2The Hand Surgery Research Center, response to wounding and cell adhesion molecules, respectively.
    [Show full text]
  • Early Growth Response 1 Regulates Hematopoietic Support and Proliferation in Human Primary Bone Marrow Stromal Cells
    Hematopoiesis SUPPLEMENTARY APPENDIX Early growth response 1 regulates hematopoietic support and proliferation in human primary bone marrow stromal cells Hongzhe Li, 1,2 Hooi-Ching Lim, 1,2 Dimitra Zacharaki, 1,2 Xiaojie Xian, 2,3 Keane J.G. Kenswil, 4 Sandro Bräunig, 1,2 Marc H.G.P. Raaijmakers, 4 Niels-Bjarne Woods, 2,3 Jenny Hansson, 1,2 and Stefan Scheding 1,2,5 1Division of Molecular Hematology, Department of Laboratory Medicine, Lund University, Lund, Sweden; 2Lund Stem Cell Center, Depart - ment of Laboratory Medicine, Lund University, Lund, Sweden; 3Division of Molecular Medicine and Gene Therapy, Department of Labora - tory Medicine, Lund University, Lund, Sweden; 4Department of Hematology, Erasmus MC Cancer Institute, Rotterdam, the Netherlands and 5Department of Hematology, Skåne University Hospital Lund, Skåne, Sweden ©2020 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol. 2019.216648 Received: January 14, 2019. Accepted: July 19, 2019. Pre-published: August 1, 2019. Correspondence: STEFAN SCHEDING - [email protected] Li et al.: Supplemental data 1. Supplemental Materials and Methods BM-MNC isolation Bone marrow mononuclear cells (BM-MNC) from BM aspiration samples were isolated by density gradient centrifugation (LSM 1077 Lymphocyte, PAA, Pasching, Austria) either with or without prior incubation with RosetteSep Human Mesenchymal Stem Cell Enrichment Cocktail (STEMCELL Technologies, Vancouver, Canada) for lineage depletion (CD3, CD14, CD19, CD38, CD66b, glycophorin A). BM-MNCs from fetal long bones and adult hip bones were isolated as reported previously 1 by gently crushing bones (femora, tibiae, fibulae, humeri, radii and ulna) in PBS+0.5% FCS subsequent passing of the cell suspension through a 40-µm filter.
    [Show full text]
  • Pituitary Tumor Transforming Gene 1 Regulates Aurora Kinase a Activity
    Oncogene (2008) 27, 6385–6395 & 2008 Macmillan Publishers Limited All rights reserved 0950-9232/08 $32.00 www.nature.com/onc ORIGINAL ARTICLE Pituitary tumor transforming gene 1 regulates Aurora kinase A activity Y Tong, A Ben-Shlomo, C Zhou, K Wawrowsky and S Melmed Department of Medicine, Cedars-Sinai Research Institute, David Geffen School of Medicine at UCLA, Los Angeles, CA, USA Pituitary tumor transforming gene 1 (PTTG1),a pathogenesis of estrogen-induced rat prolactinomas transforming gene highly expressed in several cancers,is (Heaney et al., 1999), and has been suggested as a a mammalian securin protein regulating both G1/S and prognostic marker for thyroid, breast (Solbach et al., G2/M phases. Using protein array screening,we showed 2004)and colon cancer invasiveness (Heaney et al., PTTG1 interacting with Aurora kinase A (Aurora-A), 2000). PTTG and HTLV-1 Tax exhibit a cooperative and confirmed the interaction using co-immunoprecipita- transforming activity (Sheleg et al., 2007), whereas small tion,His-tagged pull-down assays and intracellular interfering RNA (siRNA)directed against PTTG immunofluorescence colocalization. PTTG1 transfection suppressed lung cancer growth in nude mice (Kakar into HCT116 cells prevented Aurora-A T288 autopho- and Malik, 2006)and was also proposed as a subcellular sphorylation,inhibited phosphorylation of the histone H3 therapy for ovarian cancer (El-Naggar et al., 2007). Aurora-A substrate and resulted in abnormally condensed Overexpressed PTTG1 results in chromosome chromatin. PTTG1-null cell proliferation was more instability and aneuploidy, which has been suggested sensitive to Aurora-A knock down and to Aurora kinase as a mechanism underlying PTTG1 transforming Inhibitor III treatment.
