DOCSLIB.ORG

Functional Clusters of Autoantibodies Targeting TLR and SMAD Pathways Stratify Novel Subgroups of Systemic Lupus Erythematosus

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Functional Clusters of Autoantibodies Targeting TLR and SMAD Pathways Stratify Novel Subgroups of Systemic Lupus Erythematosus Submitted Manuscript: Confidential template updated: February 28 2012 Title: Functional clusters of autoantibodies targeting TLR and SMAD pathways stratify novel subgroups of Systemic Lupus Erythematosus Authors: M. J. Lewis1, M. B. McAndrew2, C. Wheeler2, N. Workman2, P. Agashe2, J. Koopmann2, E. Uddin2, L. Zou1, R. Stark2, J. Anson2, A. P. Cope3, T. J. Vyse4* Affiliations: 1Centre for Experimental Medicine and Rheumatology, William Harvey Research Institute, Barts and The London School of Medicine and Dentistry, Queen Mary University of London, London, EC1M 6BQ, UK. 2Oxford Gene Technology, Unit 15, Oxford Industrial Park, Yarnton, Oxfordshire, OX5 1QU, UK. 3Academic Department of Rheumatology, Centre for Molecular and Cellular Biology of Inflammation, King’s College London, London, SE1 9RT, UK. 4Department of Medical and Molecular Genetics, King’s College London, London, SE1 9RT, UK. *To whom correspondence should be addressed: [email protected] Tel. +44 20 7188 8431 Fax +44 20 7188 2585 One Sentence Summary: Using an advanced design of protein microarray, we reveal the identity of over 100 proteins targeted by autoantibodies in the autoimmune disease Systemic Lupus Erythematosus, and show that these novel autoantigens cluster into functionally-related groups involved in toll-like receptor pathways and SMAD signaling. Abstract: The molecular targets of the vast majority of autoantibodies in systemic lupus erythematosus (SLE) are unknown. Using a baculovirus-insect cell expression system to create an advanced protein microarray with improved protein folding and epitope conservation, we assayed sera from 277 SLE individuals and 280 age, gender and ethnicity matched controls. Here, we identified 103 novel autoantigens in SLE sera and show that SLE autoantigens are distinctly clustered into four functionally related groups. The original SLE autoantigens Ro60, La, and SMN1/Sm complex formed the first distinct antigen cluster (SLE1a). A further set of antigens (SLE1b) extended this group with other proteins involved in RNA, DNA and chromatin processing. The largest two subgroups of novel autoantigens involved interconnected genes involved in receptor-regulated SMAD signalling (SLE2) and toll-like receptor pathways and lymphocyte development (SLE3). SLE individuals clustered into four subgroups matching the four functional clusters of autoantigens, which suggests that autoantibody profiles of SLE patients identify subgroups with different underlying pathogenic immune mechanisms. The microarray revealed a significant number of ethnicity-sensitive autoantibodies in keeping with the strong influence of ethnicity on SLE prevalence, severity and organ involvement. Multiple recent failures of new SLE therapies in clinical trials demonstrates that there is a need for improved classification of SLE and related connective tissue diseases. The novel autoantibody clusters identified in this study represent a major advance in SLE diagnostics, and enable identification of new subgroups of SLE, each of which may require different therapeutic strategies. 