DOCSLIB.ORG

Conus Geographus, 70% Fatality Rate

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Conus Geographus, 70% Fatality Rate VENOMOUS CONE SNAILS (FISH - HUNTING SPECIES) Some kill people: Conus geographus, 70% fatality rate. 3 F2 4 different clades of fish-hunting cone snails harpoon tooth proboscis tip Lightning-strike cabal -Conotoxin - INCREASES Na channel conductance k-Conotoxin - Blocks K channels Others - ? k-PVIIA CRIONQKCFQHLDDCCSRKCNRFNKCV -PVIA EACYAOGTFCGIKOGLCCSEFCLPGVCFG Prey Capture Excitotoxic Neuromuscular 1 Shock 2 Block Very rapid, fish stunned Irreversible paralysis Lightning-strike cabal Lightning strike constellation -Conotoxin - INCREASES Na channel conductance k-Conotoxin - Blocks K channels -Conotoxin - Activates Na Channels Con-ikot-ikot - Inhibits Glu receptor desensitization Motor cabal Motor constellation w-Conotoxin - Blocks Ca channels a-Conotoxin - Competitive nicotinic receptor inhibitor y-Conotoxin - Nicotinic receptor channel blocker? m-Conotoxin - BLOCKS Na channel conductance Conus geographus • The Deadliest Snail in the Ocean Net Strategy Sensory Deadening Neuromuscular Block (Nirvana Cabal) (Motor Cabal) Nirvana Cabal Sedated, quiescent state Motor Cabal Neuromuscular transmission block Nirvana cabal Targeted to sensory circuitry: s-Conotoxin - 5HT3 receptor blocker * Conantokin - NMDA receptor blocker * “Sluggish” peptide “Sleeper” peptides “Weaponized” insulin Mature venom insulin is post-translationally modified Con-Ins G1 Highly expressed in venom gland Highly abundant in C. geographus venom Helena Hemami-Safavi Activity testing Adam Douglass SafaviSantosh-Hemami Karanth et al. 2015, Amnon PNAS Schlegel Venom insulin: proposed mechanism of action Adminstration of insulin causes glucose uptake from the blood into liver and muscle tissue Insulin overdose: rapid depletion of blood glucose leads to insufficient glucose supply for the brain: dizziness, nausea, coma and death Insulin shock, hypoglycemic shock Insulin as a murder weapon, the Sunny von Bülow case: American heiress and socialite. Her husband, Claus von Bülow, was convicted of attempting her murder by insulin overdose C. geographus insulin: the Sunny von Bülow peptide Smallest insulin described from a natural source Why so small? A chain B chain Structural Features of Human/Fish Insulin Insulin Hexamer Insulin Dimer A chain GIVEQCCTSICSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKT hexamerization dimerization http://watcut.uwaterloo.ca/webnotes/Metabolism/diabetesHbA1c.html Oligomerization leads to slow (IV) absorption rates Insulin receptor Diabetes is treated by using a combination of basal (hexameric) and fast-acting (monomeric) insulins FISH-HUNTING CONE SNAILS HAVE EVOLVED A MONOMERIC INSULIN Michael Lawrance, WEHI A chain B chain ActiveMonomeractive Loss of activity Insulin Signaling Activation 1.5 human insulin l e ConG1_Cys v e l DOI 1.0 Insulin Signat ling Activation k ConG1_desPTM 1.5 A p human insulin e v l i t e 0.5 ConG1_Cys a v l e e l DOI 1.0 r t k ConG1_desPTM A p e -2 0 2 4 v i t 0.5 a l log [insulin] (nM) e r -2 0 2 4 log [insulin] (nM) Chemical total synthesis of DOI mutants 1. 25% mercaptoethanol/DMF, r.t., 2 h. 2. DTNP, DCM, r.t., 1 h SBu-t Mmt t-BuO2C O 3. 1% TFA, 5% TIS, DCM S S 2 mins, 6 times. GIVEQCCTSICSLYQLENYC N N OH H H GIVEQCCTSICSLYQLENYCN Trt 4. DCM, r.t., 5 h. Acm Acm 5. 5% TIS, 2.5% H2O, 2 1 92.5% TFA, r.t., 2.5 h. 2.5% TIS, 2.5% H2O, S 95% TFA, DTDP, r.t., N 2-chlorotrityl Resin 2.5 h. FVNQHLCGSHLVEAYYLVCGER FVNQHLCGSHLVEAYYLVCGER OH Acm Acm S S GIVEQCCTSICSLYQLENYCN OH S 1. 