DOCSLIB.ORG

Contributing to the Uniprot Knowledgebase - How You Can Help

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Contributing to the Uniprot Knowledgebase - How You Can Help Contributing to the UniProt Knowledgebase - how you can help Cecilia Arighi, PhD PIR team lead UniProt [email protected] 1 Outline v UniProt Overview v UniProt curated and additional publications v Community contribution: Why? What is the benefit? v Your personal researcher identifier v Publication submission and review processes v What happens after submission v Examples and demo 2 The Universal Protein Resource www.uniprot.org Comprehensive, high-quality and freely accessible resource of protein sequence and functional information 3 Resources we provide >500K unique visitors per month BLAST SEQUENCE ID MAPPING PEPTIDE Tools: ALIGNMENT SEARCH PROGRAMATIC DOWNLOADS ACCESS https://www.uniprot.org 4 The knowledgebase UniProtKB • high quality expert curation • non-redundant (1 entry/gene/species) • cross-references in every Reviewed entry (Swiss-Prot) • automatic annotation • sequence redundancy allowed • computationally generated Unreviewed • cross-references in every (TrEMBL) entry Release 2020_02 5 Types of data in a UniProtKB entry Functional Names comprehensive annotation standardized Sequences Identifiers isoforms unique, staBle variants, etc Links to Amino acid- specialized speciFic data databases 6 Literature Annotations Expert UniProtKB organized in topics in curation curation Entry Entry view CLDN1 - Claudin-1 - Homo sapiens (Human) - CLDN1 gene & protein http://www.uniprot.org/uniprot/O95832 UniProtKB - O95832 (CLD1_HUMAN) Protein Claudin-1 Gene CLDN1 Organism Homo sapiens (Human) Status s Reviewed - Annotation score: - Experimental evidence at protein level Function Claudins function as major constituents of the tight junction complexes that regulate the permeability of epithelia. While some claudin family members play essential roles in the formation of impermeable barriers, others mediate the permeability to ions and small molecules. Often, several claudin family members are coexpressed and interact with each other, and this determines the overall permeability. CLDN1 is required to prevent the paracellular diffusion of small molecules through tight junctions in the epidermis and is required for the normal barrier function of the skin. Required for normal water homeostasis and to prevent excessive water loss through the skin, probably via an indirect effect on the expression levels of other proteins, since CLDN1 itself seems to be dispensable for water barrier formation in keratinocyte tight junctions (PubMed:23407391). Evidence: 1 Publication (Microbial infection) Acts as a receptor for hepatitis C virus in hepatocytes (PubMed:17325668). Acts as a receptor for dengue virus (PubMed:24074594). Evidence: 2 Publications GO - Molecular function identical protein binding Evidence: Source: UniProtKB structural molecule activity Evidence: Source: InterPro virus receptor activity Evidence: Source: UniProtKB-KW GO - Biological process aging Evidence: Source: Ensembl bicellular tight junction assembly Evidence: Source: UniProtKB calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules Evidence: Source: UniProtKB cell-cell junction organization Evidence: Source: MGI cellular response to butyrate Evidence: Source: Ensembl Updates cellular response to interferon-gamma Evidence: Source: Ensembl cellular response to lead ion Evidence: Source: Ensembl cellular response to transforming growth factor beta stimulus Evidence: Source: Ensembl cellular response to tumor necrosis factor Evidence: Source: Ensembl drug transport across blood-nerve barrier Evidence: Source: Ensembl Or establishment of blood-nerve barrier Evidence: Source: Ensembl 1 of 11 3/22/17, 9:08 AM New Entries Poux, Arighi, Magrane et al. 2017, Bioinformatics 33(21):3454, doi: 