PARL (Human) Recombinant Protein (P01)

Total Page：16

File Type：pdf, Size：1020Kb

Produktinformation Diagnostik & molekulare Diagnostik Laborgeräte & Service Zellkultur & Verbrauchsmaterial Forschungsprodukte & Biochemikalien Weitere Information auf den folgenden Seiten! See the following pages for more information! Lieferung & Zahlungsart Lieferung: frei Haus Bestellung auf Rechnung SZABO-SCANDIC Lieferung: € 10,- HandelsgmbH & Co KG Erstbestellung Vorauskassa Quellenstraße 110, A-1100 Wien T. +43(0)1 489 3961-0 Zuschläge F. +43(0)1 489 3961-7 [email protected] • Mindermengenzuschlag www.szabo-scandic.com • Trockeneiszuschlag • Gefahrgutzuschlag linkedin.com/company/szaboscandic • Expressversand facebook.com/szaboscandic PARL (Human) Recombinant Protein Gene Alias: PRO2207, PSARL, PSARL1, PSENIP2, (P01) RHBDS1 Gene Summary: This gene encodes a mitochondrial Catalog Number: H00055486-P01 integral membrane protein. Following proteolytic Regulation Status: For research use only (RUO) processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. This gene may Product Description: Human PARL full-length ORF ( be involved in signal transduction via regulated NP_061092.3, 1 a.a. - 379 a.a.) recombinant protein with intramembrane proteolysis of membrane-tethered GST-tag at N-terminal. precursor proteins. Variation in this gene has been associated with increased risk for type 2 diabetes. Sequence: Alternative splicing results in multiple transcript variants MAWRGWAQRGWGCGQAWGASVGGRSCEELTAVLT encoding different isoforms. [provided by RefSeq] PPQLLGRRFNFFIQQKCGFRKAPRKVEPRRSDPGTSG EAYKRSALIPPVEETVFYPSPYPIRSLIKPLFFTVGFTGC AFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQKE GDFRKEINKWWNNLSDGQRTVTGIIAANVLVFCLWRV PSLQRTMIRYFTSNPASKVLCSPMLLSTFSHFSLFHMA ANMYVLWSFSSSIVNILGQEQFMAVYLSAGVISNFVSY VGKVATGRYGPSLGASGAIMTVLAAVCTKIPEGRLAIIF LPMFTFTAGNALKAIIAMDTAGMILGWKFFDHAAHLGG ALFGIWYVTYGHELIWKNREPLVKIWHEIRTNGPKKGG GSK Host: Wheat Germ (in vitro) Theoretical MW (kDa): 68.6 Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 55486 Gene Symbol: PARL Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Mitochondrial Rhomboid PARL Regulates Cytochrome C Release During Apoptosis Via OPA1-Dependent Cristae Remodeling
View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Elsevier - Publisher Connector Mitochondrial Rhomboid PARL Regulates Cytochrome c Release during Apoptosis via OPA1-Dependent Cristae Remodeling Sara Cipolat,1,7 Tomasz Rudka,2,7 Dieter Hartmann,2,7 Veronica Costa,1 Lutgarde Serneels,2 Katleen Craessaerts,2 Kristine Metzger,2 Christian Frezza,1 Wim Annaert,3 Luciano D’Adamio,5 Carmen Derks,2 Tim Dejaegere,2 Luca Pellegrini,6 Rudi D’Hooge,4 Luca Scorrano,1,* and Bart De Strooper2,* 1 Dulbecco-Telethon Institute, Venetian Institute of Molecular Medicine, Padova, Italy 2 Neuronal Cell Biology and Gene Transfer Laboratory 3 Membrane Trafﬁcking Laboratory Center for Human Genetics, Flanders Interuniversity Institute for Biotechnology (VIB4) and K.U.Leuven, Leuven, Belgium 4 Laboratory of Biological Psychology, K.U.Leuven, Leuven, Belgium 5 Albert Einstein College of Medicine, Bronx, NY 10461, USA 6 Centre de Recherche Robert Giffard, Universite` Laval, G1J 2G3 Quebec, Canada 7 These authors contribute equally to this work. *Contact: [email protected] (L.S.); [email protected] (B.D.S.) DOI 10.1016/j.cell.2006.06.021 SUMMARY been identiﬁed in D. melanogaster (Freeman, 2004), where they function as essential activators of the epidermal Rhomboids, evolutionarily conserved integral growth factor (EGF) signaling pathway, proteolytically membrane proteases, participate in crucial sig- cleaving the EGF receptor ligands Spitz, Gurken, and naling pathways. Presenilin-associated rhom- Keren. Since all Rhomboids share a conserved serine boid-like (PARL) is an inner mitochondrial protease catalytic dyad (Lemberg et al., 2005), it has membrane rhomboid of unknown function, been suggested that they are able to cleave proteins in whose yeast ortholog is involved in mito- the transmembrane domain.