6 M urea, 0.2 M NH4HCO3, pH 8 S 2 + 4 S S 2. I2, AcOH/H2O FVNQHLCGSHLVEAYYLVCGER OH 5 B15 Tyr DOI analog Xiaochun Xiong, Danny Chou Current Progress • By utilizing the structural insights from Con-Ins-G1, our current lead DOI analogue has a comparable bioactivity as con-Ins-G1. • By introducing additional mutations learned from Con- Ins-G1, our goal is to identify monomericMaria human Disotuar DOI, Danny Chou analog with full native insulin potency. Summary • Human insulin is hexameric, which leads to delayed action after subcutaneous injections. • Monomeric human insulin (DOI) has 1,000 fold weaker bioactivity due to the lack of B24 Phe. • Venom insulin, Con-Ins-G1, has reasonable bioactivity toward human insulin receptor although it lacks B24 Phe. • Crystal structure of Con-Ins-G1 suggests the importance of B15 & B20 Tyr in compensating the role of B24 Phe. • Through chemical protein synthesis, the importance of B15 & B20 Tyr is confirmed. • Further protein engineering efforts are currently underway to develop a monomeric human insulin with full bioactivity. Nirvana Cabal peptides that reached clinical trials Sluggish * Contulakin-G <ESEEGGSNATKKPYIL Neurotensin <ELYENKPRRPYIL (Intractable Pain) Molecular target: Neurotensin Receptor Nirvana Cabal peptides that reached clinical trials Sleeper (Subtype-specific NMDA receptor antagonist) Conantokin Gly Glu Gla Gla Leu Gln Gla Asn Gln Gla Glu Ile Arg Gla Lys Ser Asn NH2 COO OOC COO CO2 CH2 CH CH CH 2 Vitamin K 2 carboxylase C C Glu Gla (Epilepsy - Subtype-specific NMDA receptor antagonist) Molecular target: NMDA Receptor (NR2B subunit) ω-MVIIA CKGKGAKCSRLMYDCCTGSCRSGKC# ω-GVIA CKSOGSSCSOTSYNCCRSCNOYTKRCY# Conus geographus venom components, Biomedical Applications Con Ins GI Preclinical Diabetes (C. geographus insulin) Contulakin G Phase I Intractable Cancer Pain Conantokin G Phase I Epilepsy ω-Conotoxin GVIA Diagnostic Lambert-Eaton Syndrome ω-Conotoxin MVIIA FDA Approved Neuropathic Pain Drug MORE PEPTIDE THERAPEUTICS SHOULD BE DISCOVERED FROM STUDYING CHEMICAL INTERACTIONS BETWEEN MARINE ANIMALS Biomedical applications from studying one single chemical interaction: (between Conus geographus and its fish prey) 1 FDA Approved drug: (Neuropathic pain; target: Cav 2.2 Ca Channel) 2 Compounds in human clinical trials: Contulakin G (Cancer pain; Target: Neurotensin Receptor) Conantokin G (Epilepsy; Target: NMDA Receptor) 1 Diagnostic agent: Radiolabeled ω-GVIA (Lambert-Eaton Syndrome) 1 Preclinical stage drug development: Con Ins-GI (Diabetes) ~800 Species of Cone Snails (family Conidae) Arguably the largest genus of marine invertebrates The venom of each different Conus species has a different set of peptides. With ~800 Conus species that each have ~100 peptides, there are over 100,000 pharmacologically active peptides Toxins in Conus venoms are used for more than prey capture: Defense against predators Deterrence of competitors Why so many different peptides in one venom? Venom peptides are used for more than prey capture: Defense against predators Deterrence of competitors EACH SPECIES HAS MULTIPLE BIOTIC INTERACTIONS Why does each species have different venom components? EACH SPECIES HAS ITS OWN PARTICULAR ECOLOGICAL NICHE Each Conus species has: Different prey spectrum, different predators, different competitors Conus sulcatus The Slowest Fish-Hunting Cone Biodiversity Chemical Biology Neuroscience Colubraria “The vampires of the Tropical Seas” Acknowledgments Early Characterization Venom Insulins Of Conotoxins HELENA HEMAMI-SAFAVI Luly Cruz (Philippines) Joanna Gajzwiak Bill Gray (Utah) Sam Robinson Doju Yoshikami (Utah) Aiping Lyu (Shanghai) Anthony Craig, Jean Rivier (La Jolla) Mark Yandell (Utah Medical School) Grey Bulaj (Utah) Danny Chou (Utah Medical School) Beatrix Uberheide (New York) Turris Venoms Jean Rivier, Judit Erchegyi (La Jolla) Gisela Concepcion (Philippines) Michael