10.1093/bioinformatics/btx439 7 However…. v UniProt has a finite curation task force v Expert curation activity is prioritized, focusing on certain taxonomic groups or protein sets v The set of articles supporting annotations is a selection representing the landscape of knowledge aBout the protein at a given time (PMID:29036270) v Emerging critical topics, like COVID-19, with rapid accumulation of knowledge demanding up-to-date coverage 8 To expand access to published knowledge about a protein entry v Complement UniProt literature set with additional publications v Computationally mapped puBlications from external resources v Leverage community expertise for adding puBlications and information (annotations) v Classify publications into the entry annotation topics to improve navigation and discovery 9 Publication display in UniProt entry Sperm-associated antigen 5 UniProt Additional Filter by annotation topic https://www.uniprot.org/uniprot/Q96R06/publications 10 Publication display in UniProt entry Sperm-associated antigen 5 https://www.uniprot.org/uniprot/Q96R06/publications 11 ComputationallyNIA workshopmapped bibliography Sources • Sources of literature: MGI PhosphoSitePlus SGD iPTMnet • Curated & Text mining sources dictyBase PRO WormBase PDB Additional BiBliography for UniProt release 2020_02 PomBase pGenN covers (unique): TAIR PubTator 39,366,390 AC/PMID pairs FlyBase BioMuta 347,890 ACs ZFIN MEROPS 985,675 PMIDs RGD IntAct IC4R GeneRif BioCyc GAD Reactome Alzforum • Article categorization into different UniProt topics UPCLASS classification for UniProt release 2020_02 covers 37,893,926 AC/PMID pairs 345,617 ACs 954,619 PMIDs 12 Community: You as a contributor of literature and knowledge Why? v You have the expertise v You can help scale up curation v You asked BeneFits to you v Recognition for the papers and annotations contriButed v ContriBution citaBle and can Be used as a delivery of your research v Play an active role in improving the database v An improved database better supports the research community 13 Icon made by Flat Icons from www.flaticon.com Did you know about the different publication sources in UniProt (curated, from external resources, and community) prior to this webinar? 14 ORCID https://orcid.org/ v Unique digital identifier for researchers v You control puBlic data in your profile v Used as login mechanism to verify your identity v Used for giving you recognition for your contriBution 15 Icon made by Flat Icons from www.flaticon.com Do you have an ORCID ID? 16 System Overview 17 Snapshot of 1-Auto filled with data from the Submission Form entry 2-Checking puBlication exists and it has not been curated in UniProt 3-What aspects does the puBlication describe about the protein? 6-Does the publication show 4-Does publication provide name for any aspect that associates this gene/protein for the entry? protein with some disease? 5-Does the publication show some 7-Any other annotation? function about this protein? 9-Agree to show ORCID on 8-Your contact information weBsite for recognition (not to be shared) 18 Review Process v Ensure content is appropriate. Only facts related to the protein as described in the puBlication, not personal opinions v Minor edits to correct typos, grammar and for standardization purposes v Other content changes are done only with the suBmitter’s permission Track status of submissions: https://community.uniprot.org/BBsub/BBsubinfo.html 19 Status tag What does it mean? Who can view these? The suBmission can Be viewed in the Public entry puBlication section on the UniProt Everyone weBsite The suBmission has Been reviewed and Reviewed will show on UniProt entry page on Everyone weBsite in upcoming release The suBmission has not yet Been SuBmitter when Under Review reviewed By UniProt and it is not ready signed in with ORCID for release The suBmission has Been found SuBmitter when Dropped