[Show full text]
Genetic Correction of HAX1 in Induced Pluripotent Stem Cells from a Patient with Severe Congenital Neutropenia Improves Defective Granulopoiesis
Bone Marrow Failure Syndromes ARTICLES Genetic correction of HAX1 in induced pluripotent stem cells from a patient with severe congenital neutropenia improves defective granulopoiesis Tatsuya Morishima,1 Ken-ichiro Watanabe,1 Akira Niwa,2 Hideyo Hirai,3 Satoshi Saida,1 Takayuki Tanaka,2 Itaru Kato,1 Katsutsugu Umeda,1 Hidefumi Hiramatsu,1 Megumu K. Saito,2 Kousaku Matsubara,4 Souichi Adachi,5 Masao Kobayashi,6 Tatsutoshi Nakahata,2 and Toshio Heike1 1Department of Pediatrics, Graduate School of Medicine, Kyoto University, Kyoto; 2Department of Clinical Application, Center for iPS Cell Research and Application, Kyoto University, Kyoto; 3Department of Transfusion Medicine and Cell Therapy, Kyoto University Hospital, Kyoto; 4Department of Pediatrics, Nishi-Kobe Medical Center, Kobe; 5Human Health Sciences, Graduate School of Medicine, Kyoto University, Kyoto; and 6Department of Pediatrics, Hiroshima University Graduate School of Biomedical Sciences, Hiroshima, Japan ABSTRACT HAX1 was identified as the gene responsible for the autosomal recessive type of severe congenital neutropenia. However, the connection between mutations in the HAX1 gene and defective granulopoiesis in this disease has remained unclear, mainly due to the lack of a useful experimental model for this disease. In this study, we generated induced pluripotent stem cell lines from a patient presenting for severe congenital neutropenia with HAX1 gene deficiency, and analyzed their in vitro neutrophil differentiation potential by using a novel serum- and feeder-free directed differentiation culture system. Cytostaining and flow cytometric analyses of myeloid cells differentiated from patient-derived induced pluripotent stem cells showed arrest at the myeloid progenitor stage and apoptotic predisposition, both of which replicated abnormal granulopoiesis. Moreover, lentiviral transduction of the HAX1 cDNA into patient-derived induced pluripotent stem cells reversed disease-related abnormal granulopoiesis.
[Show full text]
Human CLPB) Is a Potent Mitochondrial Protein Disaggregase That Is Inactivated By
bioRxiv preprint doi: https://doi.org/10.1101/2020.01.17.911016; this version posted January 18, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Skd3 (human CLPB) is a potent mitochondrial protein disaggregase that is inactivated by 3-methylglutaconic aciduria-linked mutations Ryan R. Cupo1,2 and James Shorter1,2* 1Department of Biochemistry and Biophysics, 2Pharmacology Graduate Group, Perelman School of Medicine at the University of Pennsylvania, Philadelphia, PA 19104, U.S.A. *Correspondence: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.01.17.911016; this version posted January 18, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. ABSTRACT Cells have evolved specialized protein disaggregases to reverse toxic protein aggregation and restore protein functionality. In nonmetazoan eukaryotes, the AAA+ disaggregase Hsp78 resolubilizes and reactivates proteins in mitochondria. Curiously, metazoa lack Hsp78. Hence, whether metazoan mitochondria reactivate aggregated proteins is unknown. Here, we establish that a mitochondrial AAA+ protein, Skd3 (human CLPB), couples ATP hydrolysis to protein disaggregation and reactivation. The Skd3 ankyrin-repeat domain combines with conserved AAA+ elements to enable stand-alone disaggregase activity. A mitochondrial inner-membrane protease, PARL, removes an autoinhibitory peptide from Skd3 to greatly enhance disaggregase activity. Indeed, PARL-activated Skd3 dissolves α-synuclein fibrils connected to Parkinson’s disease. Human cells lacking Skd3 exhibit reduced solubility of various mitochondrial proteins, including anti-apoptotic Hax1.