Lawrence, Ray Norton, Julia Imperial Briony Forbes (Australia) Estuardo Lopez-Vera (Mexico) Manuel Aguilar (Mexico) Constellation Pharmacology Utah Former Bea Ramiro (Philippines) Russ Teichert Undergraduates April Cabang Cheenu Raghurahman Craig Clark Maren Watkins Tosifa Memon Michael McIntosh Sam Espino David Griffin Financial Support Kevin Chase David Johnson National Institute of General Medical Na Channels, K Channels Aryan Azimi-Zonooz Science (GM48677) Heinz Terlau (Germany ) Chris Hopkins HHMI Professorship Grant Min-Min Zhang ICBG Grant (NIH Fogarty Center) Doju Yoshikami Neogastropoda Buccinoidea Muricoidea Olivoidea Conoidea Cancellarioidea Tonnoidea Conoidea (~15,000 species) CONIDAE (~800 SPECIES) CLAVATULIDAE DRILLIDAE* PSEUDOMELATOMIDAE* STRICTOSPIRIDAE RAPHITOMIDAE* CLATHURELLIDAE* MANGELIDAE* CONORBIDAE RURRIDAE TEREBRIDAE Cones Turrids Augers Cone Snails ~ 500 - 700 species (Conus, etc.) Auger Snails ~ 400 - 600 species (Terebra, etc.) Turrid Snails ~ 12,000 species (Turris, etc.) * Cone Snails * Auger Snails * * TURRIDS * * Small Molecules in Conus Venoms Conus genuanus Neves et al Org Lett 2015 How is Genuanine Made? • A novel nucleic acid – Derived from guanine • Methyl group modification known in some bacteria • Radical SAM enzyme • Hypothesis: Made by animal? • Only found in colored venom ducts – Radicals Endogenous insulins Highly conserved Purifying selection Venom insulins Hyperdiverse Positive selection Juxtaposition between a highly conserved (endogenous) and hypervariable (venom) insulin gene class Insulin Insulin is a peptide hormone of the pancreas, and is central to regulating carbohydrate and fat metabolism in the body. It causes cells in the liver, skeletal muscles, and fat tissue to absorb glucose from the blood. A chain B chain Within vertebrates, the amino acid sequence and peptide structure is strongly conserved (fish insulin is active in human cells) Insulins are found in many invertebrates where they exert similar effects Molluscan insulins have longer chains and an additional disulfide bond .
Load more

Recommended publications
  • Cone Snail Case
    Cone Snail case Cone snail molecular phylogeny Cone snail video Snail Venom Yields Potent Painkiller, But Delivering The Drug Is Tricky Updated August 4, 201510:52 AM ETPublished August 3, 20153:30 PM ET http://www.npr.org/sections/health-shots/2015/08/03/428990755/snail-venom- yields-potent-painkiller-but-delivering-the-drug-is-tricky Magician’s cone (Conus magus) The magician’s cone, Conus magus, is a fish-hunting, or piscivorous cone snail found in the Western Pacific. It is so common in some of small Pacific islands, especially in the Philippines, that it is routinely sold in the market as food. The magician’s cone attacks its fish prey by sticking out its light yellowish proboscis, from which venom is pushed through a harpoon-like tooth. It hunts by the hook-and-line method and so will engulf its prey after it has been paralyzed. To learn more about hook-and-line hunters, click here. Scientists have analyzed the venom of the magician’s cone and one of its venom components was discovered to have a unique pharmacological activity by blocking a specific calcium channel (N-type). After this venom component was isolated and characterized in a laboratory, researchers realized that it had potential medical application. By blocking N-type calcium channels, the venom blocks channels that when open convey pain from nerve cells. If this is blocked, the brain cannot perceive these pain signals. It was developed as a pain management drug, and is now chemically synthesized and sold under the trade name Prialt. This drug is given to patients who have very severe pain that is not alliviated by morphine.
