CLDN14 Monoclonal Antibody (M01), Clone 3D11

Total Page：16

File Type：pdf, Size：1020Kb

CLDN14 Monoclonal Antibody (M01), Clone 3D11

CLDN14 monoclonal antibody (M01), These junctions are comprised of sets of continuous clone 3D11 networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly Catalog Number: H00023562-M01 facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral Regulation Status: For research use only (RUO) membrane protein and a component of tight junction strands. The encoded protein also binds specifically to Product Description: Mouse monoclonal antibody the WW domain of Yes-associated protein. Defects in raised against a partial recombinant CLDN14. this gene are the cause of an autosomal recessive form of nonsyndromic sensorineural deafness. Several Clone Name: 3D11 transcript variants encoding the same protein have been found for this gene. [provided by RefSeq] Immunogen: CLDN14 (NP_036262, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: HWRRTAHVGTNILTAVSYLKGLWMECVWHSTGIYQC QIYRSLLALPQDLQAAR Host: Mouse Reactivity: Human Applications: ELISA, IP, S-ELISA (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Isotype: IgG2a Kappa Storage Buffer: In 1x PBS, pH 7.2 Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 23562 Gene Symbol: CLDN14 Gene Alias: DFNB29 Gene Summary: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Genome Wide Association Study of Response to Interval and Continuous Exercise Training: the Predict‑HIIT Study Camilla J
Williams et al. J Biomed Sci (2021) 28:37 https://doi.org/10.1186/s12929-021-00733-7 RESEARCH Open Access Genome wide association study of response to interval and continuous exercise training: the Predict-HIIT study Camilla J. Williams1†, Zhixiu Li2†, Nicholas Harvey3,4†, Rodney A. Lea4, Brendon J. Gurd5, Jacob T. Bonafglia5, Ioannis Papadimitriou6, Macsue Jacques6, Ilaria Croci1,7,20, Dorthe Stensvold7, Ulrik Wislof1,7, Jenna L. Taylor1, Trishan Gajanand1, Emily R. Cox1, Joyce S. Ramos1,8, Robert G. Fassett1, Jonathan P. Little9, Monique E. Francois9, Christopher M. Hearon Jr10, Satyam Sarma10, Sylvan L. J. E. Janssen10,11, Emeline M. Van Craenenbroeck12, Paul Beckers12, Véronique A. Cornelissen13, Erin J. Howden14, Shelley E. Keating1, Xu Yan6,15, David J. Bishop6,16, Anja Bye7,17, Larisa M. Haupt4, Lyn R. Grifths4, Kevin J. Ashton3, Matthew A. Brown18, Luciana Torquati19, Nir Eynon6 and Jef S. Coombes1* Abstract Background: Low cardiorespiratory ftness (V̇O2peak) is highly associated with chronic disease and mortality from all causes. Whilst exercise training is recommended in health guidelines to improve V̇O2peak, there is considerable inter-individual variability in the V̇O2peak response to the same dose of exercise. Understanding how genetic factors contribute to V̇O2peak training response may improve personalisation of exercise programs. The aim of this study was to identify genetic variants that are associated with the magnitude of V̇O2peak response following exercise training. Methods: Participant change in objectively measured V̇O2peak from 18 diferent interventions was obtained from a multi-centre study (Predict-HIIT). A genome-wide association study was completed (n 507), and a polygenic predictor score (PPS) was developed using alleles from single nucleotide polymorphisms= (SNPs) signifcantly associ- –5 ated (P < 1 10 ) with the magnitude of V̇O2peak response.
