DOCSLIB.ORG

DEFB119 (NM 153289) Human Tagged ORF Clone – RC209341

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
DEFB119 (NM 153289) Human Tagged ORF Clone – RC209341 OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC209341 DEFB119 (NM_153289) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: DEFB119 (NM_153289) Human Tagged ORF Clone Tag: Myc-DDK Symbol: DEFB119 Synonyms: DEFB-19; DEFB-20; DEFB20; DEFB120; ESC42-RELA; ESC42-RELB Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC209341 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAACTTCTTTACCTGTTTCTTGCCATCCTTCTGGCCATAGAAGAACCAGTGATATCAGGCAAACGCC ACATCCTTCGATGCATGGGTAACAGTGGAATTTGTAGGGCCTCTTGCAAAAAGAACGAACAGCCCTACCT CTATTGCAGAAATTGTCAGTCCTGCTGCCTCCAGTCCTACATGAGGATAAGCATTTCTGGCAAAGAGGAA AATACCGACTGGTCTTATGAGAAGCAGTGGCCAAGACTACCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC209341 protein sequence Red=Cloning site Green=Tags(s) MKLLYLFLAILLAIEEPVISGKRHILRCMGNSGICRASCKKNEQPYLYCRNCQSCCLQSYMRISISGKEE NTDWSYEKQWPRLP myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6548_h10.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 DEFB119 (NM_153289) Human Tagged ORF Clone – RC209341 Cloning Scheme: Plasmid Map: ACCN: NM_153289 ORF Size: 252 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 DEFB119 (NM_153289) Human Tagged ORF Clone – RC209341 OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. RefSeq: NM_153289.4 RefSeq Size: 515 bp RefSeq ORF: 255 bp Locus ID: 245932 UniProt ID: Q8N690 Protein Families: Secreted Protein MW: 9.8 kDa Gene Summary: This gene encodes a member of the beta subfamily of defensins. Beta-defensins are antimicrobial peptides that protect tissues and organs from infection by a variety of microorganisms. This gene is found in a cluster with other beta-defensin genes on the long arm of chromosome 20. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2014] Product images: Western blot validation of overexpression lysate (Cat# [LY407106]) using anti-DDK antibody (Cat# [TA50011-100]). Left: Cell lysates from un- transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC209341 using transfection reagent MegaTran 2.0 (Cat# [TT210002]). This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Load more

Recommended publications
  • Reproductive Biology and Endocrinology Biomed Central
    Reproductive Biology and Endocrinology BioMed Central Research Open Access Identification, cloning and functional characterization of novel beta-defensins in the rat (Rattus norvegicus) Suresh Yenugu1,3, Vishnu Chintalgattu2, Christopher J Wingard2, Yashwanth Radhakrishnan1, Frank S French1 and Susan H Hall*1 Address: 1Laboratories for Reproductive Biology, Department of Pediatrics, University of North Carolina, Chapel Hill, North Carolina 27599, USA, 2Department of Physiology, Brody School of Medicine, East Carolina University, Greenville, North Carolina 27834, USA and 3Department of Biochemistry and Molecular Biology, Pondicherry University, Pondicherry, 605014, India Email: Suresh Yenugu - [email protected]; Vishnu Chintalgattu - [email protected]; Christopher J Wingard - [email protected]; Yashwanth Radhakrishnan - [email protected]; Frank S French - [email protected]; Susan H Hall* - [email protected] * Corresponding author Published: 04 February 2006 Received: 23 November 2005 Accepted: 04 February 2006 Reproductive Biology and Endocrinology2006, 4:7 doi:10.1186/1477-7827-4-7 This article is available from: http://www.rbej.com/content/4/1/7 © 2006Yenugu et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Abstract Background: beta-defensins are small cationic peptides that exhibit broad spectrum antimicrobial properties. The majority of beta-defensins identified in humans are predominantly expressed in the male reproductive tract and have roles in non-immunological processes such as sperm maturation and capacitation. Characterization of novel defensins in the male reproductive tract can lead to increased understanding of their dual roles in immunity and sperm maturation.