    [Show full text]
  • Taxonomic Revision of West African Cone Snails (Gastropoda: Conidae) Based Upon Mitogenomic Studies: Implications for Conservation
    European Journal of Taxonomy 663: 1–89 ISSN 2118-9773 https://doi.org/10.5852/ejt.2020.663 www.europeanjournaloftaxonomy.eu 2020 · Tenorio M.J. et al. This work is licensed under a Creative Commons Attribution License (CC BY 4.0). Monograph urn:lsid:zoobank.org:pub:78E7049C-F592-4D01-9D15-C7715119B584 Taxonomic revision of West African cone snails (Gastropoda: Conidae) based upon mitogenomic studies: implications for conservation Manuel J. TENORIO 1,*, Samuel ABALDE 2, José R. PARDOS-BLAS 3 & Rafael ZARDOYA 4 1 Departamento CMIM y Química Inorgánica – Instituto de Biomoléculas (INBIO), Facultad de Ciencias, Torre Norte, 1ª Planta, Universidad de Cadiz, 11510 Puerto Real, Cadiz, Spain. 2,3,4 Museo Nacional de Ciencias Naturales (MNCN-CSIC), José Gutiérrez Abascal 2, 28006 Madrid, Spain. * Corresponding author: [email protected] 2 Email: [email protected] 3 Email: [email protected] 4 Email: [email protected] 1 urn:lsid:zoobank.org:author:24B3DC9A-3E34-4165-A450-A8E86B0D1231 2 urn:lsid:zoobank.org:author:C72D4F45-19A1-4554-9504-42D1705C85A3 3 urn:lsid:zoobank.org:author:1CAB2718-4C97-47EE-8239-0582C472C40E 4 urn:lsid:zoobank.org:author:C55129E8-7FF7-41B2-A77C-4097E61DDD2E Abstract. In the last few years, a sharp increase in the number of descriptions of new species of West African cone snails, particularly from the Cabo Verde Archipelago, has taken place. In previous studies, we used mitogenome sequences for reconstructing robust phylogenies, which comprised in total 120 individuals representing the majority of species (69.7%) described from this biogeographical region (except Angolan endemics) and grouped into seven genera within the family Conidae.
    [Show full text]
  • Chemical Synthesis and NMR Solution Structure of Conotoxin GXIA from Conus Geographus
    marine drugs Article Chemical Synthesis and NMR Solution Structure of Conotoxin GXIA from Conus geographus David A. Armstrong 1, Ai-Hua Jin 2, Nayara Braga Emidio 2 , Richard J. Lewis 2 , Paul F. Alewood 2 and K. Johan Rosengren 1,* 1 School of Biomedical Sciences, Faculty of Medicine, The University of Queensland, Brisbane, QLD 4072, Australia; [email protected] 2 Institute for Molecular Bioscience, The University of Queensland, Brisbane, QLD 4072, Australia; [email protected] (A.-H.J.); [email protected] (N.B.E.); [email protected] (R.J.L.); [email protected] (P.F.A.) * Correspondence: [email protected] Abstract: Conotoxins are disulfide-rich peptides found in the venom of cone snails. Due to their exquisite potency and high selectivity for a wide range of voltage and ligand gated ion channels they are attractive drug leads in neuropharmacology. Recently, cone snails were found to have the capability to rapidly switch between venom types with different proteome profiles in response to predatory or defensive stimuli. A novel conotoxin, GXIA (original name G117), belonging to the I3-subfamily was identified as the major component of the predatory venom of piscivorous Conus geographus. Using 2D solution NMR spectroscopy techniques, we resolved the 3D structure for GXIA, the first structure reported for the I3-subfamily and framework XI family. The 32 amino acid peptide is comprised of eight cysteine residues with the resultant disulfide connectivity forming an ICK+1 motif. With a triple stranded β-sheet, the GXIA backbone shows striking similarity to Citation: Armstrong, D.A.; Jin, A.-H.; several tarantula toxins targeting the voltage sensor of voltage gated potassium and sodium channels.