inappropriate (e.g., incorrect association signed in with ORCID of paper to entry) 20 https://community.uniprot.org/BBsub/BBsubinfo.html 21 ORCID as Source Attribution for your Work https://www.uniprot.org/uniprot/Q96R06/publications 22 Community Submission Statistics https://community.uniprot.org/BBsub/STATS.html 23 Linking a Publication to an Entry v You don’t need to Be author of the puBlication to contriBute v Important to match the protein that is descriBed in the publication with the correct species v If you are the author you know what species you worked on v If you are not the author, you can consider the following tips: v Check species info in materials and methods section of paper to do a search in UniProt with name and species v Does puBlication provide any type of identifiers for the proteins/genes (e.g., GenBank, PDB, etc)? v Is there any sequence that can Be compared to UniProt one? 24 “SeQuence analysis indicates that the cDNA is 3,843-nt long and encodes a protein of 1,193 aa with a predicted molecular mass of 134,400 Da (Fig. ​(Fig.2;2; accession no. AF399910).“ https://www.ncbi.nlm.nih.gov/pmc/articles/PMC64699/ v Use UniProt Retrieve/ID mapping to map external identifiers to UniProt https://www.uniprot.org/uploadlists/ 25 Publication has some seQuence that can be used to find entry TRPV1-long and short in vampire bat differ in C-terminal sequence TRPV1-S GIKRTLSFSLRSSRAV TRPV1-L GIKRTLSFSLRSSRVAGRNWKNFALVPLLRDASTRERQP Gracheva et al., Nature. 2011 Aug 3;476(7358):88-9. PMID: 21814281 GIKRTLSFSLRSSRAV v Use peptide search with GIKRTLSFSLRSSRVAGRNWKNFALVPLLRDASTRERQP subsequence to find correct entry https://www.uniprot.org/peptidesearch/ Desmodus rotundus (Vampire bat) TRPV1-L TRPV1-S 26 DEMO ON COMMUNITY SUBMISSION Go to https://community.uniprot.org/BBsub/doc/puBlic/Com munitysubmissionUniProtdemo_voice.mp4 27 https://covid-19.uniprot.org/uniprotkb?query=* 28 Future work in community submissions v SuBmission in Batch.
Load more

Recommended publications
  • The ELIXIR Core Data Resources: ​Fundamental Infrastructure for The
    Supplementary Data: The ELIXIR Core Data Resources: fundamental infrastructure ​ for the life sciences The “Supporting Material” referred to within this Supplementary Data can be found in the Supporting.Material.CDR.infrastructure file, DOI: 10.5281/zenodo.2625247 (https://zenodo.org/record/2625247). ​ ​ Figure 1. Scale of the Core Data Resources Table S1. Data from which Figure 1 is derived: Year 2013 2014 2015 2016 2017 Data entries 765881651 997794559 1726529931 1853429002 2715599247 Monthly user/IP addresses 1700660 2109586 2413724 2502617 2867265 FTEs 270 292.65 295.65 289.7 311.2 Figure 1 includes data from the following Core Data Resources: ArrayExpress, BRENDA, CATH, ChEBI, ChEMBL, EGA, ENA, Ensembl, Ensembl Genomes, EuropePMC, HPA, IntAct /MINT , InterPro, PDBe, PRIDE, SILVA, STRING, UniProt ● Note that Ensembl’s compute infrastructure physically relocated in 2016, so “Users/IP address” data are not available for that year. In this case, the 2015 numbers were rolled forward to 2016. ● Note that STRING makes only minor releases in 2014 and 2016, in that the interactions are re-computed, but the number of “Data entries” remains unchanged. The major releases that change the number of “Data entries” happened in 2013 and 2015. So, for “Data entries” , the number for 2013 was rolled forward to 2014, and the number for 2015 was rolled forward to 2016. The ELIXIR Core Data Resources: fundamental infrastructure for the life sciences ​ 1 Figure 2: Usage of Core Data Resources in research The following steps were taken: 1. API calls were run on open access full text articles in Europe PMC to identify articles that ​ ​ mention Core Data Resource by name or include specific data record accession numbers.
    [Show full text]
  • What Remains to Be Discovered in the Eukaryotic Proteome?