    [Show full text]
  • (PTTG1IP/PBF) Predicts Breast Cancer Survival
    Repo et al. BMC Cancer (2017) 17:705 DOI 10.1186/s12885-017-3694-6 RESEARCHARTICLE Open Access PTTG1-interacting protein (PTTG1IP/PBF) predicts breast cancer survival Heli Repo1* , Natalia Gurvits1, Eliisa Löyttyniemi2, Marjukka Nykänen3, Minnamaija Lintunen1, Henna Karra4, Samu Kurki5, Teijo Kuopio3, Kati Talvinen1, Mirva Söderström1 and Pauliina Kronqvist1 Abstract Background: PTTG1-interacting protein (PTTG1IP) is an oncogenic protein, which participates in metaphase-anaphase transition of the cell cycle through activation of securin (PTTG1). PTTG1IP promotes the shift of securin from the cell cytoplasm to the nucleus, allowing the interaction between separase and securin. PTTG1IP overexpression has been previously observed in malignant disease, e.g. in breast carcinoma. However, the prognostic value of PTTG1IP in breast carcinoma patients has not previously been revealed. Methods: A total of 497 breast carcinoma patients with up to 22-year follow-up were analysed for PTTG1IP and securin immunoexpression. The results were evaluated for correlations with the clinical prognosticators and patient survival. Results: In our material, negative PTTG1IP immunoexpression predicted a 1.5-fold risk of breast cancer death (p =0.02). However, adding securin immunoexpression to the analysis indicated an even stronger and independent prognostic power in the patient material (HR = 2.5, p < 0.0001). The subcellular location of securin was found with potential prognostic value also among the triple-negative breast carcinomas (n = 96, p = 0.052). Conclusions: PTTG1IP-negativity alone and in combination with high securin immunoexpression indicates a high risk of breast cancer death, resulting in up to 14-year survival difference in our material. Keywords: PTTG1IP, PBF, Immunohistochemistry, Breast cancer, Prognosis Background nucleus, allowing the interaction between separase and Pituitary tumour transforming gene 1 interacting pro- securin [1].
    [Show full text]
  • Nuclear Localization of PTTG1 Promotes Migration and Invasion of Seminoma Tumor Through Activation of MMP-2
    Nuclear Localization of PTTG1 Promotes Migration and Invasion of Seminoma Tumor Through Activation of MMP-2. Emanuela Teveroni International Scientic Institute "Paul VI", ISI, Fondazione Policlinico "A.Gemelli" IRCCS Fiorella Di Nicuolo International Scientic Institute "Paul VI", ISI, Fondazione Policlinico "A.Gemelli" IRCCS Giada Bianchetti Department of Neuroscience, section of Biophysics, Università Cattolica del Sacro Cuore Alan L. Epstein Department of Pathology, Keck school of medicine, University of Southern California, Los Angeles Giuseppe Grande International Scientic Institute "Paul VI", ISI, Fondazione Policlinico "A.Gemelli" IRCCS Giuseppe Maulucci Department of Neuroscience, section of Biophysics, Università Cattolica del Sacro Cuore Marco De Spirito Università Cattolica del Sacro Cuore: Universita Cattolica del Sacro Cuore Alfredo Pontecorvi Division of Endocrinology, Fondazione policlinico "A.Gemelli" IRCCS Domenico Milardi Division of Endocrinology, Fondazione policlinico "A.Gemelli" IRCCS Francesca Mancini ( [email protected] ) International Scientic Institute "Paul VI", ISI, Fondazione Policlinico 'A. Gemelli' IRCCS, Rome, Italy https://orcid.org/0000-0002-2459-8815 Research Keywords: PTTG1, seminoma cell lines, testicular cancer, PBF, MMP-2, invasiveness Posted Date: December 15th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-125309/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/53 Abstract Background: Seminoma is the most common subtype of testicular germ cell tumors (TGCTs) and its molecular patterns have not been fully claried. The pituitary tumor-transforming gene 1 (PTTG1) is a securin, inhibitor of premature sister chromatid segregation during mitosis and is overexpressed in many cancers. PTTG1 shows the ability to sustain the invasiveness of several cancer types through its transcriptional activity.
