DOCSLIB.ORG

DACH1 (NM 080759) Human Tagged ORF Clone Product Data

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
DACH1 (NM 080759) Human Tagged ORF Clone Product Data OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC221505 DACH1 (NM_080759) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: DACH1 (NM_080759) Human Tagged ORF Clone Tag: Myc-DDK Symbol: DACH1 Synonyms: DACH Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 5 DACH1 (NM_080759) Human Tagged ORF Clone – RC221505 ORF Nucleotide >RC221505 representing NM_080759 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGTGCCGGCGGCTTTGATCCCTCCGACCCAGCTGGTCCCCCCTCAACCCCCAATCTCCACGTCTG CTTCCTCCTCTGGCACCACCACCTCCACCTCTTCGGCGACTTCGTCTCCGGCTCCTTCCATCGGACCCCC GGCGTCCTCTGGGCCAACTCTGTTCCGCCCGGAGCCCATCGCTTCGGCGGCGGCGGCGGCGGCCACAGTC ACCTCTACCGGCGGCGGCGGCGGCGGCGGCGGCAGCGGAGGCGGCGGCGGCAGCAGCGGCAACGGAGGCG GCGGTGGCGGCGGCGGCGGTGGCAGCAACTGCAACCCCAACCTGGCGGCCGCGAGCAACGGCAGCGGCGG CGGCGGCGGCGGCATCAGCGCTGGCGGCGGCGTCGCTTCCAGCACCCCCATCAACGCCAGCACCGGCAGC AGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGCAGCAGTAGTAGCAGCAGCAGCAGTAGCAGCAGCAGCT GCGGCCCCCTCCCCGGGAAACCCGTGTACTCAACCCCGTCCCCAGTGGAAAACACCCCTCAGAATAATGA GTGCAAAATGGTGGATCTGAGGGGGGCCAAAGTGGCTTCCTTCACGGTGGAGGGCTGCGAGCTGATCTGC CTGCCCCAGGCTTTCGACCTGTTCCTGAAGCACTTGGTGGGGGGCTTGCATACGGTCTACACCAAGCTGA AGCGGCTGGAGATCACGCCGGTGGTGTGCAATGTGGAACAAGTTCGCATCCTGAGGGGACTGGGCGCCAT CCAGCCAGGAGTGAACCGCTGCAAACTCATCTCCAGGAAGGACTTCGAGACCCTCTACAATGACTGCACC AACGCAAGTTCTAGACCTGGAAGGCCTCCTAAGAGGACTCAAAGTGTCACCTCCCCAGAGAACTCTCACA TCATGCCGCATTCTGTCCCTGGTCTCATGTCTCCTGGGATAATTCCACCAACAGGTCTGACAGCAGCCGC TGCAGCAGCTGCTGCTGCTACCAATGCAGCTATTGCTGAAGCAATGAAGGTGAAAAAAATCAAATTAGAA GCCATGAGCAACTATCATGCCAGTAATAACCAACATGGAGCAGACTCTGAAAACGGGGACATGAATTCAA GTGTCGGACTGGAACTTCCTTTTATGATGATGCCCCACCCTCTAATTCCTGTCAGCCTACCTCCAGCATC TGTCACCATGGCAATGAGCCAGATGAACCACCTCAGCACCATTGCAAATATGGCAGCAGCAGCACAAGTT CAGAGTCCCCCATCCAGAGTTGAGACATCAGTTATTAAGGAGCGTGTTCCTGATAGCCCCTCACCTGCCC CCTCTCTGGAGGAGGGGAGAAGGCCTGGCAGTCACCCATCATCACATCGCAGCAGCAGCGTGTCCAGCTC CCCTGCTCGGACTGAGAGCTCTTCTGACAGAATCCCGGTCCATCAGAATGGGTTGTCCATGAACCAGATG CTGATGGGCTTATCACCAAATGTACTTCCTGGGCCCAAAGAGGGAGATTTGGCCGGTCATGACATGGGAC ATGAGTCAAAAAGGATGCATATTGAAAAAGATGAGACCCCGCTTTCTACACCAACCGCAAGAGACAGCCT TGACAAACTCTCTCTAACTGGGCATGGACAACCACTGCCTCCAGGTTTTCCATCTCCTTTTCTGTTTCCT GATGGACTGTCTTCCATCGAGACTCTTCTGACTAACATACAGGGGCTGTTGAAAGTTGCCATAGATAATG