    bioRxiv preprint doi: https://doi.org/10.1101/469569; this version posted November 16, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Hidden in plain sight: What remains to be discovered in the eukaryotic proteome? Valerie Wood∗1,2, Antonia Lock3, Midori A. Harris1,2, Kim Rutherford1,2, J¨urgB¨ahler3, and Stephen G. Oliver1,2 1Cambridge Systems Biology Centre, University of Cambridge, Cambridge, UK 2Department of Biochemistry, University of Cambridge, Cambridge, UK 3Department of Genetics, Evolution and Environment, University College London, London, UK November 12, 2018 Abstract The first decade of genome sequencing stimulated an explosion in the charac- terization of unknown proteins. More recently, the pace of functional discovery has slowed, leaving around 20% of the proteins even in well-studied model or- ganisms without informative descriptions of their biological roles. Remarkably, many uncharacterized proteins are conserved from yeasts to human, suggesting that they contribute to fundamental biological processes. To fully understand biological systems in health and disease, we need to account for every part of the system. Unstudied proteins thus represent a collective blind spot that limits the progress of both basic and applied biosciences. We use a simple yet powerful metric based on Gene Ontology (GO) bio- logical process terms to define characterized and uncharacterized proteins for human, budding yeast, and fission yeast. We then identify a set of conserved but unstudied proteins in S.
    [Show full text]
  • NCBI Databases
    Jon K. Lærdahl, Structural Bioinforma�cs NCBI databases Read this ar�cle! Nucleic Acids 43 Res. , D6 (2015) Jon K. Lærdahl, EMBL-­‐EBI databases Structural Bioinforma�cs European Nucleo�de Archive (ENA) nucleo�de sequence database Ensembl -­‐ automa�c and manually curated annota�on on selected eukaryo�c (vertebrate) genomes Ensembl Genomes – Ensembl for “all other organisms” UniProt – protein sequence and func�onal informa�on ChEMBL – database of bioac�ve compounds IntAct -­‐ repository of molecular interac�ons, including protein-­‐protein, protein-­‐small molecule and protein-­‐nucleic acid interac�ons CiteXplore – 25 million literature abstracts including PubMed, Agricola & patents Gene Ontology (GO) -­‐ controlled vocabulary to describe gene and gene product a�ributes in any organism Gene Ontology Annota�on (GOA) – GO annota�ons for proteins in UniProt All data is publicly available Jon K. Lærdahl, Structural Bioinforma�cs GenBank a comprehensive public database of nucleo�de sequences and suppor�ng bibliographic and biological annota�on all publicly available DNA sequences submissions from authors – web-­‐based BankIt – standalone program Sequin submissions from EST and other high-­‐throughput sequencing projects daily exchange of data with ENA and DNA Data Bank of Japan (DDBJ) – all sequences submi�ed to DDBJ, ENA, or GenBank will end up in all 3 databases within few days Jon K. Lærdahl, Structural Bioinforma�cs INSDC Jon K. Lærdahl, Structural Bioinforma�cs Sequin – for submi�ng to GenBank BankIt is web-­‐ based alterna�ve Link to “Create a submission” Jon K. Lærdahl, Structural Bioinforma�cs Entry in GenBank format Oct 2015: 202,237,081,559 bases in 188,372,017 sequence records in the tradi�onal GenBank divisions 1,222,635,267,498 bases in 309,198,943 sequence records in the WGS Jon K.
    [Show full text]
  • The Biogrid Interaction Database
    D470–D478 Nucleic Acids Research, 2015, Vol. 43, Database issue Published online 26 November 2014 doi: 10.1093/nar/gku1204 The BioGRID interaction database: 2015 update Andrew Chatr-aryamontri1, Bobby-Joe Breitkreutz2, Rose Oughtred3, Lorrie Boucher2, Sven Heinicke3, Daici Chen1, Chris Stark2, Ashton Breitkreutz2, Nadine Kolas2, Lara O’Donnell2, Teresa Reguly2, Julie Nixon4, Lindsay Ramage4, Andrew Winter4, Adnane Sellam5, Christie Chang3, Jodi Hirschman3, Chandra Theesfeld3, Jennifer Rust3, Michael S. Livstone3, Kara Dolinski3 and Mike Tyers1,2,4,* 1Institute for Research in Immunology and Cancer, Universite´ de Montreal,´ Montreal,´ Quebec H3C 3J7, Canada, 2The Lunenfeld-Tanenbaum Research Institute, Mount Sinai Hospital, Toronto, Ontario M5G 1X5, Canada, 3Lewis-Sigler Institute for Integrative Genomics, Princeton University, Princeton, NJ 08544, USA, 4School of Biological Sciences, University of Edinburgh, Edinburgh EH9 3JR, UK and 5Centre Hospitalier de l’UniversiteLaval´ (CHUL), Quebec,´ Quebec´ G1V 4G2, Canada Received September 26, 2014; Revised November 4, 2014; Accepted November 5, 2014 ABSTRACT semi-automated text-mining approaches, and to en- hance curation quality control. The Biological General Repository for Interaction Datasets (BioGRID: http://thebiogrid.org) is an open access database that houses genetic and protein in- INTRODUCTION teractions curated from the primary biomedical lit- Massive increases in high-throughput DNA sequencing erature for all major model organism species and technologies (1) have enabled an unprecedented level of humans. As of September 2014, the BioGRID con- genome annotation for many hundreds of species (2–6), tains 749 912 interactions as drawn from 43 149 pub- which has led to tremendous progress in the understand- lications that represent 30 model organisms.