    [Show full text]
  • Chromosomal Microarray Analysis in Turkish Patients with Unexplained Developmental Delay and Intellectual Developmental Disorders
    177 Arch Neuropsychitry 2020;57:177−191 RESEARCH ARTICLE https://doi.org/10.29399/npa.24890 Chromosomal Microarray Analysis in Turkish Patients with Unexplained Developmental Delay and Intellectual Developmental Disorders Hakan GÜRKAN1 , Emine İkbal ATLI1 , Engin ATLI1 , Leyla BOZATLI2 , Mengühan ARAZ ALTAY2 , Sinem YALÇINTEPE1 , Yasemin ÖZEN1 , Damla EKER1 , Çisem AKURUT1 , Selma DEMİR1 , Işık GÖRKER2 1Faculty of Medicine, Department of Medical Genetics, Edirne, Trakya University, Edirne, Turkey 2Faculty of Medicine, Department of Child and Adolescent Psychiatry, Trakya University, Edirne, Turkey ABSTRACT Introduction: Aneuploids, copy number variations (CNVs), and single in 39 (39/123=31.7%) patients. Twelve CNV variant of unknown nucleotide variants in specific genes are the main genetic causes of significance (VUS) (9.75%) patients and 7 CNV benign (5.69%) patients developmental delay (DD) and intellectual disability disorder (IDD). were reported. In 6 patients, one or more pathogenic CNVs were These genetic changes can be detected using chromosome analysis, determined. Therefore, the diagnostic efficiency of CMA was found to chromosomal microarray (CMA), and next-generation DNA sequencing be 31.7% (39/123). techniques. Therefore; In this study, we aimed to investigate the Conclusion: Today, genetic analysis is still not part of the routine in the importance of CMA in determining the genomic etiology of unexplained evaluation of IDD patients who present to psychiatry clinics. A genetic DD and IDD in 123 patients. diagnosis from CMA can eliminate genetic question marks and thus Method: For 123 patients, chromosome analysis, DNA fragment analysis alter the clinical management of patients. Approximately one-third and microarray were performed. Conventional G-band karyotype of the positive CMA findings are clinically intervenable.
    [Show full text]
  • Visual Gene Network Analysis of Aging-Specific Gene Co-Expression
    4open 2018, 1,4 © B.P. Parida et al., Published by EDP Sciences 2018 https://doi.org/10.1051/fopen/2018004 Available online at: www.4open-sciences.org RESEARCH ARTICLE Visual gene network analysis of aging-specific gene co-expression in human indicates overlaps with immuno-pathological regulations Bibhu Prasad Parida1,*, Biswapriya Biswavas Misra2, Amarendra Narayan Misra3,4 1 Post-Graduate Department of Biosciences and Biotechnology, School of Biotechnology, Fakir Mohan University, Balasore 756020, Odisha, India 2 Department of Internal Medicine, Section on Molecular Medicine, Wake Forest School of Medicine, Medical Center Boulevard, Winston-Salem 27157, NC, USA 3 Central University of Jharkhand, Brambe, Ratu-Lohardaga Road, Ranchi 835205, Jharkhand, India 4 Khallikote University, Berhampur 760001, Odisha, India Received 19 September 2017, Accepted 4 July 2018 Abstract- - Introduction: Aging is a complex biological process that brings about a gradual decline of physiological and metabolic machineries as a result of maturity. Also, aging is irreversible and leads ultimately to death in biological organisms. Methods: We intend to characterize aging at the gene expression level using publicly available human gene expression arrays obtained from gene expression omnibus (GEO) and ArrayExpress. Candidate genes were identified by rigorous screening using filtered data sets, i.e., GSE11882, GSE47881, and GSE32719. Using Aroma and Limma packages, we selected the top 200 genes showing up and down regulation (p < 0.05 and fold change >2.5) out of which 185 were chosen for further comparative analysis. Results: This investigation enabled identification of candidate genes involved in aging that are associated with several signaling cascades demonstrating strong correlation with ATP binding and protease functions.