CCAGAGCTCAAGAGAAACAGGTCCAACTGGAAAAAACTGAGCTGAAGATGGATTTTTTAAGGGAAAGAGA ACTAAGGGAAACACTTGAGAAGCAGTTGGCTATGGAACAAAAGAATAGAGCCATAGTTCAAAAGAGGCTA AAGAAGGAGAAGAAGGCAAAGAGAAAATTGCAGGAAGCACTTGAGTTTGAGACGAAACGGCGTGAACAAG CAGAACAGACGCTAAAACAGGCAGCTTCAACAGATAGTCTCAGGGTCTTAAATGACTCTCTGACCCCAGA GATAGAGGCTGACCGCAGTGGCGGCAGAACAGATGCTGAAAGGACAATACAAGATGGAAGACTGTATTTG AAAACTACTGTCATGTAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 5 DACH1 (NM_080759) Human Tagged ORF Clone – RC221505 Protein Sequence: >RC221505 representing NM_080759 Red=Cloning site Green=Tags(s) MAVPAALIPPTQLVPPQPPISTSASSSGTTTSTSSATSSPAPSIGPPASSGPTLFRPEPIASAAAAAATV TSTGGGGGGGGSGGGGGSSGNGGGGGGGGGGSNCNPNLAAASNGSGGGGGGISAGGGVASSTPINASTGS SSSSSSSSSSSSSSSSSSSSSSSCGPLPGKPVYSTPSPVENTPQNNECKMVDLRGAKVASFTVEGCELIC LPQAFDLFLKHLVGGLHTVYTKLKRLEITPVVCNVEQVRILRGLGAIQPGVNRCKLISRKDFETLYNDCT NASSRPGRPPKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLE AMSNYHASNNQHGADSENGDMNSSVGLELPFMMMPHPLIPVSLPPASVTMAMSQMNHLSTIANMAAAAQV QSPPSRVETSVIKERVPDSPSPAPSLEEGRRPGSHPSSHRSSSVSSSPARTESSSDRIPVHQNGLSMNQM LMGLSPNVLPGPKEGDLAGHDMGHESKRMHIEKDETPLSTPTARDSLDKLSLTGHGQPLPPGFPSPFLFP DGLSSIETLLTNIQGLLKVAIDNARAQEKQVQLEKTELKMDFLRERELRETLEKQLAMEQKNRAIVQKRL KKEKKAKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSLTPEIEADRSGGRTDAERTIQDGRLYL KTTVMY myc-FLAG tag Restriction Sites: SgfI-MluI Cloning Scheme: This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 5 DACH1 (NM_080759) Human Tagged ORF Clone – RC221505 Plasmid Map: ACCN: NM_080759 ORF Size: 2118 bp OTI Disclaimer: Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at [email protected] or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_080759.6 RefSeq Size: 5240 bp RefSeq ORF: 2121 bp Locus ID: 1602 UniProt ID: Q9UI36 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 4 / 5 DACH1 (NM_080759) Human Tagged ORF Clone – RC221505 Domains: Ski_Sno Protein Families: Transcription Factors MW: 73 kDa Gene Summary: This gene encodes a chromatin-associated protein that associates with other DNA-binding transcription factors to regulate gene expression and cell fate determination during development. The protein contains a Ski domain that is highly conserved from Drosophila to human. Expression of this gene is lost in some forms of metastatic cancer, and is correlated with poor prognosis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 5 / 5.