    [Show full text]
  • Biocuration 2016 - Posters
    Biocuration 2016 - Posters Source: http://www.sib.swiss/events/biocuration2016/posters 1 RAM: A standards-based database for extracting and analyzing disease-specified concepts from the multitude of biomedical resources Jinmeng Jia and Tieliu Shi Each year, millions of people around world suffer from the consequence of the misdiagnosis and ineffective treatment of various disease, especially those intractable diseases and rare diseases. Integration of various data related to human diseases help us not only for identifying drug targets, connecting genetic variations of phenotypes and understanding molecular pathways relevant to novel treatment, but also for coupling clinical care and biomedical researches. To this end, we built the Rare disease Annotation & Medicine (RAM) standards-based database which can provide reference to map and extract disease-specified information from multitude of biomedical resources such as free text articles in MEDLINE and Electronic Medical Records (EMRs). RAM integrates disease-specified concepts from ICD-9, ICD-10, SNOMED-CT and MeSH (http://www.nlm.nih.gov/mesh/MBrowser.html) extracted from the Unified Medical Language System (UMLS) based on the UMLS Concept Unique Identifiers for each Disease Term. We also integrated phenotypes from OMIM for each disease term, which link underlying mechanisms and clinical observation. Moreover, we used disease-manifestation (D-M) pairs from existing biomedical ontologies as prior knowledge to automatically recognize D-M-specific syntactic patterns from full text articles in MEDLINE. Considering that most of the record-based disease information in public databases are textual format, we extracted disease terms and their related biomedical descriptive phrases from Online Mendelian Inheritance in Man (OMIM), National Organization for Rare Disorders (NORD) and Orphanet using UMLS Thesaurus.
    [Show full text]
  • Annual Scientific Report 2011 Annual Scientific Report 2011 Designed and Produced by Pickeringhutchins Ltd
    European Bioinformatics Institute EMBL-EBI Annual Scientific Report 2011 Annual Scientific Report 2011 Designed and Produced by PickeringHutchins Ltd www.pickeringhutchins.com EMBL member states: Austria, Croatia, Denmark, Finland, France, Germany, Greece, Iceland, Ireland, Israel, Italy, Luxembourg, the Netherlands, Norway, Portugal, Spain, Sweden, Switzerland, United Kingdom. Associate member state: Australia EMBL-EBI is a part of the European Molecular Biology Laboratory (EMBL) EMBL-EBI EMBL-EBI EMBL-EBI EMBL-European Bioinformatics Institute Wellcome Trust Genome Campus, Hinxton Cambridge CB10 1SD United Kingdom Tel. +44 (0)1223 494 444, Fax +44 (0)1223 494 468 www.ebi.ac.uk EMBL Heidelberg Meyerhofstraße 1 69117 Heidelberg Germany Tel. +49 (0)6221 3870, Fax +49 (0)6221 387 8306 www.embl.org [email protected] EMBL Grenoble 6, rue Jules Horowitz, BP181 38042 Grenoble, Cedex 9 France Tel. +33 (0)476 20 7269, Fax +33 (0)476 20 2199 EMBL Hamburg c/o DESY Notkestraße 85 22603 Hamburg Germany Tel. +49 (0)4089 902 110, Fax +49 (0)4089 902 149 EMBL Monterotondo Adriano Buzzati-Traverso Campus Via Ramarini, 32 00015 Monterotondo (Rome) Italy Tel. +39 (0)6900 91402, Fax +39 (0)6900 91406 © 2012 EMBL-European Bioinformatics Institute All texts written by EBI-EMBL Group and Team Leaders. This publication was produced by the EBI’s Outreach and Training Programme. Contents Introduction Foreword 2 Major Achievements 2011 4 Services Rolf Apweiler and Ewan Birney: Protein and nucleotide data 10 Guy Cochrane: The European Nucleotide Archive 14 Paul Flicek:
    [Show full text]
  • Uniprot.Ws: R Interface to Uniprot Web Services