    [Show full text]
  • A Study of Alterations in DNA Epigenetic Modifications (5Mc and 5Hmc) and Gene Expression Influenced by Simulated Microgravity I
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Digital Repository @ Iowa State University Genome Informatics Facility Publications Genome Informatics Facility 1-28-2016 A Study of Alterations in DNA Epigenetic Modifications (5mC and 5hmC) and Gene Expression Influenced by Simulated Microgravity in Human Lymphoblastoid Cells Basudev Chowdhury Purdue University Arun S. Seetharam Iowa State University, [email protected] Zhiping Wang Indiana University School of Medicine Yunlong Liu Indiana University School of Medicine Amy C. Lossie Purdue University See next page for additional authors Follow this and additional works at: https://lib.dr.iastate.edu/genomeinformatics_pubs Part of the Bioinformatics Commons, Genetics Commons, and the Genomics Commons Recommended Citation Chowdhury, Basudev; Seetharam, Arun S.; Wang, Zhiping; Liu, Yunlong; Lossie, Amy C.; Thimmapuram, Jyothi; and Irudayaraj, Joseph, "A Study of Alterations in DNA Epigenetic Modifications (5mC and 5hmC) and Gene Expression Influenced by Simulated Microgravity in Human Lymphoblastoid Cells" (2016). Genome Informatics Facility Publications. 4. https://lib.dr.iastate.edu/genomeinformatics_pubs/4 This Article is brought to you for free and open access by the Genome Informatics Facility at Iowa State University Digital Repository. It has been accepted for inclusion in Genome Informatics Facility Publications by an authorized administrator of Iowa State University Digital Repository. For more information, please contact [email protected]. A Study of Alterations in DNA Epigenetic Modifications (5mC and 5hmC) and Gene Expression Influenced by Simulated Microgravity in Human Lymphoblastoid Cells Abstract Cells alter their gene expression in response to exposure to various environmental changes. Epigenetic mechanisms such as DNA methylation are believed to regulate the alterations in gene expression patterns.
    [Show full text]
  • Characterization of the Β-Defensin Genes in Giant Panda Zhi-Yi Zhang1, He-Min Zhang2, De-Sheng Li2, Tie-Yi Xiong3 & Sheng-Guo Fang 1
    www.nature.com/scientificreports OPEN Characterization of the β-defensin genes in giant panda Zhi-Yi Zhang1, He-Min Zhang2, De-Sheng Li2, Tie-Yi Xiong3 & Sheng-Guo Fang 1 β-Defensins are small antimicrobial proteins expressed in various organisms and have great potential Received: 12 July 2017 for improving animal health and selective breeding programs. Giant pandas have a distinctive lineage Accepted: 12 June 2018 in Carnivora, and it is unclear whether β-defensin genes have experienced diferent selective pressures Published: xx xx xxxx during giant panda evolution. We therefore characterized the giant panda (Ailuropoda melanoleuca) β-defensin gene family through gap flling, TBLASTN, and HMM searches. Among 36 β-defensins identifed, gastrointestinal disease may induce the expression of the DEFB1 and DEFB139 genes in the digestive system. Moreover, for DEFB139, a signifcant positive selection diferent from that of its homologs was revealed through branch model comparisons. A Pro-to-Arg mutation in the giant panda DEFB139 mature peptide may have enhanced the peptide’s antimicrobial potency by increasing its stability, isoelectric point, surface charge and surface hydrophobicity, and by stabilizing its second β-sheet. Broth microdilution tests showed that the increase in net charge caused by the Pro-to-Arg mutation has enhanced the peptide’s potency against Staphylococcus aureus, although the increase was minor. We expect that additional gene function and expression studies of the giant panda DEFB139 gene could improve the existing conservation strategies for the giant panda. Defensins are a group of small antimicrobial peptides (AMPs) found in large variety of plants, invertebrates, and vertebrates that act against a broad spectrum of pathogens including enveloped viruses, gram-positive and gram-negative bacteria, mycobacteria, and fungi1.