Load more

Recommended publications
  • Research Article Integrative Deep Learning for Identifying Differentially Expressed (DE) Biomarkers
    Hindawi Computational and Mathematical Methods in Medicine Volume 2019, Article ID 8418760, 10 pages https://doi.org/10.1155/2019/8418760 Research Article Integrative Deep Learning for Identifying Differentially Expressed (DE) Biomarkers Jayeon Lim ,1 SoYoun Bang,2 Jiyeon Kim,3 Cheolyong Park ,3 JunSang Cho,4 and SungHwan Kim 1 1Department of Applied Statistics, Konkuk University, Seoul, Republic of Korea 2Department of Data Science, Konkuk University, Seoul, Republic of Korea 3Department of Statistics, Keimyung University, Daegu, Republic of Korea 4Industry-University Cooperation Foundation, Konkuk University, Seoul, Republic of Korea Correspondence should be addressed to SungHwan Kim; [email protected] Received 5 April 2019; Revised 19 June 2019; Accepted 4 August 2019; Published 2 November 2019 Academic Editor: Esmaeil Ebrahimie Copyright © 2019 Jayeon Lim et al. +is is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. As a large amount of genetic data are accumulated, an effective analytical method and a significant interpretation are required. Recently, various methods of machine learning have emerged to process genetic data. In addition, machine learning analysis tools using statistical models have been proposed. In this study, we propose adding an integrated layer to the deep learning structure, which would enable the effective analysis of genetic data and the discovery of significant biomarkers of diseases. We conducted a simulation study in order to compare the proposed method with metalogistic regression and meta-SVM methods. +e objective function with lasso penalty is used for parameter estimation, and the Youden J index is used for model comparison.
    [Show full text]
  • Using Evolutionary Conserved Modules in Gene Networks As a Strategy to Leverage High Throughput Gene Expression Queries Jeanne M
    Ecology, Evolution and Organismal Biology Ecology, Evolution and Organismal Biology Publications 9-2010 Using Evolutionary Conserved Modules in Gene Networks as a Strategy to Leverage High Throughput Gene Expression Queries Jeanne M. Serb Iowa State University, [email protected] Megan C. Orr Iowa State University M. Heather West Greenlee Iowa State University, [email protected] Follow this and additional works at: http://lib.dr.iastate.edu/eeob_ag_pubs Part of the Ecology and Evolutionary Biology Commons, Genetics Commons, and the Systems Biology Commons The ompc lete bibliographic information for this item can be found at http://lib.dr.iastate.edu/ eeob_ag_pubs/19. For information on how to cite this item, please visit http://lib.dr.iastate.edu/ howtocite.html. This Article is brought to you for free and open access by the Ecology, Evolution and Organismal Biology at Iowa State University Digital Repository. It has been accepted for inclusion in Ecology, Evolution and Organismal Biology Publications by an authorized administrator of Iowa State University Digital Repository. For more information, please contact [email protected]. Using Evolutionary Conserved Modules in Gene Networks as a Strategy to Leverage High Throughput Gene Expression Queries Abstract Background: Large-scale gene expression studies have not yielded the expected insight into genetic networks that control complex processes. These anticipated discoveries have been limited not by technology, but by a lack of effective strategies to investigate the data in a manageable and meaningful way. Previous work suggests that using a pre-determined seednetwork of gene relationships to query large-scale expression datasets is an effective way to generate candidate genes for further study and network expansion or enrichment.
    [Show full text]
  • Estrogen Receptor Β, a Regulator of Androgen Receptor Signaling in The
    Estrogen receptor β, a regulator of androgen receptor PNAS PLUS signaling in the mouse ventral prostate Wan-fu Wua, Laure Maneixa, Jose Insunzab, Ivan Nalvarteb, Per Antonsonb, Juha Kereb, Nancy Yiu-Lin Yub, Virpi Tohonenb, Shintaro Katayamab, Elisabet Einarsdottirb, Kaarel Krjutskovb, Yu-bing Daia, Bo Huanga, Wen Sua,c, Margaret Warnera, and Jan-Åke Gustafssona,b,1 aCenter for Nuclear Receptors and Cell Signaling, University of Houston, Houston, TX 77204; bCenter for Innovative Medicine, Department of Biosciences and Nutrition, Karolinska Institutet, Novum, 14186 Stockholm, Sweden; and cAstraZeneca-Shenzhen University Joint Institute of Nephrology, Centre for Nephrology & Urology, Shenzhen University Health Science Center, Shenzhen 518060, China Contributed by Jan-Åke Gustafsson, March 31, 2017 (sent for review February 8, 2017; reviewed by Gustavo E. Ayala and David R. Rowley) − − − − As estrogen receptor β / (ERβ / ) mice age, the ventral prostate (13). Several ERβ-selective agonists have been synthesized (14– (VP) develops increased numbers of hyperplastic, fibroplastic le- 20), and they have been found to be antiinflammatory in the brain sions and inflammatory cells. To identify genes involved in these and the gastrointestinal tract (21, 22) and antiproliferative in cell changes, we used RNA sequencing and immunohistochemistry to lines (23–27) and cancer models (23, 28). We have previously − − compare gene expression profiles in the VP of young (2-mo-old) shown that there is an increase in p63-positive cells in ERβ / − − and aging (18-mo-old) ERβ / mice and their WT littermates. We mouse VP but that these cells were not confined to the basal layer also treated young and old WT mice with an ERβ-selective agonist but were interdispersed with the basal and luminal layer (13).