[Show full text]
The Incomplete Puzzle of the BCL2 Proteins
cells Perspective The Incomplete Puzzle of the BCL2 Proteins Hector Flores-Romero and Ana J. García-Sáez * Interfaculty Institute of Biochemistry, Eberhard-Karls-Universität Tübingen, 72076 Tübingen, Germany; [email protected] * Correspondence: [email protected] Received: 3 September 2019; Accepted: 26 September 2019; Published: 29 September 2019 Abstract: The proteins of the BCL2 family are key players in multiple cellular processes, chief amongst them being the regulation of mitochondrial integrity and apoptotic cell death. These proteins establish an intricate interaction network that expands both the cytosol and the surface of organelles to dictate the cell fate. The complexity and unpredictability of the BCL2 interactome resides in the large number of family members and of interaction surfaces, as well as on their different behaviours in solution and in the membrane. Although our current structural knowledge of the BCL2 proteins has been proven therapeutically relevant, the precise structure of membrane-bound complexes and the regulatory effect that membrane lipids exert over these proteins remain key questions in the field. Here, we discuss the complexity of BCL2 interactome, the new insights, and the black matter in the field. Keywords: BCL2 proteins; MOMP; protein membrane interactions; apoptosis; cancer therapy Perspective in BCL2 Universe The proteins of the BCL2 family are the main regulators of the intrinsic apoptotic pathway and constitute a fundamental part of tumorigenic cell dismissal and cancer treatment effectiveness [1,2]. Apoptosis effectors, or BAX-type proteins, are the most effective removers of damaged cells, while their antiapoptotic counterparts, or BCL2-type proteins, inhibit apoptotic cell death and play a role in chemotherapeutic resistance [3,4].
[Show full text]
Insights Into the Catalytic Properties of the Mitochondrial Rhomboid
bioRxiv preprint doi: https://doi.org/10.1101/2020.07.27.224220; this version posted July 29, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 2 Insights into the catalytic properties of the mitochondrial rhomboid protease PARL 3 4 5 Laine Lysyk1, Raelynn Brassard1, Elena Arutyunova1, Verena Siebert2, Zhenze Jiang3, 6 Emmanuella Takyi1, Melissa Morrison1, Howard S. Young1, Marius K. Lemberg2, Anthony J. 7 O’Donoghue3, M. Joanne Lemieux1* 8 9 1 Department of Biochemistry, Faculty of Medicine and Dentistry, Membrane Protein Disease 10 Research Group, University of Alberta, Edmonton T6G 2R3, Alberta, Canada 11 2 Center for Molecular Biology of Heidelberg University (ZMBH), DKFZ-ZMBH Alliance, 12 Im Neuenheimer Feld 282, 69120 Heidelberg, Germany 13 3 Skaggs School of Pharmacy and Pharmaceutical Sciences, University of California San 14 Diego, 9500 Gilman Drive, La Jolla, CA 92093, USA 15 16 *Correspondence: e-mail: [email protected] 17 18 19 Abstract 20 The rhomboid protease PARL is a critical regulator of mitochondrial homeostasis through its 21 cleavage of substrates such as PINK1, PGAM5, and Smac, which have crucial roles in 22 mitochondrial quality control and apoptosis. To gain insight into the catalytic properties of the 23 PARL protease, we expressed human PARL in yeast and used FRET-based kinetic assays to 24 measure proteolytic activity in vitro. We show PARL activity in detergent is enhanced by 25 cardiolipin. Significantly higher turnover rates are observed for PARL reconstituted in 26 proteoliposomes, with Smac being cleaved most rapidly at a rate of 1 min-1.