    Package ‘UniProt.ws’ September 26, 2021 Type Package Title R Interface to UniProt Web Services Version 2.33.0 Depends methods, utils, RSQLite, RCurl, BiocGenerics (>= 0.13.8) Imports AnnotationDbi, BiocFileCache, rappdirs Suggests RUnit, BiocStyle, knitr Description A collection of functions for retrieving, processing and repackaging the UniProt web services. Collate AllGenerics.R AllClasses.R getFunctions.R methods-select.R utilities.R License Artistic License 2.0 biocViews Annotation, Infrastructure, GO, KEGG, BioCarta VignetteBuilder knitr LazyLoad yes git_url https://git.bioconductor.org/packages/UniProt.ws git_branch master git_last_commit 5062003 git_last_commit_date 2021-05-19 Date/Publication 2021-09-26 Author Marc Carlson [aut], Csaba Ortutay [ctb], Bioconductor Package Maintainer [aut, cre] Maintainer Bioconductor Package Maintainer <[email protected]> R topics documented: UniProt.ws-objects . .2 UNIPROTKB . .4 utilities . .8 Index 11 1 2 UniProt.ws-objects UniProt.ws-objects UniProt.ws objects and their related methods and functions Description UniProt.ws is the base class for interacting with the Uniprot web services from Bioconductor. In much the same way as an AnnotationDb object allows acces to select for many other annotation packages, UniProt.ws is meant to allow usage of select methods and other supporting methods to enable the easy extraction of data from the Uniprot web services. select, columns and keys are used together to extract data via an UniProt.ws object. columns shows which kinds of data can be returned for the UniProt.ws object. keytypes allows the user to discover which keytypes can be passed in to select or keys via the keytype argument. keys returns keys for the database contained in the UniProt.ws object .
    [Show full text]
  • Unexpected Insertion of Carrier DNA Sequences Into the Fission Yeast Genome During CRISPR–Cas9 Mediated Gene Deletion
    Longmuir et al. BMC Res Notes (2019) 12:191 https://doi.org/10.1186/s13104-019-4228-x BMC Research Notes RESEARCH NOTE Open Access Unexpected insertion of carrier DNA sequences into the fssion yeast genome during CRISPR–Cas9 mediated gene deletion Sophie Longmuir, Nabihah Akhtar and Stuart A. MacNeill* Abstract Objectives: The fssion yeast Schizosaccharomyces pombe is predicted to encode ~ 200 proteins of < 100 amino acids, including a number of previously uncharacterised proteins that are found conserved in related Schizosaccharomyces species only. To begin an investigation of the function of four of these so-called microproteins (designated Smp1– Smp4), CRISPR–Cas9 genome editing technology was used to delete the corresponding genes in haploid fssion yeast cells. Results: None of the four microprotein-encoding genes was essential for viability, meiosis or sporulation, and the deletion cells were no more sensitive to a range of cell stressors than wild-type, leaving the function of the proteins unresolved. During CRISPR–Cas9 editing however, a number of strains were isolated in which additional sequences were inserted into the target loci at the Cas9 cut site. Sequencing of the inserts revealed these to be derived from the chum salmon Oncorhynchus keta, the source of the carrier DNA used in the S. pombe transformation. Keywords: Microprotein, Fission yeast, Schizosaccharomyces pombe, Oncorhynchus keta, CRISPR–Cas9 Introduction Te results presented here arose out of a project to Microproteins (also known as SEPs for smORF-encoded investigate the function of four unstudied S. pombe peptides) are small (generally < 100 amino acid) proteins microproteins, designated Smp1–Smp4 (see Table 1 for that are increasingly being implicated in a wide range of systematic IDs).