    [Show full text]
  • Endogenous Dach1 in Cancer
    www.impactjournals.com/oncoscience/ Oncoscience,Oncoscience Advance 2015, Publications Vol.2, No.10 2015 Editorial Endogenous Dach1 in cancer Kongming Wu, Xun Yuan and Richard Pestell The Dachshund gene is a key component of the epithelial cells (PEC) reduced Dach1 expression both in retinal determination gene network in Drosophila eye cultured cells and in extirpated tumor tissues [2]. Combined development. Recent studies have demonstrated an with previous finding that DACH1 represses ligand induced important role for the human Dachshund homologue transcriptional activation of the androgen receptor and 1 (DACH1) in tumorigenesis [1]. Mechanistic studies prostate cancer cellular proliferation in tissue culture [3], it demonstrated that DACH1 regulates its target genes via is likely that DACH1 conveys distinct functions at different either directly binding to specific DNA sequences within stages of prostate cancer onset and progression. chromatin or indirectly through forming protein complex The transition from hormone-dependent to castrate- with other transcriptional factors, including c-Jun and resistant prostate cancer (CRPC) is the major cause of Smad4. DACH1 restrained proliferation, migration therapeutic failure. Clinical studies have shown that in vitro and repressed tumor growth and metastasis in vivo. increased IL-6 and IL-8 signaling correlates with CRPC There prior observations were based on cultured cells and predicts poor prognosis [4]. IL-6 and IL-8 produced engineering DACH1 expression. The physiological role of by prostate cancer cell promote cancer cell proliferation the endogenous DACH1 had not been determined in part and invasion. because genetic deletion in the mice was periembryonic Moreover, IL-8 signaling from tumor cells initiates lethal.
    [Show full text]
  • DACH1 Inhibits Glioma Invasion and Tumor Growth Via the Wnt/Catenin Pathway
    Journal name: OncoTargets and Therapy Article Designation: Original Research Year: 2018 Volume: 11 OncoTargets and Therapy Dovepress Running head verso: Wang et al Running head recto: DACH1 inhibits glioma via the Wnt/catenin pathway open access to scientific and medical research DOI: 168314 Open Access Full Text Article ORIGINAL RESEARCH DACH1 inhibits glioma invasion and tumor growth via the Wnt/catenin pathway Jing Wang* Background/aim: Glioma is the most common and malignant nervous system tumor and Yan Zou* is associated with high-grade malignancy and high recurrence. The mammalian Dachshund1 Xuechao Wu (DACH1) is a recognized anti-tumor site and has low expression in several malignant tumors, Mu Chen including glioma. We designed and conducted this study to further determine the mechanism Shuai Zhang of DACH1 in glioma. Xiaojie Lu Patients and methods: The data collected from specimens of patients with glioma from GSE16011 and REMBRANDT databases were analyzed. The effect of DACH1 on proliferation, Qing Wang migration, and invasion of U87 and U251 cell lines was analyzed in vitro. The symbol targets Neurosurgery, The Affiliated Wuxi of the Wnt/β-catenin pathway were also evaluated through Western blot. No 2 People’s Hospital, Nanjing Medical University, Wuxi, Jiangsu, Results: DACH1 deficiency was found in glioma tissues, and the DACH1 level was negatively People’s Republic of China correlated with the tumor malignancy. DACH1 overexpression inhibited the tumor prolifera- For personal use only. *These authors contributed equally tion, migration, and invasion. High expression of DACH1 also dampened the Wnt/β-catenin to this work pathway, and the activation of the Wnt/β-catenin pathway partly led to the limited proliferation in glioma cells.