    [Show full text]
  • Plant & Animal Genome V
    June 6-8, 2019 Futian Shangri-La PAG ASIA 2019 Shenzhen, China THE INTERNATIONAL CONFERENCE ON THE STATUS OF PLANT & ANIMAL GENOME RESEARCH FINAL PROGRAM, ABSTRACT & EXHIBIT GUIDE Co-Chairs STEPHEN HELLER NIH, USA ZHONGLIN TANG Agricultural Genome Research Institute, Chinese Academy of Agricultural Sciences (CAAS), China XUN XU BGI - Shenzhen, China Organizing Committee A RUDI APPELS A GRAHAM MOORE University of Melbourne, Australia John Innes Centre, United Kingdom A DAVID GRANT A MAX ROTHSCHILD USDA/ARS/CICGR, USA Iowa State University, USA A SACHIKO ISOBE A RAJEEV K. VARSHNEY Kazusa DNA Research Institute, Japan International Crops Research Institute for the Semi-Arid Tropics (ICRISAT), India A KWAN-SUK KIM Chungbuk National University, A QIFA ZHANG South Korea Huazhong Agricultural University, China A SUSAN MCCOUCH A SHU-HONG ZHAO Cornell University, USA Huazhong Agricultural University, China MEETING MANAGEMENT Corporate Sponsors Scherago International Berry Genomics LGC, Biosearch 184 S. Livingston Ave, Ste 9, #184 Technologies BGI Livingston, NJ 07039, USA NRgene Dovetail Genomics Phone: +1 201-653-5141 PacBio Genomeweb Email: [email protected] Thermo Fisher Website: www.intlpagasia.org Illumina Scientific Table of Contents Registration and Meeting Schedule 2 Scientific Program 3-20 Corporate Sponsors 21 Exhibitor Descriptions 22-28 Abstracts: Workshops 29-42 Posters 43-62 Author Index 63-66 Floorplan (Exhibits & Posters) 67 Notes 68 Mark Your Calendar for: Plant & Animal Genome XXVIII January 11-15, 2020 Town & Country Hotel
    [Show full text]
  • Focused Examination of the Intestinal Lamina Propria Yields Greater Molecular Insight Into Mechanisms Underlying SIV Induced Immune Dysfunction
    Focused Examination of the Intestinal lamina Propria Yields Greater Molecular Insight into Mechanisms Underlying SIV Induced Immune Dysfunction Mahesh Mohan1, Deepak Kaushal2, Pyone P. Aye1, Xavier Alvarez1, Ronald S. Veazey1, Andrew A. Lackner1* 1 Division of Comparative Pathology, Tulane National Primate Research Center, Covington, Louisiana, United States of America, 2 Division of Bacteriology and Parasitology, Tulane National Primate Research Center, Covington, Louisiana, United States of America Abstract Background: The Gastrointestinal (GI) tract is critical to AIDS pathogenesis as it is the primary site for viral transmission and a major site of viral replication and CD4+ T cell destruction. Consequently GI disease, a major complication of HIV/SIV infection can facilitate translocation of lumenal bacterial products causing localized/systemic immune activation leading to AIDS progression. Methodology/Principal Findings: To better understand the molecular mechanisms underlying GI disease we analyzed global gene expression profiles sequentially in the intestine of the same animals prior to and at 21 and 90d post SIV infection (PI). More importantly we maximized information gathering by examining distinct mucosal components (intraepithelial lymphocytes, lamina propria leukocytes [LPL], epithelium and fibrovascular stroma) separately. The use of sequential intestinal resections combined with focused examination of distinct mucosal compartments represents novel approaches not previously attempted. Here we report data pertaining to the LPL. A significant increase (61.7-fold) in immune defense/inflammation, cell adhesion/migration, cell signaling, transcription and cell division/differentiation genes were observed at 21 and 90d PI. Genes associated with the JAK-STAT pathway (IL21, IL12R, STAT5A, IL10, SOCS1) and T-cell activation (NFATc1, CDK6, Gelsolin, Moesin) were notably upregulated at 21d PI.
    [Show full text]
  • 6-Xin Cai-CG-MS
    Send Orders for Reprints to [email protected] Current Genomics, 2019, 20, 293-305 293 RESEARCH ARTICLE Comparative RNA-Seq Analysis of Differentially Expressed Genes in the Epididymides of Yak and Cattleyak Wangsheng Zhao1, Kifayatullah Mengal1, Meng Yuan1, Eugene Quansah1, Pengcheng Li1, Shixin Wu1, Chuanfei Xu1, Chuanping Yi1 and Xin Cai1,* 1School of Life Science and Engineering, Southwest University of Science and Technology, Mianyang 621010, Sichuan, China Abstract: Background: Cattleyak are the Fl hybrids between (♀) yak (Bos grunniens) and (♂) cattle (Bos taurus). Cattleyak exhibit higher capability in adaptability to a harsh environment and display much higher performances in production than the yak and cattle. The cattleyak, however, are females fertile but males sterile. All previous studies greatly focused on testes tissues to study the mechanism of male infertility in cattleyak. However, so far, no transcriptomic study has been conducted on the ep- ididymides of yak and cattleyak. Objective: Our objective was to perform comparative transcriptome analysis between the epididymi- des of yak and cattleyak and predict the etiology of male infertility in cattleyak. Methods: We performed comparative transcriptome profiles analysis by mRNA sequencing in the ep- A R T I C L E H I S T O R Y ididymides of yak and cattleyak. Received: June 20, 2019 Results: In total 3008 differentially expressed genes (DEGs) were identified in cattleyak, out of which Revised: July 25, 2019 1645 DEGs were up-regulated and 1363 DEGs were down-regulated. Thirteen DEGs were validated by Accepted: July 29, 2019 quantitative real-time PCR. DEGs included certain genes that were associated with spermatozoal matura- DOI: tion, motility, male fertility, water and ion channels, and beta-defensins.