2 [Main Text: ] Introduction Although first described in 1957, anti-nuclear antibodies (ANA) and anti-double-stranded DNA (dsDNA) antibodies remain the main diagnostic tests for systemic lupus erythematosus (SLE) (1, 2). Following the development of assays for extractable nuclear antigens Ro, La, Sm and U1- RNP, there have been no significant improvements in diagnostic assays for SLE for many years (3). In contrast, the identification of citrullinated proteins as autoantigen epitopes in rheumatoid arthritis (RA) led to a marked improvement in RA diagnostic tests with the development of anti- cyclic citrullinated peptide (CCP) assays. Although numerous SLE-associated autoantibodies have been described (4), they have not significantly improved upon the diagnostic and biomarker abilities of conventional SLE tests, and all too often the true molecular target remains undefined. Protein microarrays using spots of autoantigens applied to glass slides for detecting autoantibodies in sera of SLE patients were first reported in 2002 by Robinson et al (5). This initial study was largely based on existing autoantigens, as were subsequent similar studies, which identified several glomerular antigens and serum factors including B cell-activating factor (BAFF) as autoantibody targets in SLE individuals (6-10). Microarrays utilising large scale de novo synthesis of thousands of proteins have detected autoantibodies in cancer and other diseases (11, 12), but were only able to identify one novel SLE autoantigen, a chloride intracellular channel, CLIC2 (13). Older, first generation protein microarrays may have failed to identify autoantibodies for a number of reasons: bacterial and yeast protein expression systems employed in older studies are prone to generate proteins of poor conformation due to misfolding and lack of higher species post-translational modifications; furthermore, early protein microarrays were not designed to preserve protein epitopes in their native conformation. In this study, we describe a next generation protein microarray utilising 1545 distinct proteins chosen from multiple functional and disease pathways, to probe for the presence of autoantibodies to novel autoantigens in SLE. Our overall aim being to identify previously undiscovered autoantibodies that in combination might act as SLE biomarkers that will substantially improve the diagnostic (and potentially prognostic) performance over existing clinical assays. The protein microarray platform used in this study has been designed to display full-length, correctly folded proteins. Proteins bound to the array are expressed with a biotin carboxyl carrier protein (BCCP) folding tag using a baculovirus insect cell expression system and screened for correct folding before being arrayed in a specific, oriented manner designed to conserve native, discontinuous epitopes (Fig. 1A) (14, 15). This newer design of protein microarray has never before been applied to autoimmune disease. In this study, we set out to validate this novel protein microarray as a platform for improving antibody-based diagnostic tests and to identify the underlying nature of autoantigens in SLE. Results Identification of novel SLE-associated autoantigens During the discovery phase of the study, serum samples from 86 SLE patients and 90 age, gender and ethnicity matched healthy controls were analysed for IgG autoantibody levels against 1545 correctly folded, full-length human proteins using the Discovery array v.3.0 protein array (Oxford Gene Technology, UK) (Fig. 1A). Samples were assayed by ELISA for ANA and anti- dsDNA antibodies for comparison. Candidate autoantigens were identified for validation in two 3 further cohorts of UK SLE patients and tested against a confounding autoimmune disease cohort including individuals with the following conditions: rheumatoid arthritis (n=68), systemic sclerosis (n=12) and primary Sjögren’s syndrome (n=6), polymyositis (n=3) and mixed connective tissue disease (n=3). After correction for multiple testing, the array identified a total of 116 autoantibodies (Figure 1B, Table 1), with higher antibody levels in SLE patients compared to controls, at a false discovery rate (FDR) of <0.01. The well-known SLE autoantigens TROVE2 (Ro60) and SSB (La) showed the most significant difference between SLE and control groups. The array validated a further 11 previously reported SLE autoantigens (Fig. 1C): PABPC1 (16), ANXA1 (Annexin A1) (17), HMGB2 (18), HNRNPA2B1 (19, 20), PSME3 (also known as