    [Show full text]
  • Dach1 (NM 007826) Mouse Tagged ORF Clone – MR216327 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MR216327 Dach1 (NM_007826) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Dach1 (NM_007826) Mouse Tagged ORF Clone Tag: Myc-DDK Symbol: Dach1 Synonyms: Dac; Dach Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 5 Dach1 (NM_007826) Mouse Tagged ORF Clone – MR216327 ORF Nucleotide >MR216327 representing NM_007826 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCAGTGCCGGCGGCTTTGATCCCTCCGACCCAGCTGGTCCCCCCTCAACCCCCGATCTCTACTTCTG CTTCCTCCTCGGGCACCACCACCTCCACCTCCTCGGCGACCTCGTCTCCGGCTCCATCCATCGGACCCCC GGCGTCGTCTGGGCCAACTCTGTTCCGGCCGGAGCCCATTGCCTCTTCTGCTTCTTCTTCAGCCGCGGCC ACAGTCACCTCTCCTGGTGGCGGCGGCGGCGGCAGCGGAGGCGGCGGTGGCAGCGGCGGCAACGGAGGCG GCGGCGGGAGCAACTGCAACCCCAGCCTGGCGGCCGGGAGCAGCGGCGGCGGCGTTAGCGCTGGCGGCGG CGGCGCCTCCAGCACCCCCATCACCGCGAGCACCGGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGCAGT AGCAGCAGCAGCAGCAGTAGCAGCAGCAGCAGCAGTAGCAGCAGCAGCTGCGGCCCCCTCCCTGGGAAAC CCGTGTACTCAACCCCGTCCCCAGTGGAAAACACCCCCCAGAATAATGAGTGCAAAATGGTGGATCTGAG AGGGGCCAAAGTGGCTTCCTTTACGGTGGAGGGCTGCGAGCTGATCTGCCTGCCCCAGGCTTTCGACCTG
    [Show full text]
  • Conserved Role for the Dachshund Protein with Drosophila Pax6 Homolog Eyeless in Insulin Expression
    Conserved role for the Dachshund protein with Drosophila Pax6 homolog Eyeless in insulin expression Naoki Okamoto, Yuka Nishimori, and Takashi Nishimura1 Laboratory for Growth Control Signaling, RIKEN Center for Developmental Biology, Chuo-ku Kobe, Hyogo 650-0047, Japan Edited by Lynn M. Riddiford, Howard Hughes Medical Institute, Janelia Farm Research Campus, Ashburn, VA, and approved December 29, 2011 (received for review September 29, 2011) Members of the insulin family peptides have conserved roles in the regulates two different processes in the IPCs during development. regulation of growth and metabolism in a wide variety of metazo- A previous study (10) demonstrated that a series of genes, dachs- ans. The Drosophila genome encodes seven insulin-like peptide hund (dac), ey, optix,andtiptop (tio), are expressed in the IPC lin- genes, dilp1–7, and the most prominent dilps (dilp2, dilp3, and eage at the embryonic stage. Interestingly, all these genes function dilp5) are expressed in brain neurosecretory cells known as “insu- in a genetic regulatory module to initiate the development of the lin-producing cells” (IPCs). Although these dilps are expressed in the eye from epithelial tissue (18–20). In mammals, the genes that same cells, the expression of each dilp is regulated independently. determine islet cell differentiation during embryogenesis control However, the molecular mechanisms that regulate the expression the tissue-specific expression of islet cell hormones in the adult. of individual dilps in the IPCs remain largely unknown. Here, we Therefore we tested whether genes that are involved in eye de- show that Dachshund (Dac), which is a highly conserved nuclear velopment regulate dilp expression at later stages of development.