[Show full text]
PARL Antibody Cat
PARL Antibody Cat. No.: 4761 PARL Antibody Immunocytochemistry of PARL in 3T3 cells with PARL Immunofluorescence of PARL in 3T3 cells with PARL antibody at 2.5 μg/mL. antibody at 2.50 μg/mL. Specifications HOST SPECIES: Rabbit SPECIES REACTIVITY: Human, Mouse, Rat HOMOLOGY: Predicted species reactivity based on immunogen sequence: Bovine: (100%) PARL antibody was raised against a 15 amino acid synthetic peptide from near the amino terminus of human PARL. IMMUNOGEN: The immunogen is located within amino acids 40 - 90 of PARL. TESTED APPLICATIONS: ELISA, ICC, IF, WB September 25, 2021 1 https://www.prosci-inc.com/parl-antibody-4761.html PARL antibody can be used for detection of PARL by Western blot at 1 - 2 μg/mL. Despite its predicted molecular weight of ~42kDa, PARL is observed at a higher molecular weight in SDS-PAGE. Antibody can also be used for immunocytochemistry starting at 2.5 μg/mL. For immunofluorescence start at 20 μg/mL. APPLICATIONS: Antibody validated: Western Blot in mouse samples; Immunocytochemistry in mouse samples and Immunofluorescence in mouse samples. All other applications and species not yet tested. POSITIVE CONTROL: 1) Cat. No. 1282 - 3T3 (NIH) Cell Lysate 2) Cat. No. 17-201 - 3T3/BALB Cell Slide Properties PURIFICATION: PARL Antibody is affinity chromatography purified via peptide column. CLONALITY: Polyclonal ISOTYPE: IgG CONJUGATE: Unconjugated PHYSICAL STATE: Liquid BUFFER: PARL Antibody is supplied in PBS containing 0.02% sodium azide. CONCENTRATION: 1 mg/mL PARL antibody can be stored at 4˚C for three months and -20˚C, stable for up to one STORAGE CONDITIONS: year.
[Show full text]
Characterization of PARL-Mediated Intramembrane Proteolysis
!"#$#%&'$()#&(*+,*-,./0123'4(#&'4,5+&$#6'67$#+',.$*&'*89:(:, , 79, , 1#(+',0(;(,19:9;, , , , , , , , , /,&"':(:,:<76(&&'4,(+,=#$&(#8,-<8-(886'+&,*-,&"',$'><($'6'+&:,-*$,&"',4'?$'',*-, , , 3#:&'$,*-,@%('+%', , , , , , , A'=#$&6'+&,*-,B(*%"'6(:&$9, C+(D'$:(&9,*-,/87'$&#, , , , , , , , , , , , E,1#(+',0(;(,19:9;F,GHIJ, , , , , , , , , , , , , , , , , , , /B@K0/!K, , 5+&$#6'67$#+',=$*&'*89:(:,(:,&"',=$*%'::,79,L"(%",6'67$#+'2'67'44'4,=$*&'#:':,%8'#D', :<7:&$#&':,&"#&,#$',#8:*,'67'44'4,L(&"(+,&"',8(=(4,7(8#9'$,*$,8(',+'#$,&*,&"',7(8#9'$M,0"*67*(4, (+&$#6'67$#+',=$*&'#:':,#$',#,<7(><(&*<:,:<='$-#6(89,*-,:'$(+',(+&$#6'67$#+',=$*&'#:':, &"#&,=8#9,#,$*8',(+,#,L(4',D#$('&9,*-,%'88<8#$,=$*%'::':M,K"',6#66#8(#+,6(&*%"*+4$(#8,$"*67*(4, =$*&'#:'F,.$':'+(8(+2/::*%(#&'4,0"*67*(4,1(;',N./01OF,(:,#,%$(&(%#8,$'?<8#&*$,*-,6(&*%"*+4$(#8, "*6'*:&#:(:, &"$*<?", (&:, %8'#D#?', *-, :<7:&$#&':, :<%", #:, .5PQI, N."