Ki) (21), ARAF (22), DEK (23), MAP3K14 (NIK) (23), APEX1 (24), MAGEB1 and MAGEB2 (25), RPL10 (26) and PSIP1 (27). A total of 103 novel autoantigens were identified by the microarray, with the most statistically significant six novel autoantibodies shown in Fig. 1D. Ten of the autoantigens have been shown to be implicated in SLE pathogenesis through immunological studies, but were not previously known to be autoantigens: CREB1, ZAP70, VAV1, PPP2CB, TEK (Tie2 receptor), IRF4, IRF5, EGR2, PPP2R5A and LYN (28-33). Five novel autoantigens are the products of SLE susceptibility genes including the well known genes IRF5 and LYN, as well as PIK3C3, NFKBIA and DNAJA1 (34-38). In summary, 26 of the 116 autoantigens have a previously identified link to SLE, either as known autoantibody targets or directly implicated in SLE pathogenesis. In a secondary analysis of all three cohorts pooled, autoantibodies from the array were ranked by positivity in SLE patients, defined as autoantibody levels >2 SD of the control population, and tested for statistical significance using Fisher’s exact test, corrected for multiple testing. The most prevalent autoantibodies were the known SLE autoantigens Ro60 (37.5%), SSB/La (35.4%), HNRNPA2B1 (29.6%) and PSME3/Ki (23.8%) (Fig. 2A). The most prevalent novel autoantibodies were LIN28A (22.4%), IGF2BP3 (21.7%) and HNRNPUL1 (21.3%). SLE patients tended to be simultaneously positive for multiple autoantibodies in contrast to the control group (Kruskal-Wallis test with post-hoc Nemenyi test, P<2 x 10-16) and confounding disease group (P=6.7 x 10-9), with some individuals producing antibodies against over 60 antigens (Fig. 2B). SLE autoantibodies cluster into distinct subgroups Since we observed that groups of autoantibodies showed strong cross-correlation, we performed unsupervised hierarchical clustering of autoantibody levels in SLE individuals (n=277). Four distinct clusters of autoantibodies (Clusters 1a, 1b, 2 and 3) could be observed
Load more

Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Functional Parsing of Driver Mutations in the Colorectal Cancer Genome Reveals Numerous Suppressors of Anchorage-Independent
    Supplementary information Functional parsing of driver mutations in the colorectal cancer genome reveals numerous suppressors of anchorage-independent growth Ugur Eskiocak1, Sang Bum Kim1, Peter Ly1, Andres I. Roig1, Sebastian Biglione1, Kakajan Komurov2, Crystal Cornelius1, Woodring E. Wright1, Michael A. White1, and Jerry W. Shay1. 1Department of Cell Biology, University of Texas Southwestern Medical Center, 5323 Harry Hines Boulevard, Dallas, TX 75390-9039. 2Department of Systems Biology, University of Texas M.D. Anderson Cancer Center, Houston, TX 77054. Supplementary Figure S1. K-rasV12 expressing cells are resistant to p53 induced apoptosis. Whole-cell extracts from immortalized K-rasV12 or p53 down regulated HCECs were immunoblotted with p53 and its down-stream effectors after 10 Gy gamma-radiation. ! Supplementary Figure S2. Quantitative validation of selected shRNAs for their ability to enhance soft-agar growth of immortalized shTP53 expressing HCECs. Each bar represents 8 data points (quadruplicates from two separate experiments). Arrows denote shRNAs that failed to enhance anchorage-independent growth in a statistically significant manner. Enhancement for all other shRNAs were significant (two tailed Studentʼs t-test, compared to none, mean ± s.e.m., P<0.05)." ! Supplementary Figure S3. Ability of shRNAs to knockdown expression was demonstrated by A, immunoblotting for K-ras or B-E, Quantitative RT-PCR for ERICH1, PTPRU, SLC22A15 and SLC44A4 48 hours after transfection into 293FT cells. Two out of 23 tested shRNAs did not provide any knockdown. " ! Supplementary Figure S4. shRNAs against A, PTEN and B, NF1 do not enhance soft agar growth in HCECs without oncogenic manipulations (Student!s t-test, compared to none, mean ± s.e.m., ns= non-significant).