    [Show full text]
  • Dicembre 2010
    PRO NATURA NOVARA ONLUS GRUPPO MALACOLOGICO NOVARESE Gianfranco Vischi ([email protected]) n- 9 - Dicembre 2010 LA CONCHIGLIA CHIMERA CHIMAERIA INCOMPARABILIS ( Falsa Cypraea? Rarissimo Ovulide? Fossile vivente?) a cura di Paolo Cesana In biologia, Chimera è un organismo che ''ha caratteri di molti altri'' (vedi nella mitologia il favoloso essere mostruoso. Le prime notizie della Chimera sono nel libro dell' Iliade). Qui di mostruoso non vi è nulla, ma anzi di meraviglioso, di una bellezza che abbaglia gli occhi (del malacologo e non). Parliamo della stupenda quanto misteriosa,enigmatica e rarissima CHIMAERIA INCOMPARABILIS (la Chimera incomparabile - BRIANO B. 1993). Chimera è il nome appropriato, perché questa splendida conchiglia (se ne conoscono, dati al 2009 solo 6 esemplari nelle collezioni di tutto il mondo) è un po’ un enigma per gli studiosi, chi la classifica nella grande Famiglia delle Cypraee - eocypraeinae - sottofam. Cypraeovulinae ? Chi nella Fam. Ovulidae - ovulinae. Anche il genere è contrastato, alcuni la classificano col genere SPHAEROCYPRAEA (con specie fossili molto simili l'attuale, risalenti all' Eocene, vedi fig. allegata ). EOCYPRAEIDAE è una piccola famiglia di Sphaerocypraea tardivelae grandi lumache di mare, consiste come detto principalmente di specie fossili (dall' Eocene inf. circa 55 milioni di anni) fino ai giorni nostri, vedere schema illustrativo. Qualche altro afferma che la conchiglia in questione possa appartenere a un gruppo a sé stante. VENIAMO ALLA DESCRIZIONE: La Chimaeria incomparabilis (o Sphaerocypraea)
    [Show full text]
  • (Approx) Mixed Micro Shells (22G Bags) Philippines € 10,00 £8,64 $11,69 Each 22G Bag Provides Hours of Fun; Some Interesting Foraminifera Also Included
    Special Price £ US$ Family Genus, species Country Quality Size Remarks w/o Photo Date added Category characteristic (€) (approx) (approx) Mixed micro shells (22g bags) Philippines € 10,00 £8,64 $11,69 Each 22g bag provides hours of fun; some interesting Foraminifera also included. 17/06/21 Mixed micro shells Ischnochitonidae Callistochiton pulchrior Panama F+++ 89mm € 1,80 £1,55 $2,10 21/12/16 Polyplacophora Ischnochitonidae Chaetopleura lurida Panama F+++ 2022mm € 3,00 £2,59 $3,51 Hairy girdles, beautifully preserved. Web 24/12/16 Polyplacophora Ischnochitonidae Ischnochiton textilis South Africa F+++ 30mm+ € 4,00 £3,45 $4,68 30/04/21 Polyplacophora Ischnochitonidae Ischnochiton textilis South Africa F+++ 27.9mm € 2,80 £2,42 $3,27 30/04/21 Polyplacophora Ischnochitonidae Stenoplax limaciformis Panama F+++ 16mm+ € 6,50 £5,61 $7,60 Uncommon. 24/12/16 Polyplacophora Chitonidae Acanthopleura gemmata Philippines F+++ 25mm+ € 2,50 £2,16 $2,92 Hairy margins, beautifully preserved. 04/08/17 Polyplacophora Chitonidae Acanthopleura gemmata Australia F+++ 25mm+ € 2,60 £2,25 $3,04 02/06/18 Polyplacophora Chitonidae Acanthopleura granulata Panama F+++ 41mm+ € 4,00 £3,45 $4,68 West Indian 'fuzzy' chiton. Web 24/12/16 Polyplacophora Chitonidae Acanthopleura granulata Panama F+++ 32mm+ € 3,00 £2,59 $3,51 West Indian 'fuzzy' chiton. 24/12/16 Polyplacophora Chitonidae Chiton tuberculatus Panama F+++ 44mm+ € 5,00 £4,32 $5,85 Caribbean. 24/12/16 Polyplacophora Chitonidae Chiton tuberculatus Panama F++ 35mm € 2,50 £2,16 $2,92 Caribbean. 24/12/16 Polyplacophora Chitonidae Chiton tuberculatus Panama F+++ 29mm+ € 3,00 £2,59 $3,51 Caribbean.