*:="#&#:', #+4, &'+:(+, N.KRPO2(+4<%'4,=<&#&(D',;(+#:',IOF,.S/3T,N="*:="*?89%'$#&',6<&#:',-#6(89,6'67'$,TOF,#+4, @6#%,N@'%*+4,6(&*%"*+4$(#824'$(D'4,#%&(D#&*$,*-,%#:=#:':OF,L"(%","#D',$*8':,(+,6(&*%"*+4$(#8, ><#8(&9,%*+&$*8,#+4,#=*=&*:(:M, , K"(:,&"':(:,#(6:,&*,#::'::,./0126'4(#&'4,%8'#D#?',*-,:'D'$#8,4(--'$'+&,:<7:&$#&':,<:(+?,#+, !"#$!%&',U0RK27#:'4,;(+'&(%,#::#9,L(&",$'%*67(+#+&89,'V=$'::'4,#+4,=<$(-('4,"<6#+,./01, NW:./01OM,X',"9=*&"':()',&"#&,&$<+%#&(*+:,*-,./01,(4'+&(-('4,!"#$!$',L(88,"#D',#,$'?<8#&*$9, '--'%&,*+,./0126'4(#&'4,%8'#D#?',#+4,&"#&,&"'$',L(88,7',:(?+(-(%#+&,4(--'$'+%':,(+,&"',%#&#89&(%, =#$#6'&'$:, *7&#(+'4, -*$, %8'#D#?', *-, '#%",
[Show full text]
Skd3 (Human Clpb) Is a Potent Mitochondrial Protein Disaggregase That Is Inactivated by 3-Methylglutaconic Aciduria-Linked Mutations Ryan R Cupo1,2, James Shorter1,2*
RESEARCH ARTICLE Skd3 (human ClpB) is a potent mitochondrial protein disaggregase that is inactivated by 3-methylglutaconic aciduria-linked mutations Ryan R Cupo1,2, James Shorter1,2* 1Department of Biochemistry and Biophysics, Perelman School of Medicine at the University of Pennsylvania, Philadelphia, United States; 2Pharmacology Graduate Group, Perelman School of Medicine at the University of Pennsylvania, Philadelphia, United States Abstract Cells have evolved specialized protein disaggregases to reverse toxic protein aggregation and restore protein functionality. In nonmetazoan eukaryotes, the AAA+ disaggregase Hsp78 resolubilizes and reactivates proteins in mitochondria. Curiously, metazoa lack Hsp78. Hence, whether metazoan mitochondria reactivate aggregated proteins is unknown. Here, we establish that a mitochondrial AAA+ protein, Skd3 (human ClpB), couples ATP hydrolysis to protein disaggregation and reactivation. The Skd3 ankyrin-repeat domain combines with conserved AAA+ elements to enable stand-alone disaggregase activity. A mitochondrial inner-membrane protease, PARL, removes an autoinhibitory peptide from Skd3 to greatly enhance disaggregase activity. Indeed, PARL-activated Skd3 solubilizes a-synuclein fibrils connected to Parkinson’s disease. Human cells lacking Skd3 exhibit reduced solubility of various mitochondrial proteins, including anti-apoptotic Hax1. Importantly, Skd3 variants linked to 3-methylglutaconic aciduria, a severe mitochondrial disorder, display diminished disaggregase activity (but not always reduced ATPase *For correspondence: activity), which predicts disease severity. Thus, Skd3 is a potent protein disaggregase critical for [email protected]. human health. edu Competing interests: The authors declare that no competing interests exist. Introduction Funding: See page 21 Protein aggregation and aberrant phase transitions are elicited by a variety of cellular stressors and Received: 19 January 2020 can be highly toxic (Chuang et al., 2018; Eisele et al., 2015; Guo et al., 2019).