    [Show full text]
  • Supplemental Materials ZNF281 Enhances Cardiac Reprogramming
    Supplemental Materials ZNF281 enhances cardiac reprogramming by modulating cardiac and inflammatory gene expression Huanyu Zhou, Maria Gabriela Morales, Hisayuki Hashimoto, Matthew E. Dickson, Kunhua Song, Wenduo Ye, Min S. Kim, Hanspeter Niederstrasser, Zhaoning Wang, Beibei Chen, Bruce A. Posner, Rhonda Bassel-Duby and Eric N. Olson Supplemental Table 1; related to Figure 1. Supplemental Table 2; related to Figure 1. Supplemental Table 3; related to the “quantitative mRNA measurement” in Materials and Methods section. Supplemental Table 4; related to the “ChIP-seq, gene ontology and pathway analysis” and “RNA-seq” and gene ontology analysis” in Materials and Methods section. Supplemental Figure S1; related to Figure 1. Supplemental Figure S2; related to Figure 2. Supplemental Figure S3; related to Figure 3. Supplemental Figure S4; related to Figure 4. Supplemental Figure S5; related to Figure 6. Supplemental Table S1. Genes included in human retroviral ORF cDNA library. Gene Gene Gene Gene Gene Gene Gene Gene Symbol Symbol Symbol Symbol Symbol Symbol Symbol Symbol AATF BMP8A CEBPE CTNNB1 ESR2 GDF3 HOXA5 IL17D ADIPOQ BRPF1 CEBPG CUX1 ESRRA GDF6 HOXA6 IL17F ADNP BRPF3 CERS1 CX3CL1 ETS1 GIN1 HOXA7 IL18 AEBP1 BUD31 CERS2 CXCL10 ETS2 GLIS3 HOXB1 IL19 AFF4 C17ORF77 CERS4 CXCL11 ETV3 GMEB1 HOXB13 IL1A AHR C1QTNF4 CFL2 CXCL12 ETV7 GPBP1 HOXB5 IL1B AIMP1 C21ORF66 CHIA CXCL13 FAM3B GPER HOXB6 IL1F3 ALS2CR8 CBFA2T2 CIR1 CXCL14 FAM3D GPI HOXB7 IL1F5 ALX1 CBFA2T3 CITED1 CXCL16 FASLG GREM1 HOXB9 IL1F6 ARGFX CBFB CITED2 CXCL3 FBLN1 GREM2 HOXC4 IL1F7
    [Show full text]
  • PRODUCT SPECIFICATION Prest Antigen GTF2E2 Product Datasheet
    PrEST Antigen GTF2E2 Product Datasheet PrEST Antigen PRODUCT SPECIFICATION Product Name PrEST Antigen GTF2E2 Product Number APrEST89212 Gene Description general transcription factor IIE, polypeptide 2, beta 34kDa Alternative Gene FE, TF2E2, TFIIE-B Names Corresponding Anti-GTF2E2 (HPA004816) Antibodies Description Recombinant protein fragment of Human GTF2E2 Amino Acid Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEF QKLWRSVTVDSMDEEKIEEYLKRQGISSMQESGPKKVAPIQRRKKPASQK KRRFKTHNEHLAGVLKDYSDITSSK Fusion Tag N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) Expression Host E. coli Purification IMAC purification Predicted MW 32 kDa including tags Usage Suitable as control in WB and preadsorption assays using indicated corresponding antibodies. Purity >80% by SDS-PAGE and Coomassie blue staining Buffer PBS and 1M Urea, pH 7.4. Unit Size 100 µl Concentration Lot dependent Storage Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. No products from Atlas Antibodies may be resold, modified for resale or used to manufacture commercial products without prior written approval from Atlas Antibodies AB. Warranty: The products supplied by Atlas Antibodies are warranted to meet stated product specifications and to conform to label descriptions when used and stored properly. Unless otherwise stated, this warranty is limited to one year from date of sales for products used, handled and stored according to Atlas Antibodies AB's instructions. Atlas Antibodies AB's sole liability is limited to replacement of the product or refund of the purchase price.
    [Show full text]
  • In Patients with Rheumatoid Arthritis This Information Is Current As of September 26, 2021
    Characterization of Autoreactive T Cells to the Autoantigens Heterogeneous Nuclear Ribonucleoprotein A2 (RA33) and Filaggrin in Patients with Rheumatoid Arthritis This information is current as of September 26, 2021. Ruth Fritsch, Daniela Eselböck, Karl Skriner, Beatrice Jahn-Schmid, Clemens Scheinecker, Barbara Bohle, Makiyeh Tohidast-Akrad, Silvia Hayer, Josef Neumüller, Serafin Pinol-Roma, Josef S. Smolen and Günter Steiner J Immunol 2002; 169:1068-1076; ; Downloaded from doi: 10.4049/jimmunol.169.2.1068 http://www.jimmunol.org/content/169/2/1068 References This article cites 83 articles, 9 of which you can access for free at: http://www.jimmunol.org/ http://www.jimmunol.org/content/169/2/1068.full#ref-list-1 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists by guest on September 26, 2021 • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2002 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. The Journal of Immunology Characterization of Autoreactive T Cells to the Autoantigens Heterogeneous Nuclear Ribonucleoprotein A2 (RA33) and Filaggrin in Patients with Rheumatoid Arthritis1 Ruth Fritsch,* Daniela Eselbo¨ck,* Karl Skriner,*† Beatrice Jahn-Schmid,*‡ Clemens Scheinecker,2* Barbara Bohle,‡ Makiyeh Tohidast-Akrad,¶ Silvia Hayer,* Josef Neumu¨ller,§ Serafin Pinol-Roma,ʈ Josef S.