    [Show full text]
  • Biogeography of Coral Reef Shore Gastropods in the Philippines
    See discussions, stats, and author profiles for this publication at: https://www.researchgate.net/publication/274311543 Biogeography of Coral Reef Shore Gastropods in the Philippines Thesis · April 2004 CITATIONS READS 0 100 1 author: Benjamin Vallejo University of the Philippines Diliman 28 PUBLICATIONS 88 CITATIONS SEE PROFILE Some of the authors of this publication are also working on these related projects: History of Philippine Science in the colonial period View project Available from: Benjamin Vallejo Retrieved on: 10 November 2016 Biogeography of Coral Reef Shore Gastropods in the Philippines Thesis submitted by Benjamin VALLEJO, JR, B.Sc (UPV, Philippines), M.Sc. (UPD, Philippines) in September 2003 for the degree of Doctor of Philosophy in Marine Biology within the School of Marine Biology and Aquaculture James Cook University ABSTRACT The aim of this thesis is to describe the distribution of coral reef and shore gastropods in the Philippines, using the species rich taxa, Nerita, Clypeomorus, Muricidae, Littorinidae, Conus and Oliva. These taxa represent the major gastropod groups in the intertidal and shallow water ecosystems of the Philippines. This distribution is described with reference to the McManus (1985) basin isolation hypothesis of species diversity in Southeast Asia. I examine species-area relationships, range sizes and shapes, major ecological factors that may affect these relationships and ranges, and a phylogeny of one taxon. Range shape and orientation is largely determined by geography. Large ranges are typical of mid-intertidal herbivorous species. Triangualar shaped or narrow ranges are typical of carnivorous taxa. Narrow, overlapping distributions are more common in the central Philippines. The frequency of range sizesin the Philippines has the right skew typical of tropical high diversity systems.
    [Show full text]
  • THE LISTING of PHILIPPINE MARINE MOLLUSKS Guido T
    August 2017 Guido T. Poppe A LISTING OF PHILIPPINE MARINE MOLLUSKS - V1.00 THE LISTING OF PHILIPPINE MARINE MOLLUSKS Guido T. Poppe INTRODUCTION The publication of Philippine Marine Mollusks, Volumes 1 to 4 has been a revelation to the conchological community. Apart from being the delight of collectors, the PMM started a new way of layout and publishing - followed today by many authors. Internet technology has allowed more than 50 experts worldwide to work on the collection that forms the base of the 4 PMM books. This expertise, together with modern means of identification has allowed a quality in determinations which is unique in books covering a geographical area. Our Volume 1 was published only 9 years ago: in 2008. Since that time “a lot” has changed. Finally, after almost two decades, the digital world has been embraced by the scientific community, and a new generation of young scientists appeared, well acquainted with text processors, internet communication and digital photographic skills. Museums all over the planet start putting the holotypes online – a still ongoing process – which saves taxonomists from huge confusion and “guessing” about how animals look like. Initiatives as Biodiversity Heritage Library made accessible huge libraries to many thousands of biologists who, without that, were not able to publish properly. The process of all these technological revolutions is ongoing and improves taxonomy and nomenclature in a way which is unprecedented. All this caused an acceleration in the nomenclatural field: both in quantity and in quality of expertise and fieldwork. The above changes are not without huge problematics. Many studies are carried out on the wide diversity of these problems and even books are written on the subject.