    [Show full text]
  • Dissecting the DNA Binding Landscape and Gene Regulatory Network of P63 and P53
    bioRxiv preprint doi: https://doi.org/10.1101/2020.06.11.145540; this version posted June 12, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Dissecting the DNA binding landscape and gene regulatory network of p63 and p53 Konstantin Riege1, Helene Kretzmer2, Simon S. McDade3, Steve Hoffmann1, Martin Fischer1,# 1 Computational Biology Group, Leibniz Institute on Aging – Fritz Lipmann Institute (FLI), Beutenbergstraße 11, 07745 Jena, Germany 2 Department of Genome Regulation, Max Planck Institute for Molecular Genetics, Ihnestraße 63-73, 14195 Berlin, Germany 3 Patrick G Johnston Centre for Cancer Research, Queen's University Belfast, 97 Lisburn Road, Belfast BT9 7AE, UK Running title: p63 GRN vs p53 GRN #To whom correspondence should be addressed. Email: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2020.06.11.145540; this version posted June 12, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract The transcription factor (TF) p53 is the best-known tumor suppressor, but its ancient sibling p63 (ΔNp63) is a master regulator of epidermis development and a key oncogenic driver in squamous cell carcinomas (SCC). Despite multiple gene expression studies becoming available in recent years, the limited overlap of reported p63-dependent genes has made it difficult to decipher the p63 gene regulatory network (GRN).
    [Show full text]
  • An Integrated Data Analysis Approach to Characterize Genes Highly Expressed in Hepatocellular Carcinoma
    Oncogene (2005) 24, 3737–3747 & 2005 Nature Publishing Group All rights reserved 0950-9232/05 $30.00 www.nature.com/onc An integrated data analysis approach to characterize genes highly expressed in hepatocellular carcinoma Mohini A Patil1,6, Mei-Sze Chua2,6, Kuang-Hung Pan3,6, Richard Lin3, Chih-Jian Lih3, Siu-Tim Cheung4, Coral Ho1,RuiLi2, Sheung-Tat Fan4, Stanley N Cohen3, Xin Chen1,5 and Samuel So2 1Department of Biopharmaceutical Sciences, University of California, San Francisco, CA 94143, USA; 2Department of Surgery and Asian Liver Center, Stanford University, Stanford, CA 94305, USA; 3Department of Genetics, Stanford University, Stanford, CA 94305, USA; 4Department of Surgery and Center for the Study of Liver Disease, University of Hong Kong, Hong Kong, China; 5Liver Center, University of California, San Francisco, CA 94143, USA Hepatocellular carcinoma (HCC) is one of the major cancer deaths worldwide (Parkin, 2001; Parkin et al., causes of cancer deaths worldwide. New diagnostic and 2001). Epidemiological and molecular genetic studies therapeutic options are needed for more effective and early have demonstrated that the development of HCC spans detection and treatment of this malignancy. We identified several decades, often starting with hepatitis B virus 703 genes that are highly expressed in HCC using DNA (HBV) or hepatitis C virus (HCV) infections. Chronic microarrays, and further characterized them in order to carriers of HBV or HCV are at much higher risk of uncover novel tumor markers, oncogenes, and therapeutic developing HCC, especially when infection has been targets for HCC. Using Gene Ontology annotations, genes accompanied by liver cirrhosis (El-Serag, H., 2001; El- with functions related to cell proliferation and cell cycle, Serag, H.B., 2002).