    [Show full text]
  • WO 2019/079361 Al 25 April 2019 (25.04.2019) W 1P O PCT
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization I International Bureau (10) International Publication Number (43) International Publication Date WO 2019/079361 Al 25 April 2019 (25.04.2019) W 1P O PCT (51) International Patent Classification: CA, CH, CL, CN, CO, CR, CU, CZ, DE, DJ, DK, DM, DO, C12Q 1/68 (2018.01) A61P 31/18 (2006.01) DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, C12Q 1/70 (2006.01) HR, HU, ID, IL, IN, IR, IS, JO, JP, KE, KG, KH, KN, KP, KR, KW, KZ, LA, LC, LK, LR, LS, LU, LY, MA, MD, ME, (21) International Application Number: MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, PCT/US2018/056167 OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, (22) International Filing Date: SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, 16 October 2018 (16. 10.2018) TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW. (25) Filing Language: English (84) Designated States (unless otherwise indicated, for every kind of regional protection available): ARIPO (BW, GH, (26) Publication Language: English GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, ST, SZ, TZ, (30) Priority Data: UG, ZM, ZW), Eurasian (AM, AZ, BY, KG, KZ, RU, TJ, 62/573,025 16 October 2017 (16. 10.2017) US TM), European (AL, AT, BE, BG, CH, CY, CZ, DE, DK, EE, ES, FI, FR, GB, GR, HR, HU, ΓΕ , IS, IT, LT, LU, LV, (71) Applicant: MASSACHUSETTS INSTITUTE OF MC, MK, MT, NL, NO, PL, PT, RO, RS, SE, SI, SK, SM, TECHNOLOGY [US/US]; 77 Massachusetts Avenue, TR), OAPI (BF, BJ, CF, CG, CI, CM, GA, GN, GQ, GW, Cambridge, Massachusetts 02139 (US).
    [Show full text]
  • Alveolar Rhabdomyosarcoma-Associated Proteins PAX3/FOXO1A and PAX7/FOXO1A Suppress the Transcriptional Activity of Myod-Target Genes in Muscle Stem Cells
    Oncogene (2013) 32, 651 --662 & 2013 Macmillan Publishers Limited All rights reserved 0950-9232/13 www.nature.com/onc ORIGINAL ARTICLE Alveolar rhabdomyosarcoma-associated proteins PAX3/FOXO1A and PAX7/FOXO1A suppress the transcriptional activity of MyoD-target genes in muscle stem cells F Calhabeu1, S Hayashi2, JE Morgan3, F Relaix2 and PS Zammit1 Rhabdomyosarcoma (RMS) is the commonest soft-tissue sarcoma in childhood and is characterized by expression of myogenic proteins, including the transcription factors MyoD and myogenin. There are two main subgroups, embryonal RMS and alveolar RMS (ARMS). Most ARMS are associated with chromosomal translocations that have breakpoints in introns of either PAX3 or PAX7, and FOXO1A. These translocations create chimeric transcription factors termed PAX3/FOXO1A and PAX7/FOXO1A respectively. Upon ectopic PAX3/FOXO1A expression, together with other genetic manipulation in mice, both differentiating myoblasts and satellite cells (the resident stem cells of postnatal muscle) can give rise to tumours with ARMS characteristics. As PAX3 and PAX7 are part of transcriptional networks that regulate muscle stem cell function in utero and during early postnatal life, PAX3/FOXO1A and PAX7/FOXO1A may subvert normal PAX3 and PAX7 functions. Here we examined how PAX3/FOXO1A and PAX7/FOXO1A affect myogenesis in satellite cells. PAX3/FOXO1A or PAX7/FOXO1A inhibited myogenin expression and prevented terminal differentiation in murine satellite cells: the same effect as dominant-negative (DN) Pax3 or Pax7 constructs. The transcription of MyoD-target genes myogenin and muscle creatine kinase were suppressed by PAX3/FOXO1A or PAX7/ FOXO1A in C2C12 myogenic cells again as seen with Pax3/7DN. PAX3/FOXO1A or PAX7/FOXO1A did not inhibit the transcriptional activity of MyoD by perturbing MyoD expression, localization, phosphorylation or interaction with E-proteins.