    [Show full text]
  • The Transcription Factor Dach1 Is Essential for Podocyte Function
    Received: 29 June 2017 | Accepted: 24 December 2017 DOI: 10.1111/jcmm.13544 ORIGINAL ARTICLE The transcription factor Dach1 is essential for podocyte function Nicole Endlich1 | Felix Kliewe1 | Frances Kindt1 | Katharina Schmidt1 | Ahmed M. Kotb1,2 | Nadine Artelt1 | Maja T. Lindenmeyer3 | Clemens D. Cohen3 | Franziska Doring€ 1 | Andreas W. Kuss4 | Kerstin Amann5 | Marcus J. Moeller6 | Nazanin Kabgani6 | Antje Blumenthal1 | Karlhans Endlich1 1Department of Anatomy and Cell Biology, University Medicine Greifswald, Greifswald, Abstract Germany Dedifferentiation and loss of podocytes are the major cause of chronic kidney disease. 2Department of Anatomy and Histology, Dach1, a transcription factor that is essential for cell fate, was found in genome-wide Faculty of Veterinary Medicine, Assiut University, Assiut, Egypt association studies to be associated with the glomerular filtration rate. We found that 3Nephrological Center, Medical Clinic and podocytes express high levels of Dach1 in vivo and to a much lower extent in vitro. Policlinic IV, University of Munich, Munich, Germany Parietal epithelial cells (PECs) that are still under debate to be a type of progenitor cell 4Department of Functional Genomics, for podocytes expressed Dach1 only at low levels. The transfection of PECs with a University Medicine Greifswald, Greifswald, plasmid encoding for Dach1 induced the expression of synaptopodin, a podocyte-spe- Germany 5Department of Nephropathology, Institute cific protein, demonstrated by immunocytochemistry and Western blot. Furthermore, of Pathology, University Hospital Erlangen, synaptopodin was located along actin fibres in a punctate pattern in Dach1-expressing Erlangen, Germany PECs comparable with differentiated podocytes. Moreover, dedifferentiating podo- 6Department of Internal Medicine II, Nephrology and Clinical Immunology, RWTH cytes of isolated glomeruli showed a significant reduction in the expression of Dach1 Aachen University Hospital, Aachen, Germany together with synaptopodin after 9 days in cell culture.
    [Show full text]
  • Combinatorial Targeting of the Androgen Receptor for Prostate
    Combinatorial Targeting of the Androgen Receptor for Prostate Cancer Therapy A thesis submitted to the University of Adelaide in the fulfilment of the requirements for the degree of Doctor of Philosophy By Sarah Louise Carter B.BiomolChem.(Hons) Dame Roma Mitchell Cancer Research Laboratories School of Medicine The University of Adelaide and The Hanson Institute March 2015 Contents Chapter 1: General Introduction ........................................................................................1 1.1 Background ..................................................................................................................2 1.2 Androgens and the Prostate ..........................................................................................3 1.3 Androgen Signalling through the Androgen Receptor .................................................4 1.3.1 The androgen receptor (AR) ..................................................................................4 1.3.2 Androgen signalling in the prostate .......................................................................6 1.4 Current Treatment Strategies for Prostate Cancer ........................................................8 1.4.1 Diagnosis ...............................................................................................................8 1.4.2 Localised disease .................................................................................................10 1.4.3 Relapse and metastatic disease ............................................................................13
    [Show full text]
  • DACH1 (C2) Antibody, Rabbit Polyclonal
    Order: (888)-282-5810 (Phone) (818)-707-0392 (Fax) [email protected] Web: www.Abiocode.com DACH1 (C2) Antibody, Rabbit Polyclonal Cat#: R0756-3 Lot#: Refer to vial Quantity: 100 ul Application: WB Predicted M.W.: 78.5 kDa Uniprot ID: Q9UI36 Background: Dachshund homolog 1 (DACH1) is a transcription factor involved in regulation of organogenesis. It appears to be a regulator of SIX1, SIX6 and probably SIX5. Corepression of precursor cell proliferation in myoblasts by SIX1 is switched to coactivation through recruitment of EYA3 to the SIX1- DACH1 complex. DACH1 may act as a corepressor of SIX6 in regulating proliferation by directly repressing cyclin-dependent kinase inhibitors, including the p27Kip1 promoter. It also inhibits TGF- beta signaling through interaction with SMAD4 and NCOR1 and binding to chromatin DNA via the DACHbox-N domain. Expression of DACH1 is lost in certain forms of metastatic cancer, and is correlated with poor prognosis. Other Names: Dachshund homolog 1, DACH Source and Purity: Rabbit polyclonal antibodies were produced by immunizing animals with a GST-fusion protein containing the C-terminal region of human DACH1. Antibodies were purified by affinity purification using immunogen. Storage Buffer and Condition: Supplied in 1 x PBS (pH 7.4), 100 ug/ml BSA, 40% Glycerol, 0.01% NaN3. Store at -20 °C. Stable for 6 months from date of receipt. Species Specificity: Human Tested Applications: WB: 1:500-1:1,000 (detect endogenous protein*) *: The apparent protein size on WB may be different from the calculated M.W. due to modifications. For research use only. Not for therapeutic or diagnostic purposes.