    [Show full text]
  • Downloaded from Bioscientifica.Com at 09/28/2021 12:16:49AM Via Free Access
    249 W Imruetaicharoenchoke et al. Mutations in PTTG1IP 24:9 459–474 Research Functional consequences of the first reported mutations of the proto-oncogene PTTG1IP/PBF W Imruetaicharoenchoke1,2,3, A Fletcher1,2, W Lu1,2, R J Watkins4, B Modasia1,2, V L Poole1,2, H R Nieto1,2, R J Thompson1,2, K Boelaert1,2, M L Read1,2, V E Smith1,2,* and C J McCabe1,2,* 1Institute of Metabolism and Systems Research, University of Birmingham, Birmingham, UK 2 Centre for Endocrinology, Diabetes and Metabolism, Birmingham Health Partners, Birmingham, UK Correspondence 3 Department of Surgery, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok, Thailand should be addressed 4 Institute of Cancer and Genomic Sciences, University of Birmingham, Birmingham, UK to C J McCabe *(V E Smith and C J McCabe contributed equally to this work) Email [email protected] Abstract Pituitary tumor-transforming gene 1-binding factor (PTTG1IP; PBF) is a multifunctional Key Words glycoprotein, which is overexpressed in a wide range of tumours, and significantly f COSMIC associated with poorer oncological outcomes, such as early tumour recurrence, distant f TCGA metastasis, extramural vascular invasion and decreased disease-specific survival. f PTTG1IP PBF transforms NIH 3T3 fibroblasts and induces tumours in nude mice, while mice f mutation harbouring transgenic thyroidal PBF expression show hyperplasia and macrofollicular f proliferation Endocrine-Related Cancer Endocrine-Related lesions. Our assumption that PBF becomes an oncogene purely through increased expression has been challenged by the recent report of mutations in PBF within the Catalogue of Somatic Mutations in Cancer (COSMIC) database.
    [Show full text]
  • A Pathway of Targeted Autophagy Is Induced by DNA Damage In
    A pathway of targeted autophagy is induced by DNA PNAS PLUS damage in budding yeast Vinay V. Eapena,1, David P. Watermana, Amélie Bernardb, Nathan Schiffmannc, Enrich Sayasd,e, Roarke Kamberf, Brenda Lemosa, Gonen Memisoglua, Jessie Anga, Allison Mazellaa, Silvia G. Chuartzmanc, Robbie J. Loewithd,e, Maya Schuldinerc, Vladimir Denicf, Daniel J. Klionskyb, and James E. Habera,2 aDepartment of Biology, Brandeis University, Waltham, MA 02454; bLife Sciences Institute, University of Michigan, Ann Arbor, MI 48109; cDepartment of Molecular Genetics, Weizmann Institute of Sciences, Rehovot, Israel 7610001; dDepartment of Molecular Biology, University of Geneva, CH-1211 Geneva 4, Switzerland; eInstitute of Genetics and Genomics in Geneva, University of Geneva, CH-1211 Geneva 4, Switzerland; and fMolecular and Cell Biology, Harvard University, Cambridge, MA 02138 Contributed by James E. Haber, December 5, 2016 (sent for review August 31, 2016; reviewed by Eric H. Baehrecke and Stephen J. Elledge) Autophagy plays a central role in the DNA damage response (DDR) by conditions. For example, in response to nutrient starvation, cells controlling the levels of various DNA repair and checkpoint proteins; recycle internal reserves of basic metabolites by the degradation however, how the DDR communicates with the autophagy pathway of proteins, or even whole organelles, by their digestion in the remains unknown. Using budding yeast, we demonstrate that global vacuole/lysosome. This process is initiated by the formation of genotoxic damage or even a single unrepaired double-strand break double-membraned cytosolic sequestering vesicles, termed phag- (DSB) initiates a previously undescribed and selective pathway of ophores, which can engulf either random portions of the cyto- autophagy that we term genotoxin-induced targeted autophagy plasm, organelles, or specific proteins (10).
