RNASEH2B Polyclonal Antibody Gene Symbol: RNASEH2B

Produktinformation

Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien

Weitere Information auf den folgenden Seiten! See the following pages for more information!

Lieferung & Zahlungsart

Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic RNASEH2B polyclonal antibody Gene Symbol: RNASEH2B

Gene Alias: AGS2, DLEU8, FLJ11712 Catalog Number: PAB23474

Gene Summary: RNase H2 is composed of a single Regulatory Status: For research use only (RUO) catalytic subunit (A) and two non-catalytic subunits (B Product Description: Rabbit polyclonal antibody raised and C) and specifically degrades the RNA of RNA:DNA against recombinant RNASEH2B. hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to Immunogen: Recombinant protein corresponding to play a role in DNA replication. Multiple transcript variants amino acids of human RNASEH2B. encoding different isoforms have been found for this gene. Defects in this gene are a cause of Sequence: Aicardi-Goutieres syndrome type 2 (AGS2). [provided by VVDNVFPNCILLLKLPGLEKLLHHVTEEKGNPEIDNKKY RefSeq] YKYSKEKTLKWLEKKVNQTVAALKTNNVNVSSRVQST AFFSGDQASTDKEEDYIRYAH

Host: Rabbit

Reactivity: Human

Applications: IF, IHC-P (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Form: Liquid

Purification: Antigen affinity purification

Isotype: IgG

Recommend Usage: Immunohistochemistry (1:50-1:200) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.

Storage Buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)

Storage Instruction: Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing.

Entrez GeneID: 79621

Page 1/1