    [Show full text]
  • DACH1 Inhibits Cyclin D1 Expression, Cellular Proliferation and Tumor
    Chu et al. Journal of Hematology & Oncology 2014, 7:73 http://www.jhoonline.org/content/7/1/73 JOURNAL OF HEMATOLOGY & ONCOLOGY RESEARCH Open Access DACH1 inhibits cyclin D1 expression, cellular proliferation and tumor growth of renal cancer cells Qian Chu1, Na Han1, Xun Yuan1, Xin Nie1, Hua Wu1, Yu Chen1, Mingzhou Guo2, Shiying Yu1 and Kongming Wu1* Abstract Background: Renal cell carcinoma (RCC) is a complex with diverse biological characteristics and distinct molecular signature. New target therapies to molecules that drive RCC initiation and progression have achieved promising responses in some patients, but the total effective rate is still far from satisfaction. Dachshund (DACH1) network is a key signaling pathway for kidney development and has recently been identified as a tumor suppressor in several cancer types. However, its role in renal cell carcinoma has not been fully investigated. Methods: Immunohistochemical staining for DACH1, PCNA and cyclin D1 was performed on human renal tissue microaraays and correlation with clinic-pathological characteristics was analyzed. In vitro proliferation, apoptosis and in vivo tumor growth were evaluated on human renal cancer cell lines with decitabine treatment or ectopic expression of DACH1. Downstream targets and potential molecular mechanism were investigated through western blot, immunoprecipitation and reporter gene assays. Results: Expression of DACH1 was significantly decreased in human renal carcinoma tissue. DACH1 protein abundance was inversely correlated with the expression of PCNA and cyclin D1, tumor grade, and TNM stage. Restoration of DACH1 function in renal clear cell cancer cells inhibited in vitro cellular proliferation, S phase progression, clone formation, and in vivo tumor growth.
    [Show full text]
  • Transcriptomics of Atopy and Atopic Asthma in White Blood Cells from Children and Adolescents
    Early View Original article Transcriptomics of atopy and atopic asthma in white blood cells from children and adolescents Yale Jiang, Olena Gruzieva, Ting Wang, Erick Forno, Nadia Boutaoui, Tao Sun, Simon K. Merid, Edna Acosta-Pérez, Inger Kull, Glorisa Canino, Josep M. Antó, Jean Bousquet, Erik Melén, Wei Chen, Juan C. Celedón Please cite this article as: Jiang Y, Gruzieva O, Wang T, et al. Transcriptomics of atopy and atopic asthma in white blood cells from children and adolescents. Eur Respir J 2019; in press (https://doi.org/10.1183/13993003.00102-2019). This manuscript has recently been accepted for publication in the European Respiratory Journal. It is published here in its accepted form prior to copyediting and typesetting by our production team. After these production processes are complete and the authors have approved the resulting proofs, the article will move to the latest issue of the ERJ online. Copyright ©ERS 2019 Transcriptomics of atopy and atopic asthma in white blood cells from children and adolescents Yale Jiang, MDc1,2*, Olena Gruzieva, PhD3*, Ting Wang, PhD1, Erick Forno, MD, MPH1, Nadia Boutaoui, PhD1, Tao Sun, MS4, Simon K. Merid, MSc3, Edna Acosta-Pérez, PhD5, Inger Kull, PhD3, Glorisa Canino, PhD5, Josep M. Antó, MD, PhD7, Jean Bousquet, MD, PhD8, Erik Melén, MD, PhD3**, Wei Chen, PhD1,**, Juan C. Celedón, MD, DrPH1** *Equal contribution **Shared senior authors 1Division of Pulmonary Medicine, Department of Pediatrics, UPMC Children’s Hospital of Pittsburgh, University of Pittsburgh, Pittsburgh, PA 2School of Medicine, Tsinghua University, Beijing, China 3Institute of Environmental Medicine, Karolinska Institutet, Stockholm, Sweden 4Department of Biostatistics, Graduate School of Public Health, University of Pittsburgh, Pittsburgh, PA 5Behavioral Sciences Research Institute, University of Puerto Rico, San Juan, PR.
    [Show full text]