    [Show full text]
  • UNIVERSITY of CALIFORNIA, SAN DIEGO Measuring
    UNIVERSITY OF CALIFORNIA, SAN DIEGO Measuring and Correlating Blood and Brain Gene Expression Levels: Assays, Inbred Mouse Strain Comparisons, and Applications to Human Disease Assessment A dissertation submitted in partial satisfaction of the requirements for the degree of Doctor of Philosophy in Biomedical Sciences by Mary Elizabeth Winn Committee in charge: Professor Nicholas J Schork, Chair Professor Gene Yeo, Co-Chair Professor Eric Courchesne Professor Ron Kuczenski Professor Sanford Shattil 2011 Copyright Mary Elizabeth Winn, 2011 All rights reserved. 2 The dissertation of Mary Elizabeth Winn is approved, and it is acceptable in quality and form for publication on microfilm and electronically: Co-Chair Chair University of California, San Diego 2011 iii DEDICATION To my parents, Dennis E. Winn II and Ann M. Winn, to my siblings, Jessica A. Winn and Stephen J. Winn, and to all who have supported me throughout this journey. iv TABLE OF CONTENTS Signature Page iii Dedication iv Table of Contents v List of Figures viii List of Tables x Acknowledgements xiii Vita xvi Abstract of Dissertation xix Chapter 1 Introduction and Background 1 INTRODUCTION 2 Translational Genomics, Genome-wide Expression Analysis, and Biomarker Discovery 2 Neuropsychiatric Diseases, Tissue Accessibility and Blood-based Gene Expression 4 Mouse Models of Human Disease 5 Microarray Gene Expression Profiling and Globin Reduction 7 Finding and Accessible Surrogate Tissue for Neural Tissue 9 Genetic Background Effect Analysis 11 SPECIFIC AIMS 12 ENUMERATION OF CHAPTERS
    [Show full text]
  • Autocrine IFN Signaling Inducing Profibrotic Fibroblast Responses By
    Downloaded from http://www.jimmunol.org/ by guest on September 23, 2021 Inducing is online at: average * The Journal of Immunology , 11 of which you can access for free at: 2013; 191:2956-2966; Prepublished online 16 from submission to initial decision 4 weeks from acceptance to publication August 2013; doi: 10.4049/jimmunol.1300376 http://www.jimmunol.org/content/191/6/2956 A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Autocrine IFN Signaling Feng Fang, Kohtaro Ooka, Xiaoyong Sun, Ruchi Shah, Swati Bhattacharyya, Jun Wei and John Varga J Immunol cites 49 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2013/08/20/jimmunol.130037 6.DC1 This article http://www.jimmunol.org/content/191/6/2956.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2013 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 23, 2021. The Journal of Immunology A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Inducing Autocrine IFN Signaling Feng Fang,* Kohtaro Ooka,* Xiaoyong Sun,† Ruchi Shah,* Swati Bhattacharyya,* Jun Wei,* and John Varga* Activation of TLR3 by exogenous microbial ligands or endogenous injury-associated ligands leads to production of type I IFN.
    [Show full text]
  • Expression of the PTTG1 Oncogene Is Associated with Aggressive Clear Cell Renal Cell Carcinoma
    Published OnlineFirst July 17, 2012; DOI: 10.1158/0008-5472.CAN-11-2330 Cancer Molecular and Cellular Pathobiology Research Expression of the PTTG1 Oncogene Is Associated with Aggressive Clear Cell Renal Cell Carcinoma Bill Wondergem1, Zhongfa Zhang1, Dachuan Huang5, Choon Kiat Ong5, Julie Koeman2, David Van't Hof3, David Petillo1, Aikseng Ooi1, John Anema4, Brian Lane4, Richard J. Kahnoski4, Kyle A. Furge1,3, and Bin Tean Teh1,5 Abstract The pituitary tumor transforming gene (PTTG1) is a recently discovered oncogene implicated in malignant progression of both endocrine and nonendocrine malignancies. Clear cell renal cell carcinoma (ccRCC) is cytogenetically characterized by chromosome 3p deletions that harbor the ccRCC-related von Hippel-Lindau, PBRM1, BAP1, and SETD2 tumor suppressor genes, along with chromosome 5q amplifications where the significance has been unclear. PTTG1 localizes to the chromosome 5q region where amplifications occur in ccRCC. In this study, we report a functional role for PTTG1 in ccRCC tumorigenesis. PTTG1 was amplified in ccRCC, overexpressed in tumor tissue, and associated with high-grade tumor cells and poor patient prognosis. In preclinical models, PTTG1 ablation reduced tumorigenesis and invasion. An analysis of gene expression affected by PTTG1 indicated an association with invasive and metastatic disease. PTTG1-dependent expression of the RhoGEF proto-oncogene ECT2 was observed in a number of ccRCC cell lines. Moreover, ECT2 expression correlated with PTTG1 expression and poor clinical features. Together, our findings reveal features of PTTG1 that are consistent with its identification of an oncogene amplified on chromsome 5q in ccRCC, where it may offer a novel therapeutic target of pathologic significance in this disease.
    [Show full text]