    [Show full text]
  • Exploring the Development and Maintenance Practices in the Gene Ontology
    Wu, S., & Stvilia, B. (2014). Exploring the Development and Maintenance Practices in the Gene Ontology. Advances In Classification Research Online, 24(1). doi:10.7152/acro.v24i1.14675 Exploring the Development and Maintenance Practices in the Gene Ontology Shuheng Wu Besiki Stvilia [email protected] [email protected] School of Library & Information Studies, Florida State University, Tallahassee, FL, 32306-2100, United States ABSTRACT research. Among many of the current bio-ontologies, the The Gene Ontology (GO) is one of the most widely used Gene Ontology (GO) is one of the most successful, and has and successful bio-ontologies in biomedicine and molecular been widely used for text mining and information extraction biology. What is special about GO as a knowledge (Blaschke, Hirschman, & Valencia, 2002; Kelso, organization (KO) system is its collaborative development Hoehndorf, & Prüfer, 2010). and maintenance practices, involving diverse communities in collectively developing the Ontology and controlling its Founded in 1998, GO consists of three ontologies quality. Guided by Activity Theory and a theoretical describing the cellular components (CC), molecular Information Quality Assessment Framework, this study functions (MF), and biological processes (BP) of genes and conducts qualitative content analysis of GO’s curation gene products in a species-neutral manner, and intends to discussions. The study found that GO has developed provide each gene and gene product with a cellular context various tools and mechanisms to gain expert feedback and (Gene Ontology, 2013a; Gene Ontology Consortium, engage various communities in developing and maintaining 2011). GO is open access, and the ontology data can be the Ontology in an efficient and less expensive way.
    [Show full text]
  • Pombase: a Comprehensive Online Resource for Fission Yeast Valerie Wood1,2,3,*, Midori A
    Published online 28 October 2011 Nucleic Acids Research, 2012, Vol. 40, Database issue D695–D699 doi:10.1093/nar/gkr853 PomBase: a comprehensive online resource for fission yeast Valerie Wood1,2,3,*, Midori A. Harris1,2,*, Mark D. McDowall4, Kim Rutherford1,2, Brendan W. Vaughan4, Daniel M. Staines4, Martin Aslett5, Antonia Lock6, Ju¨rg Ba¨ hler6, Paul J. Kersey4 and Stephen G. Oliver1,2,* 1Cambridge Systems Biology Centre, 2Department of Biochemistry, University of Cambridge, Sanger Building, 80 Tennis Court Road, Cambridge CB2 1GA, 3Cell Cycle Laboratory, Cancer Research UK, London Research Downloaded from https://academic.oup.com/nar/article-abstract/40/D1/D695/2903446 by guest on 10 March 2019 Institute, 44 Lincoln’s Inn Fields, London UK WC2A 3LY, 4European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridgeshire CB10 1SD, 5Wellcome Trust Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridgeshire CB10 1SA and 6Department of Genetics, Evolution and Environment, and UCL Cancer Institute, University College London, Darwin Building, Gower Street, London WC1E 6BT, UK Received September 7, 2011; Accepted September 24, 2011 ABSTRACT stress responses, chromatin and gene regulation and meiotic differentiation (1). Moreover, since the completion PomBase (www.pombase.org) is a new model of its genome sequence in 2002 (2), fission yeast has organism database established to provide access emerged as a prime model for the characterization of to comprehensive, accurate, and up-to-date mo- processes relevant to human disease and cell biology. A lecular data and biological information for the large and active community engages in biological and bio- fission yeast Schizosaccharomyces pombe to ef- medical research using this model system, routinely fectively support both exploratory and hypothesis- applying molecular genetic, cell biological and biochem- driven research.