[Show full text]
Supplementary Table 1: Adhesion Genes Data Set
Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
[Show full text]
Supplementary Materials
Supplementary materials Supplementary Table S1: MGNC compound library Ingredien Molecule Caco- Mol ID MW AlogP OB (%) BBB DL FASA- HL t Name Name 2 shengdi MOL012254 campesterol 400.8 7.63 37.58 1.34 0.98 0.7 0.21 20.2 shengdi MOL000519 coniferin 314.4 3.16 31.11 0.42 -0.2 0.3 0.27 74.6 beta- shengdi MOL000359 414.8 8.08 36.91 1.32 0.99 0.8 0.23 20.2 sitosterol pachymic shengdi MOL000289 528.9 6.54 33.63 0.1 -0.6 0.8 0 9.27 acid Poricoic acid shengdi MOL000291 484.7 5.64 30.52 -0.08 -0.9 0.8 0 8.67 B Chrysanthem shengdi MOL004492 585 8.24 38.72 0.51 -1 0.6 0.3 17.5 axanthin 20- shengdi MOL011455 Hexadecano 418.6 1.91 32.7 -0.24 -0.4 0.7 0.29 104 ylingenol huanglian MOL001454 berberine 336.4 3.45 36.86 1.24 0.57 0.8 0.19 6.57 huanglian MOL013352 Obacunone 454.6 2.68 43.29 0.01 -0.4 0.8 0.31 -13 huanglian MOL002894 berberrubine 322.4 3.2 35.74 1.07 0.17 0.7 0.24 6.46 huanglian MOL002897 epiberberine 336.4 3.45 43.09 1.17 0.4 0.8 0.19 6.1 huanglian MOL002903 (R)-Canadine 339.4 3.4 55.37 1.04 0.57 0.8 0.2 6.41 huanglian MOL002904 Berlambine 351.4 2.49 36.68 0.97 0.17 0.8 0.28 7.33 Corchorosid huanglian MOL002907 404.6 1.34 105 -0.91 -1.3 0.8 0.29 6.68 e A_qt Magnogrand huanglian MOL000622 266.4 1.18 63.71 0.02 -0.2 0.2 0.3 3.17 iolide huanglian MOL000762 Palmidin A 510.5 4.52 35.36 -0.38 -1.5 0.7 0.39 33.2 huanglian MOL000785 palmatine 352.4 3.65 64.6 1.33 0.37 0.7 0.13 2.25 huanglian MOL000098 quercetin 302.3 1.5 46.43 0.05 -0.8 0.3 0.38 14.4 huanglian MOL001458 coptisine 320.3 3.25 30.67 1.21 0.32 0.9 0.26 9.33 huanglian MOL002668 Worenine
[Show full text]
A Common Variant in CLDN14 Is Associated with Primary Biliary
www.nature.com/scientificreports OPEN A Common Variant in CLDN14 is Associated with Primary Biliary Cirrhosis and Bone Mineral Density Received: 13 October 2015 Ruqi Tang1,*, Yiran Wei1,*, Zhiqiang Li2,*, Haoyan Chen1, Qi Miao1, Zhaolian Bian1, Accepted: 16 December 2015 Haiyan Zhang1, Qixia Wang1, Zhaoyue Wang1, Min Lian1, Fan Yang1, Xiang Jiang1, Yue Yang1, Published: 04 February 2016 Enling Li1, Michael F. Seldin3,4, M. Eric Gershwin4, Wilson Liao5, Yongyong Shi3 & Xiong Ma1 Primary biliary cirrhosis (PBC), a chronic autoimmune liver disease, has been associated with increased incidence of osteoporosis. Intriguingly, two PBC susceptibility loci identified through genome-wide association studies are also involved in bone mineral density (BMD). These observations led us to investigate the genetic variants shared between PBC and BMD. We evaluated 72 genome-wide significant BMD SNPs for association with PBC using two European GWAS data sets (n = 8392), with replication of significant findings in a Chinese cohort (685 cases, 1152 controls). Our analysis identified a novel variant in the intron of the CLDN14 gene (rs170183, Pfdr = 0.015) after multiple testing correction. The three associated variants were followed-up in the Chinese cohort; one SNP rs170183 demonstrated −5 consistent evidence of association in diverse ethnic populations (Pcombined = 2.43 × 10 ). Notably, expression quantitative trait loci (eQTL) data revealed that rs170183 was correlated with a decline in CLDN14 expression in both lymphoblastoid cell lines and T cells (Padj = 0.003 and 0.016, respectively). In conclusion, our study identified a novel PBC susceptibility variant that has been shown to be strongly associated with BMD, highlighting the potential of pleiotropy to improve gene discovery.