    [Show full text]
  • Mrna Expression in Human Leiomyoma and Eker Rats As Measured by Microarray Analysis
    Table 3S: mRNA Expression in Human Leiomyoma and Eker Rats as Measured by Microarray Analysis Human_avg Rat_avg_ PENG_ Entrez. Human_ log2_ log2_ RAPAMYCIN Gene.Symbol Gene.ID Gene Description avg_tstat Human_FDR foldChange Rat_avg_tstat Rat_FDR foldChange _DN A1BG 1 alpha-1-B glycoprotein 4.982 9.52E-05 0.68 -0.8346 0.4639 -0.38 A1CF 29974 APOBEC1 complementation factor -0.08024 0.9541 -0.02 0.9141 0.421 0.10 A2BP1 54715 ataxin 2-binding protein 1 2.811 0.01093 0.65 0.07114 0.954 -0.01 A2LD1 87769 AIG2-like domain 1 -0.3033 0.8056 -0.09 -3.365 0.005704 -0.42 A2M 2 alpha-2-macroglobulin -0.8113 0.4691 -0.03 6.02 0 1.75 A4GALT 53947 alpha 1,4-galactosyltransferase 0.4383 0.7128 0.11 6.304 0 2.30 AACS 65985 acetoacetyl-CoA synthetase 0.3595 0.7664 0.03 3.534 0.00388 0.38 AADAC 13 arylacetamide deacetylase (esterase) 0.569 0.6216 0.16 0.005588 0.9968 0.00 AADAT 51166 aminoadipate aminotransferase -0.9577 0.3876 -0.11 0.8123 0.4752 0.24 AAK1 22848 AP2 associated kinase 1 -1.261 0.2505 -0.25 0.8232 0.4689 0.12 AAMP 14 angio-associated, migratory cell protein 0.873 0.4351 0.07 1.656 0.1476 0.06 AANAT 15 arylalkylamine N-acetyltransferase -0.3998 0.7394 -0.08 0.8486 0.456 0.18 AARS 16 alanyl-tRNA synthetase 5.517 0 0.34 8.616 0 0.69 AARS2 57505 alanyl-tRNA synthetase 2, mitochondrial (putative) 1.701 0.1158 0.35 0.5011 0.6622 0.07 AARSD1 80755 alanyl-tRNA synthetase domain containing 1 4.403 9.52E-05 0.52 1.279 0.2609 0.13 AASDH 132949 aminoadipate-semialdehyde dehydrogenase -0.8921 0.4247 -0.12 -2.564 0.02993 -0.32 AASDHPPT 60496 aminoadipate-semialdehyde
    [Show full text]
  • Β-Defensin Expression in the Canine Nasal Cavity by Michelle Satomi
    β-defensin expression in the canine nasal cavity by Michelle Satomi Aono A thesis submitted to the Graduate Faculty of Auburn University in partial fulfillment of the requirements for the Degree of Masters of Science Auburn, Alabama May 6th, 2013 Keywords: defensin, innate immunity, canine nasal cavity Copyright 2013 by Michelle S. Aono Approved by Edward E. Morrison, Professor and Head of Anatomy, Physiology and Pharmacology Robert Kemppainen, Associate Professor of Anatomy, Physiology and Pharmacology John C. Dennis, Research Fellow IV of Anatomy, Physiology and Pharmacology Abstract Defensins are a family of endogenous antibiotics that are important in mucosal innate immunity, but little is currently known about defensin expression in the nasal cavity. Herein expression of canine β-defensin (cBD)1, cBD103, cBD108 and cBD123 RNA in the respiratory epithelium (RE), cBD1 and 108 RNA in the olfactory epithelium (OE), and cBD1, cBD108, cBD119 and cBD123 RNA in the olfactory bulb (OB) is reported. cBD1 and 103 were also expressed in the canine nares and tongue. cBD102, cBD120, and cBD122 RNA expression was undetectable in the tissues examined. cBD103 transcript abundance in canine nares showed a 90 fold range of inter-individual variation. Murine β-defensin 14 expression mirrors that of cBD103 in the dog, with high expression in the nares and tongue, but has little to no expression in the RE, OE or OB. High expression of cBD103 in the nares may provide indirect protection to the OE by eliminating pathogens in the rostral portion of the nasal cavity, whereas cBD1 and 108 may provide direct protection to the RE and OE.