    [Show full text]
  • A Resource for RNA Subcellular Localizations
    Nucleic Acids Research Advance Access published August 19, 2016 Nucleic Acids Research, 2016 1 doi: 10.1093/nar/gkw728 RNALocate: a resource for RNA subcellular localizations Ting Zhang1,†, Puwen Tan1,†, Liqiang Wang1,†, Nana Jin1,†, Yana Li1, Lin Zhang1, Huan Yang2, Zhenyu Hu1, Lining Zhang1, Chunyu Hu1, Chunhua Li1, Kun Qian1, Changjian Zhang2, Yan Huang1, Kongning Li1,*, Hao Lin2,* and Dong Wang1,3,* 1College of Bioinformatics Science and Technology, Harbin Medical University, Harbin 150081, China, 2Key Laboratory for NeuroInformation of Ministry of Education, Center of Bioinformatics, School of Life Science and Downloaded from Technology, University of Electronic Science and Technology of China, Chengdu 610054, China and 3Department of Biochemistry and Molecular Biology, Shantou University Medical College, Shantou 515041, China Received July 12, 2016; Accepted August 08, 2016 http://nar.oxfordjournals.org/ ABSTRACT gene expression regulation or mitosis etc (4). Thus, the cel- lular role of the RNA after synthesis could be inferred from Increasing evidence has revealed that RNA subcellu- its subcellular localization information. Based on this, sub- lar localization is a very important feature for deeply cellular localization for RNAs plays an important role in understanding RNA’s biological functions after be- studying biological function of RNAs. Therefore, it is ur- ing transported into intra- or extra-cellular regions. gent to construct a database of RNA subcellular localiza- RNALocate is a web-accessible database that aims tion to integrate, analyze and predict RNA subcellular lo- at Bibliotheque Commune De ChimieUNIL - EPFL on November 12, 2016 to provide a high-quality RNA subcellular localiza- calization for speeding up RNA structural and functional tion resource and facilitate future researches on RNA research.
    [Show full text]
  • Pombase Anatomy of the Main Page
    Anatomy of the PomBase Main page PomBase (www.PomBase.org, funded by the Wellcome Trust) is the model organism database for the fission yeast Schizosaccharomyces pombe. Its primary goal is to support exploratory and hypothesis-driven research and to promote and support the use of fission yeast as a model eukaryotic system. PomBase integrates the S. pombe genome sequence with genetic, molecular and cell biological data, and provides tools to interrogate these data. A longer term goal of PomBase is to provide a detailed and comprehensive networked model of a eukaryotic cell. The front page of PomBase showcases fission yeast research (research spotlight and community curation), and other news of interest to the community. The frontpage provides access to all areas of PomBase as indicated by the numbers in the image below. 1 - the ‘simple search’ box. Search for: ● S. pombe gene names, or genes orthologous to human or S. cerevisiae genes by ortholog name ● Annotations from specific publications by searching for the PubMed ID ● Annotations to specific terms in ontologies (e.g. the Gene Ontology GO, or the fission yeast phenotype ontology FYPO) 2 - The website navigation menu. Comprised of the following sections: ➢ Search Links to the advanced search (query builder), peptide motif search and genome browser ➢ Submit Links to instructions for contributing data to PomBase ➢ Genome status Links to a gene annotation overview (the GO slim overview) and curation statistics, genome relevant information (sequence status, updates, statistics and coordinate changes), and a list of ‘priority unstudied genes’ (genes with orthologs in vertebrates not characterized in any species) ➢ Downloads Datasets (e.g.
    [Show full text]