[Show full text]
1 Integrative Omics Analyses Reveal Epigenetic Memory in Diabetic Renal
Page 1 of 53 Diabetes Integrative Omics analyses reveal epigenetic memory in diabetic renal cells regulating genes associated with kidney dysfunction. Anita Bansal1, Sreeram Balasubramanian2, Sangeeta Dhawan3, Amy Leung1, Zhen Chen1, Rama Natarajan*1. 1Department of Diabetes Complications and Metabolism, Diabetes and Metabolism Research Institute, Beckman Research Institute of City of Hope, 1500 East Duarte Road, Duarte, CA 91010, 2 Division of Biology and Biological Engineering, California Institute of Technology, 1200 E California Blvd, Pasadena, CA 91125, 3Department of Translational Research and Cellular Therapeutics, Diabetes and Metabolism Research Institute, Beckman Research Institute of City of Hope, 1500 East Duarte Road, Duarte, CA 91010. Correspondence to * Rama Natarajan. Email: [email protected] 626-218-2289 Keywords Diabetic kidney disease, tubular epithelial cells, metabolic memory, epigenomics Running title: Epigenetic memory in diabetic renal tubular cells Word count: 4949 Number of Figures: 6 1 Diabetes Publish Ahead of Print, published online August 3, 2020 Diabetes Page 2 of 53 Abstract Diabetic kidney disease (DKD) is a major complication of diabetes and the leading cause of end- stage renal failure. Epigenetics has been associated with metabolic memory, in which prior periods of hyperglycemia enhance the future risk of developing DKD despite subsequent glycemic control. To understand the mechanistic role of such epigenetic memory in human DKD and identify new therapeutic targets, we profiled gene expression, DNA methylation, and chromatin accessibility in kidney proximal tubule epithelial cells (PTECs) derived from non-diabetic and Type-2 diabetic (T2D) subjects. T2D-PTECs displayed persistent gene expression and epigenetic changes with and without TGFβ1 treatment, even after culturing in vitro under similar conditions as non-diabetic PTECs, signified by deregulation of fibrotic and transport associated genes (TAGs).
[Show full text]
Application of Microarray-Based Comparative Genomic Hybridization in Prenatal and Postnatal Settings: Three Case Reports
SAGE-Hindawi Access to Research Genetics Research International Volume 2011, Article ID 976398, 9 pages doi:10.4061/2011/976398 Case Report Application of Microarray-Based Comparative Genomic Hybridization in Prenatal and Postnatal Settings: Three Case Reports Jing Liu, Francois Bernier, Julie Lauzon, R. Brian Lowry, and Judy Chernos Department of Medical Genetics, University of Calgary, 2888 Shaganappi Trail NW, Calgary, AB, Canada T3B 6A8 Correspondence should be addressed to Judy Chernos, [email protected] Received 16 February 2011; Revised 20 April 2011; Accepted 20 May 2011 Academic Editor: Reha Toydemir Copyright © 2011 Jing Liu et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Microarray-based comparative genomic hybridization (array CGH) is a newly emerged molecular cytogenetic technique for rapid evaluation of the entire genome with sub-megabase resolution. It allows for the comprehensive investigation of thousands and millions of genomic loci at once and therefore enables the efficient detection of DNA copy number variations (a.k.a, cryptic genomic imbalances). The development and the clinical application of array CGH have revolutionized the diagnostic process in patients and has provided a clue to many unidentified or unexplained diseases which are suspected to have a genetic cause. In this paper, we present three clinical cases in both prenatal and postnatal settings. Among all, array CGH played a major discovery role to reveal the cryptic and/or complex nature of chromosome arrangements. By identifying the genetic causes responsible for the clinical observation in patients, array CGH has provided accurate diagnosis and appropriate clinical management in a timely and efficient manner.