    [Show full text]
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
    [Show full text]
  • Microarray-Based Analysis of Genes, Transcription Factors, and Epigenetic Modifications in Lung Cancer Exposed to Nitric Oxide
    CANCER GENOMICS & PROTEOMICS 17 : 401-415 (2020) doi:10.21873/cgp.20199 Microarray-based Analysis of Genes, Transcription Factors, and Epigenetic Modifications in Lung Cancer Exposed to Nitric Oxide ARNATCHAI MAIUTHED 1, ORNJIRA PRAKHONGCHEEP 2,3 and PITHI CHANVORACHOTE 2,3 1Department of Pharmacology, Faculty of Pharmacy, Mahidol University, Bangkok, Thailand; 2Cell-based Drug and Health Product Development Research Unit, Faculty of Pharmaceutical Sciences, Chulalongkorn University, Bangkok, Thailand; 3Department of Pharmacology and Physiology, Faculty of Pharmaceutical Sciences, Chulalongkorn University, Bangkok, Thailand Abstract. Background/Aim: Nitric oxide (NO) is recognized NO exposure of lung cancer cells resulted in a change in as an important biological mediator that exerts several transcription factors (TFs) and epigenetic modifications human physiological functions. As its nature is an aqueous (histone modification and miRNA). Interestingly, NO soluble gas that can diffuse through cells and tissues, NO treatment was shown to potentiate cancer stem cell-related can affect cell signaling, the phenotype of cancer and modify genes and transcription factors Oct4, Klf4, and Myc. surrounding cells. The variety of effects of NO on cancer cell Conclusion: Through this comprehensive approach, the biology has convinced researchers to determine the defined present study illustrated the scheme of how NO affects mechanisms of these effects and how to control this mediator molecular events in lung cancer cells. for a better understanding as well as for therapeutic gain. Materials and Methods: We used bioinformatics and Lung cancer is one of the leading causes of cancer-related pharmacological experiments to elucidate the potential deaths worldwide (1, 2). Since the aggressive phenotypes regulation and underlying mechanisms of NO in non-small and treatment failures have been frequently observed in lung a lung cancer cell model.
    [Show full text]
  • A Semi-Quantitative Analysis of Lupus Arthritis Using Contrasted High-Field MRI
    bioRxiv preprint doi: https://doi.org/10.1101/218503; this version posted November 13, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. MRI in Lupus Arthritis A semi-quantitative analysis of lupus arthritis using contrasted high-field MRI. Eric S Zollars, MD, PhD. Assistant Professor, Division of Rheumatology, Medical University of South Carolina Russell Chapin, MD. Assistant Professor, Division of Musculoskeletal Radiology, Medical University of South Carolina Corresponding author: Eric Zollars Email: [email protected] Phone: 843-792-1964 Fax: Address: 96 Jonathan Lucas ST, MSC 632, MUSC, Charleston, SC 29466 Financial support Zollars: This project is supported by the South Carolina Clinical & Translational Research (SCTR) Institute, with an academic home at the Medical University of South Carolina, through NIH-NCATS Grant Number UL1TR001450. No commercial support or conflicts of interest 1 bioRxiv preprint doi: https://doi.org/10.1101/218503; this version posted November 13, 2017. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. MRI in Lupus Arthritis Abstract (fewer than 250 words) Objective Arthritis in systemic lupus erythematosus is poorly described and there is no objective measure for quantification of the arthritis. We aim to develop MRI as a research tool for the quantification of lupus arthritis. Methods Patients were eligible for entry into the study if they were evaluated at the MUSC Lupus Center and determined by their treating physician to have active hand arthritis due to SLE.