[Show full text]
Loss of Parla Function Results in Inactivity, Olfactory Impairment, and Dopamine Neuron Loss in Zebrafish
biomedicines Article Loss of parla Function Results in Inactivity, Olfactory Impairment, and Dopamine Neuron Loss in Zebrafish Rawan Merhi, Michael Kalyn, Amanda Zhu-Pawlowsky and Marc Ekker * Department of Biology, Faculty of Science, University of Ottawa, Ottawa, ON K1N 6N5, Canada; [email protected] (R.M.); [email protected] (M.K.); [email protected] (A.Z.-P.) * Correspondence: [email protected]; Tel.: +1-613-562-5800 (ext. 2605) Abstract: The presenilin-associated rhomboid-like (PARL) gene was found to contribute to mitochon- drial morphology and function and was linked to familial Parkinson’s disease (PD). The PARL gene product is a mitochondrial intramembrane cleaving protease that acts on a number of mitochondrial proteins involved in mitochondrial morphology, apoptosis, and mitophagy. To date, functional and genetic studies of PARL have been mainly performed in mammals. However, little is known about PARL function and its role in dopaminergic (DA) neuron development in vertebrates. The zebrafish genome comprises two PARL paralogs: parla and parlb. Here, we established a loss-of-function muta- tion in parla via CRISPR/Cas9-mediated mutagenesis. We examined DA neuron numbers in the adult brain and expression of genes associated with DA neuron function in larvae and adults. We show that loss of parla function results in loss of DA neurons, mainly in the olfactory bulb. Changes in the levels of tyrosine hydroxylase transcripts supported this neuronal loss. Expression of fis1, a gene involved in mitochondrial fission, was increased in parla mutants. Finally, we showed that loss of parla function translates into impaired olfaction and altered locomotion parameters.
[Show full text]
Mutations in CLPB Cause Intellectual Disability, Congenital Neutropenia
Mutations in CLPB cause intellectual disability, congenital neutropenia, progressive brain atrophy, movement disorder, cataracts and 3-methylglutaconic aciduria Running title: CLPB defect Saskia B. Wortmann1, Szymon Ziętkiewicz2*, Maria Kousi3*, Radek Szklarczyk4*, Tobias B. Haack5,6, Sören Gersting7, Ania Muntau7, Aleksandar Rakovic8, G. Herma Renkema1, Richard Rodenburg1, Tim M. Storm5, Thomas Meitinger5, M Estela Rubio-Gozalbo9, Elzbieta Chrusciel2, Felix Distelmaier10, Christelle Golzio3, Joop H. Jansen11, Clara van Karnebeek12,13, Yolanda Lillquist12,13, Thomas Lücke14, Katrin Õunap15, Riina Zordania15, Joy Yaplito-Lee16, Hans van Bokhoven17, Johannes N. Spelbrink1,18, Frédéric M. Vaz19, Mia Pras- Raves19, Rafal Ploski20 Ewa Pronicka21, Christine Klein8, Michel A.A.P. Willemsen22, Arjan P.M. de Brouwer17,23, Holger Prokisch5, Nicholas Katsanis3, Ron A. Wevers24 *equal contributions 1 Nijmegen Centre for Mitochondrial Disorders (NCMD), Amalia Children’s Hospital, RadboudUMC Nijmegen, The Netherlands 2 Department of Molecular and Cellular Biology, Intercollegiate Faculty of Biotechnology, University of Gdańsk, Poland 3 Center for Human Disease Modeling, Duke University Medical Center, Durham, NC, USA 4 Clinical Genomics, Maastricht UMC+, Maastricht, The Netherlands 5 Institute of Human Genetics, Helmholtz Zentrum Munich, Neuherberg, Germany 6 Institute of Human Genetics, Technische Universität München, Munich, Germany 7 Department of Molecular Pediatrics, Dr. von Hauner Children's Hospital, Ludwig- Maximilians-University, Munich, Germany. 8 Institute of Neurogenetics, University of Lübeck, Lübeck, Germany 9 Departments of Pediatrics and Genetic Metabolic Diseases, Maastricht University Medical Center, Maastricht, The Netherlands 10 Department of General Pediatrics, Neonatology and Pediatric Cardiology, University Children's Hospital, Heinrich-Heine University, Düsseldorf, Germany 11 Department of Laboratory Medicine, Laboratory of Hematology, RadboudUMC, Nijmegen, The Netherlands 12 Division of Biochemical Diseases, Department of Pediatrics, B.C.