[Show full text]
Chromosome 21 Leading Edge Gene Set
Chromosome 21 Leading Edge Gene Set Genes from chr21q22 that are part of the GSEA leading edge set identifying differences between trisomic and euploid samples. Multiple probe set IDs corresponding to a single gene symbol are combined as part of the GSEA analysis. Gene Symbol Probe Set IDs Gene Title 203865_s_at, 207999_s_at, 209979_at, adenosine deaminase, RNA-specific, B1 ADARB1 234539_at, 234799_at (RED1 homolog rat) UDP-Gal:betaGlcNAc beta 1,3- B3GALT5 206947_at galactosyltransferase, polypeptide 5 BACE2 217867_x_at, 222446_s_at beta-site APP-cleaving enzyme 2 1553227_s_at, 214820_at, 219280_at, 225446_at, 231860_at, 231960_at, bromodomain and WD repeat domain BRWD1 244622_at containing 1 C21orf121 240809_at chromosome 21 open reading frame 121 C21orf130 240068_at chromosome 21 open reading frame 130 C21orf22 1560881_a_at chromosome 21 open reading frame 22 C21orf29 1552570_at, 1555048_at_at, 1555049_at chromosome 21 open reading frame 29 C21orf33 202217_at, 210667_s_at chromosome 21 open reading frame 33 C21orf45 219004_s_at, 228597_at, 229671_s_at chromosome 21 open reading frame 45 C21orf51 1554430_at, 1554432_x_at, 228239_at chromosome 21 open reading frame 51 C21orf56 223360_at chromosome 21 open reading frame 56 C21orf59 218123_at, 244369_at chromosome 21 open reading frame 59 C21orf66 1555125_at, 218515_at, 221158_at chromosome 21 open reading frame 66 C21orf7 221211_s_at chromosome 21 open reading frame 7 C21orf77 220826_at chromosome 21 open reading frame 77 C21orf84 239968_at, 240589_at chromosome 21 open reading frame 84
[Show full text]
6, -11 and -14 As Prognostic Markers in Human Breast Carcinoma
Int J Clin Exp Pathol 2019;12(6):2195-2204 www.ijcep.com /ISSN:1936-2625/IJCEP0091345 Original Article Identification of claudin-2, -6, -11 and -14 as prognostic markers in human breast carcinoma Hongyao Jia1, Xin Chai2, Sijie Li1, Di Wu1, Zhimin Fan1 1Department of Breast Surgery, The First Hospital of Jilin University, Changchun 130021, Jilin, P. R. China; 2De- partment of Breast Surgery, Jilin Cancer Hospital, 1018 Huguang Street, Changchun 130021, Jilin, P. R. China Received January 15, 2019; Accepted March 25, 2019; Epub June 1, 2019; Published June 15, 2019 Abstract: The development of cancer occurs with various genomic and epigenetic modifications that act as indica- tors for early diagnosis and treatment. Recent data have shown that the abnormal expression of the claudin (CLDN) tight junction (TJ) proteins is involved in the tumorigenesis of numerous human cancers. Real-time quantitative PCR and western blotting were used to explore the differences in the expression of the CLDN TJ proteins in breast carcinoma tissues and non-neoplastic tissues. The results showed that CLDN5, CLDN9, CLDN12 and CLDN13 were not expressed in breast carcinoma tissues or non-neoplastic tissues. CLDN1, CLDN3, CLDN8 and CLDN10 were expressed in breast carcinoma and non-neoplastic tissues, but there was no significant difference between the ex- pression of these CLDN proteins among them. The expression of CLDN2, -6, -11 and -14 varied between the breast carcinoma and non-neoplastic tissues. Moreover, 86 samples of breast carcinoma and non-neoplastic tissues were examined for the expression of CLDN2, -6, -11 and -14 by streptavidin-peroxidase immunohistochemical staining.
