Produktinformation

Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien

Weitere Information auf den folgenden Seiten! See the following pages for more information!

Lieferung & Zahlungsart

Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic ANKRD17 monoclonal antibody (M01A), clone 1D8

Catalog # : H00026057-M01A 規格 : [ 200 uL ] List All

Specification Application Image

Product Mouse monoclonal antibody raised against a partial recombinant ELISA Description: ANKRD17.

Immunogen: ANKRD17 (NP_115593, 2501 a.a. ~ 2603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence: ERDSTGIVTPSGTFHQHVPAGYMDFPKVGGMPFSVYGNAMIPPVAPIPD GAGGPIFNGPHAADPSWNSLIKMVSSSTENNGPQTVWTGPWAPHMNSV HMNQLG

Host: Mouse

Reactivity: Human

Isotype: IgG1 Kappa

Quality Control Antibody Reactive Against Recombinant Protein. Testing:

Storage Buffer: In ascites fluid

Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction:

MSDS: Download

Datasheet: Download

Applications ELISA

Gene Information

Entrez GeneID: 26057

GeneBank NM_032217 Accession#:

Protein NP_115593 Accession#:

Gene Name: ANKRD17

Gene Alias: FLJ22206,GTAR,KIAA0697,NY-BR-16

Gene ankyrin repeat domain 17 Description:

Gene Ontology: Hyperlink

Page 1 of 2 2020/6/25 Gene Summary: This gene encodes a protein with ankyrin repeats, which are associated with protein-protein interactions. Studies in mice suggest that this protein is involved in liver development. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Other ankyrin repeat domain protein 17,gene trap ankyrin repeat,serologically Designations: defined breast cancer antigen NY-BR-16

Related Disease Osteoporosis Tobacco Use Disorder

Page 2 of 2 2020/6/25