[Show full text]
PARL Deficiency in Mouse Causes Complex III Defects, Coenzyme Q Depletion, and Leigh-Like Syndrome
PARL deficiency in mouse causes Complex III defects, coenzyme Q depletion, and Leigh-like syndrome Marco Spinazzia,b,1, Enrico Radaellic, Katrien Horréa,b, Amaia M. Arranza,b, Natalia V. Gounkoa,b,d, Patrizia Agostinise, Teresa Mendes Maiaf,g,h, Francis Impensf,g,h, Vanessa Alexandra Moraisi, Guillermo Lopez-Lluchj,k, Lutgarde Serneelsa,b, Placido Navasj,k, and Bart De Stroopera,b,l,1 aVIB Center for Brain and Disease Research, 3000 Leuven, Belgium; bDepartment of Neurosciences, Katholieke Universiteit Leuven, 3000 Leuven, Belgium; cComparative Pathology Core, Department of Pathobiology, School of Veterinary Medicine, University of Pennsylvania, Philadelphia, PA 19104-6051; dElectron Microscopy Platform, VIB Bio Imaging Core, 3000 Leuven, Belgium; eCell Death Research & Therapy Laboratory, Department for Cellular and Molecular Medicine, Katholieke Universiteit Leuven, 3000 Leuven, Belgium; fVIB Center for Medical Biotechnology, VIB, 9000 Ghent, Belgium; gVIB Proteomics Core, VIB, 9000 Ghent, Belgium; hDepartment for Biomolecular Medicine, Ghent University, 9000 Ghent, Belgium; iInstituto de Medicina Molecular, Faculdade de Medicina, Universidade de Lisboa, 1649-028 Lisbon, Portugal; jCentro Andaluz de Biología del Desarrollo, Universidad Pablo de Olavide-Consejo Superior de Investigaciones Científicas-Junta de Andalucía, 41013 Seville, Spain; kCentro de Investigaciones Biomédicas en Red de Enfermedades Raras, Instituto de Salud Carlos III, 28029 Madrid, Spain; and lUK Dementia Research Institute, University College London, WC1E 6BT London, United Kingdom Edited by Richard D. Palmiter, University of Washington, Seattle, WA, and approved November 21, 2018 (received for review July 11, 2018) The mitochondrial intramembrane rhomboid protease PARL has been proposed that PARL exerts proapoptotic effects via misprocessing implicated in diverse functions in vitro, but its physiological role in of the mitochondrial Diablo homolog (hereafter DIABLO) (10).
[Show full text]
Mitochondrial Dynamics, ROS, and Cell Signaling: a Blended Overview
life Review Mitochondrial Dynamics, ROS, and Cell Signaling: A Blended Overview Valentina Brillo †, Leonardo Chieregato †, Luigi Leanza *,‡ , Silvia Muccioli ‡ and Roberto Costa ‡ Department of Biology, University of Padova, 35121 Padova, Italy; [email protected] (V.B.); [email protected] (L.C.); [email protected] (S.M.); [email protected] (R.C.) * Correspondence: [email protected]; Tel.: +39-049-827-6343 † These two authors contributed equally. ‡ These authors share senior authorship. Abstract: Mitochondria are key intracellular organelles involved not only in the metabolic state of the cell, but also in several cellular functions, such as proliferation, Calcium signaling, and lipid trafficking. Indeed, these organelles are characterized by continuous events of fission and fusion which contribute to the dynamic plasticity of their network, also strongly influenced by mitochondrial contacts with other subcellular organelles. Nevertheless, mitochondria release a major amount of reactive oxygen species (ROS) inside eukaryotic cells, which are reported to mediate a plethora of both physiological and pathological cellular functions, such as growth and proliferation, regulation of autophagy, apoptosis, and metastasis. Therefore, targeting mitochondrial ROS could be a promising strategy to overcome and hinder the development of diseases such as cancer, where malignant cells, possessing a higher amount of ROS with respect to healthy ones, could be specifically targeted by therapeutic treatments. In this review, we collected the ultimate findings on the blended interplay among mitochondrial shaping, mitochondrial ROS, and several signaling pathways, in order to Citation: Brillo, V.; Chieregato, L.; Leanza, L.; Muccioli, S.; Costa, R. contribute to the dissection of intracellular molecular mechanisms involved in the pathophysiology Mitochondrial Dynamics, ROS, and of eukaryotic cells, possibly improving future therapeutic approaches.
[Show full text]