[Show full text]
Genetic and Molecular Analysis of the CLDN14 Gene in Moroccan Family with Non‑Syndromic Hearing Loss
Original Article Genetic and molecular analysis of the CLDN14 gene in Moroccan family with non‑syndromic hearing loss Majida Charif, Redouane Boulouiz, Amina Bakhechane, Houda Benrahma, Halima Nahili, Abdelmajid Eloualid, Hassan Rouba, Mostafa Kandil, Omar Abidi, Guy Lenaers, Abdelhamid Barakat Département de Recherche Scientifique, Laboratoire de Génétique Moléculaire et Humaine, Institut Pasteur, 1, Place Louis Pasteur, C.P. 20360 Casablanca, Morocco Introduction BACKGROUND: Hearing loss is the most prevalent human genetic sensorineural defect. Mutations in the CLDN14 gene, encoding the tight junction claudin 14 protein Hearing loss is the most prevalent human genetic expressed in the inner ear, have been shown to cause non‑syndromic recessive hearing loss DFNB29. sensorineural defect. It occurs in 1 in 500 births and AIM: We describe a Moroccan SF7 family with affects 278 million people world‑wide.[1,2] The majority of non‑syndromic hearing loss. We performed linkage analysis in this family and sequencing to identify the the genes responsible for this disease have not yet been mutation causing deafness. cloned and little is known about the corresponding gene MATERIALS AND METHODS: Genetic linkage analysis, suggested the involvement of CLDN14 and KCNE1 gene in products and their function in the cochlea. Nevertheless, deafness in this family. Mutation screening was performed several genes responsible for neurosensory deafness using direct sequencing of the CLDN14 and KCNE1 coding are involved in the regulation of the crucial inner ear ion exon gene. RESULTS: Our results show the presence of c.11C>T homeostasis. The most studied include genes coding for mutation in the CLDN14 gene. Transmission analysis of the connexins (GJB2,[3] GJB3[4] and GJB6[5]), for the ion this mutation in the family showed that the three affected [6] [7] [8] individuals are homozygous, whereas parents and three channels (KCNQ4, SLC26A4 and SLC26A5 ) and the healthy individuals are heterozygous.
[Show full text]
Detailed Clinical Features of Deafness Caused by a Claudin-14 Variant
Article Detailed Clinical Features of Deafness Caused by a Claudin-14 Variant Tomohiro Kitano 1, Shin-ichiro Kitajiri 1,*, Shin-ya Nishio 1,2 and Shin-ichi Usami 1,2 1 Department of Otorhinolaryngology, Shinshu University School of Medicine, 3-1-1 Asahi, Matsumoto, Nagano 390-8621, Japan; [email protected] (T.K.); [email protected] (S.N.); [email protected] (S.U.) 2 Department of Hearing Implant Sciences, Shinshu University School of Medicine, 3-1-1 Asahi, Matsumoto, Nagano 390-8621, Japan * Correspondence: [email protected]; Tel.: +81-263-37-2666 Received: 23 July 2019; Accepted: 14 September 2019; Published: 16 September 2019 Abstract: Tight junctions are cellular junctions that play a major role in the epithelial barrier function. In the inner ear, claudins, occludin, tricellulin, and angulins form the bicellular or tricellular binding of membrane proteins. In these, one type of claudin gene, CLDN14, was reported to be responsible for human hereditary hearing loss, DFNB29. Until now, nine pathogenic variants have been reported, and most phenotypic features remain unclear. In the present study, genetic screening for 68 previously reported deafness causative genes was carried out to identify CLDN14 variants in a large series of Japanese hearing loss patients, and to clarify the prevalence and clinical characteristics of DFNB29 in the Japanese population. One patient had a homozygous novel variant (c.241C>T: p.Arg81Cys) (0.04%: 1/2549). The patient showed progressive bilateral hearing loss, with post-lingual onset. Pure-tone audiograms indicated a high-frequency hearing loss type, and the deterioration gradually spread to other frequencies.