    [Show full text]
  • Discovery of Rare Ancestry-Specific Variants in the Fetal Genome That Confer Risk of Preterm Premature Rupture of Membranes (PPROM) and Preterm Birth Bhavi P
    Modi et al. BMC Medical Genetics (2018) 19:181 https://doi.org/10.1186/s12881-018-0696-4 TECHNICAL ADVANCE Open Access Discovery of rare ancestry-specific variants in the fetal genome that confer risk of preterm premature rupture of membranes (PPROM) and preterm birth Bhavi P. Modi1, Hardik I. Parikh2, Maria E. Teves3, Rewa Kulkarni1, Jiang Liyu3, Roberto Romero4,5, Timothy P. York1,3 and Jerome F. Strauss III1,3* Abstract Background: Preterm premature rupture of membranes (PPROM) is the leading identifiable cause of preterm birth, a complication that is more common in African Americans. Attempts to identify genetic loci associated with preterm birth using genome-wide association studies (GWAS) have only been successful with large numbers of cases and controls, and there has yet to be a convincing genetic association to explain racial/ethnic disparities. Indeed, the search for ancestry-specific variants associated with preterm birth has led to the conclusion that spontaneous preterm birth could be the consequence of multiple rare variants. The hypothesis that preterm birth is due to rare genetic variants that would go undetected in standard GWAS has been explored in the present study. The detection and validation of these rare variants present challenges because of the low allele frequency. However, some success in the identification of fetal loci/genes associated with preterm birth using whole genome sequencing and whole exome sequencing (WES) has recently been reported. While encouraging, this is currently an expensive technology, and methods to leverage the sequencing data to quickly identify and cost-effectively validate variants are needed. Methods: We developed a WES data analysis strategy based on neonatal genomic DNA from PPROM cases and term controls that was unencumbered by preselection of candidate genes, and capable of identifying variants in African Americans worthy of focused evaluation to establish statistically significant associations.
    [Show full text]
  • Identification, Characterization, and Evolution of a Primate Β-Defensin
    Genes and Immunity (2005) 6, 203–210 & 2005 Nature Publishing Group All rights reserved 1466-4879/05 $30.00 www.nature.com/gene FULL PAPER Identification, characterization, and evolution of a primate b-defensin gene cluster Y Radhakrishnan1, KG Hamil1, S Yenugu1, SL Young2, FS French1 and SH Hall1 1Department of Pediatrics, Laboratories for Reproductive Biology, University of North Carolina, Chapel Hill, NC, USA; 2Department of Obstetrics and Gynecology, Laboratories for Reproductive Biology, University of North Carolina, Chapel Hill, NC, USA Defensins are members of a large diverse family of cationic antimicrobial peptides that share a signature pattern consisting of six conserved cysteine residues. Defensins have a wide variety of functions and their disruption has been implicated in various human diseases. Here we report the characterization of DEFB119–DEFB123, five genes in the human b-defensin cluster locus on chromosome 20q11.1. The genomic structures of DEFB121 and DEFB122 were determined in silico. Sequences of the five macaque orthologs were obtained and expression patterns of the genes were analyzed in humans and macaque by semiquantitative reverse transcription polymerase chain reaction. Expression was restricted to the male reproductive tract. The genes in this cluster are differentially regulated by androgens. Evolutionary analyses suggest that this cluster originated by a series of duplication events and by positive selection. The evolutionary forces driving the proliferation and diversification of these defensins may be
    [Show full text]