    [Show full text]
  • The Methamphetamine-Induced RNA Targetome of Hnrnp H in Hnrnph1 Mutants Showing Reduced Dopamine Release and Behavior
    bioRxiv preprint doi: https://doi.org/10.1101/2021.07.06.451358; this version posted July 7, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. The methamphetamine-induced RNA targetome of hnRNP H in Hnrnph1 mutants showing reduced dopamine release and behavior Qiu T. Ruan1,2,3, Michael A. Rieger4, William B. Lynch2,5, Jiayi W. Cox6, Jacob A. Beierle1,2,3, Emily J. Yao2, Amarpreet Kandola2, Melanie M. Chen2, Julia C. Kelliher2, Richard K. Babbs2, Peter E. A. Ash7, Benjamin Wolozin7, Karen K. Szumlinski8, W. Evan Johnson9, Joseph D. Dougherty4, and Camron D. Bryant1,2,3* 1. Biomolecular Pharmacology Training Program, Department of Pharmacology and Experimental Therapeutics, Boston University School of Medicine 2. Laboratory of Addiction Genetics, Department of Pharmacology and Experimental Therapeutics and Psychiatry, Boston University School of Medicine 3. Transformative Training Program in Addiction Science, Boston University School of Medicine 4. Department of Genetics, Department of Psychiatry, Washington University School of Medicine 5. Graduate Program for Neuroscience, Boston University 6. Programs in Biomedical Sciences, Boston University School of Medicine 7. Department of Pharmacology and Experimental Therapeutics and Neurology, Boston University School of Medicine 8. Department of Psychological and Brain Sciences, University of California, Santa Barbara 9. Department of Medicine, Computational Biomedicine, Boston University School of Medicine *Corresponding Author Camron D. Bryant, Ph.D. Department of Pharmacology and Experimental Therapeutics and Department of Psychiatry 72 E.
    [Show full text]
  • Pig Antibodies
    Pig Antibodies gene_name sku Entry_Name Protein_Names Organism Length Identity CDX‐2 ARP31476_P050 D0V4H7_PIG Caudal type homeobox 2 (Fragment) Sus scrofa (Pig) 147 100.00% CDX‐2 ARP31476_P050 A7MAE3_PIG Caudal type homeobox transcription factor 2 (Fragment) Sus scrofa (Pig) 75 100.00% Tnnt3 ARP51286_P050 Q75NH3_PIG Troponin T fast skeletal muscle type Sus scrofa (Pig) 271 85.00% Tnnt3 ARP51286_P050 Q75NH2_PIG Troponin T fast skeletal muscle type Sus scrofa (Pig) 266 85.00% Tnnt3 ARP51286_P050 Q75NH1_PIG Troponin T fast skeletal muscle type Sus scrofa (Pig) 260 85.00% Tnnt3 ARP51286_P050 Q75NH0_PIG Troponin T fast skeletal muscle type Sus scrofa (Pig) 250 85.00% Tnnt3 ARP51286_P050 Q75NG8_PIG Troponin T fast skeletal muscle type Sus scrofa (Pig) 266 85.00% Tnnt3 ARP51286_P050 Q75NG7_PIG Troponin T fast skeletal muscle type Sus scrofa (Pig) 260 85.00% Tnnt3 ARP51286_P050 Q75NG6_PIG Troponin T fast skeletal muscle type Sus scrofa (Pig) 250 85.00% Tnnt3 ARP51286_P050 TNNT3_PIG Troponin T, fast skeletal muscle (TnTf) Sus scrofa (Pig) 271 85.00% ORF Names:PANDA_000462 EMBL EFB13877.1OrganismAiluropod High mobility group protein B2 (High mobility group protein a melanoleuca (Giant panda) ARP31939_P050 HMGB2_PIG 2) (HMG‐2) Sus scrofa (Pig) 210 100.00% Agpat5 ARP47429_P050 B8XTR3_PIG 1‐acylglycerol‐3‐phosphate O‐acyltransferase 5 Sus scrofa (Pig) 365 85.00% irf9 ARP31200_P050 Q29390_PIG Transcriptional regulator ISGF3 gamma subunit (Fragment) Sus scrofa (Pig) 57 100.00% irf9 ARP31200_P050 Q0GFA1_PIG Interferon regulatory factor 9 Sus scrofa (Pig)
    [Show full text]