[Show full text]
Morphology, Behavior, and the Sonic Hedgehog Pathway in Mouse Models of Down Syndrome
MORPHOLOGY, BEHAVIOR, AND THE SONIC HEDGEHOG PATHWAY IN MOUSE MODELS OF DOWN SYNDROME by Tara Dutka A dissertation submitted to Johns Hopkins University in conformity with the requirements for the degree of Doctor of Philosophy Baltimore, Maryland July, 2014 © 2014 Tara Dutka All Rights Reserved Abstract Down Syndrome (DS) is caused by a triplication of human chromosome 21 (Hsa21). Ts65Dn, a mouse model of DS, contains a freely segregating extra chromosome consisting of the distal portion of mouse chromosome 16 (Mmu16), a region orthologous to part of Hsa21, and a non-Hsa21 orthologous region of mouse chromosome 17. All individuals with DS display some level of craniofacial dysmorphology, brain structural and functional changes, and cognitive impairment. Ts65Dn recapitulates these features of DS and aspects of each of these traits have been linked in Ts65Dn to a reduced response to Sonic Hedgehog (SHH) in trisomic cells. Dp(16)1Yey is a new mouse model of DS which has a direct duplication of the entire Hsa21 orthologous region of Mmu16. Dp(16)1Yey’s creators found similar behavioral deficits to those seen in Ts65Dn. We performed a quantitative investigation of the skull and brain of Dp(16)1Yey as compared to Ts65Dn and found that DS-like changes to brain and craniofacial morphology were similar in both models. Our results validate examination of the genetic basis for these phenotypes in Dp(16)1Yey mice and the genetic links for these phenotypes previously found in Ts65Dn , i.e., reduced response to SHH. Further, we hypothesized that if all trisomic cells show a reduced response to SHH, then up-regulation of the SHH pathway might ameliorate multiple phenotypes.
[Show full text]
Advanced Intercross Line Mapping of Eae5 Reveals Ncf-1 and CLDN4 As
Advanced Intercross Line Mapping of Eae5 Reveals Ncf-1 and CLDN4 as Candidate Genes for Experimental Autoimmune Encephalomyelitis This information is current as of September 24, 2021. Kristina Becanovic, Maja Jagodic, Jian Rong Sheng, Ingrid Dahlman, Fahmy Aboul-Enein, Erik Wallstrom, Peter Olofsson, Rikard Holmdahl, Hans Lassmann and Tomas Olsson J Immunol 2006; 176:6055-6064; ; Downloaded from doi: 10.4049/jimmunol.176.10.6055 http://www.jimmunol.org/content/176/10/6055 http://www.jimmunol.org/ References This article cites 55 articles, 16 of which you can access for free at: http://www.jimmunol.org/content/176/10/6055.full#ref-list-1 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists by guest on September 24, 2021 • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2006 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Advanced Intercross Line Mapping of Eae5 Reveals Ncf-1 and CLDN4 as Candidate Genes for Experimental Autoimmune Encephalomyelitis1 Kristina Becanovic,2* Maja Jagodic,* Jian Rong Sheng,* Ingrid Dahlman,* Fahmy Aboul-Enein,† Erik Wallstrom,* Peter Olofsson,‡ Rikard Holmdahl,‡ Hans Lassmann,† and Tomas Olsson* ؋ ؋ Eae5 in rats was originally identiﬁed in two F2 intercrosses, (DA BN) and (E3 DA), displaying linkage to CNS inﬂammation and disease severity in experimental autoimmune encephalomyelitis (EAE), respectively.
[Show full text]