    [Show full text]
  • Radular Morphology of Conus (Gastropoda: Caenogastropoda: Conidae) from India
    Molluscan Research 27(3): 111–122 ISSN 1323-5818 http://www.mapress.com/mr/ Magnolia Press Radular morphology of Conus (Gastropoda: Caenogastropoda: Conidae) from India J. BENJAMIN FRANKLIN, 1, 3 S. ANTONY FERNANDO, 1 B. A. CHALKE, 2 K. S. KRISHNAN. 2, 3* 1.Centre of Advanced Study in Marine Biology, Annamalai University, Parangipettai-608 502, Cuddalore, Tamilnadu, India. 2.Tata Institute of Fundamental Research, Homi Bhabha Road, Colaba, Mumbai-400 005, India. 3.National Centre for Biological Sciences, TIFR, Old Bellary Road, Bangalore-560 065, India.* Corresponding author E-mail: (K. S. Krishnan): [email protected]. Abstract Radular morphologies of 22 species of the genus Conus from Indian coastal waters were analyzed by optical and scanning elec- tron microscopy. Although the majority of species in the present study are vermivorous, all three feeding modes known to occur in the genus are represented. Specific radular-tooth structures consistently define feeding modes. Species showing simi- lar feeding modes also show fine differences in radular structures. We propose that these structures will be of value in species identification in cases of ambiguity in other characteristics. Examination of eight discrete radular-tooth components has allowed us to classify the studied species of Conus into three groups. We see much greater inter-specific differences amongst vermivorous than amongst molluscivorous and piscivorous species. We have used these differences to provide a formula for species identification. The radular teeth of Conus araneosus, C. augur, C. bayani, C. biliosus, C. hyaena, C. lentiginosus, C. loroisii, and C. malacanus are illustrated for the first time. In a few cases our study has also enabled the correction of some erroneous descriptions in the literature.
    [Show full text]
  • University of Copenhagen
    Non-Peptidic Small Molecule Components from Cone Snail Venoms Lin, Zhenjian; Torres, Joshua P.; Watkins, Maren; Paguigan, Noemi; Niu, Changshan; Imperial, Julita S.; Tun, Jortan; Safavi-Hemami, Helena; Finol-Urdaneta, Rocio K.; Neves, Jorge L. B.; Espino, Samuel; Karthikeyan, Manju; Olivera, Baldomero M.; Schmidt, Eric W. Published in: Frontiers in Pharmacology DOI: 10.3389/fphar.2021.655981 Publication date: 2021 Document version Publisher's PDF, also known as Version of record Document license: CC BY Citation for published version (APA): Lin, Z., Torres, J. P., Watkins, M., Paguigan, N., Niu, C., Imperial, J. S., Tun, J., Safavi-Hemami, H., Finol- Urdaneta, R. K., Neves, J. L. B., Espino, S., Karthikeyan, M., Olivera, B. M., & Schmidt, E. W. (2021). Non- Peptidic Small Molecule Components from Cone Snail Venoms. Frontiers in Pharmacology, 12, [655981]. https://doi.org/10.3389/fphar.2021.655981 Download date: 30. sep.. 2021 REVIEW published: 13 May 2021 doi: 10.3389/fphar.2021.655981 Non-Peptidic Small Molecule Components from Cone Snail Venoms Zhenjian Lin 1, Joshua P. Torres 1, Maren Watkins 1, Noemi Paguigan 1, Changshan Niu 1, Julita S. Imperial 1, Jortan Tun 1, Helena Safavi-Hemami 1,2, Rocio K. Finol-Urdaneta 3, Jorge L. B. Neves 4, Samuel Espino 1, Manju Karthikeyan 1, Baldomero M. Olivera 1* and Eric W. Schmidt 1* 1Departments of Medicinal Chemistry and Biochemistry, School of Biological Sciences, University of Utah, Salt Lake City, UT, United States, 2Faculty of Health and Medical Sciences, Department of Biomedical Sciences, University of Copenhagen, Copenhagen, Denmark, 3Illawarra Health and Medical Research Institute, University of Wollongong, Wollongong, NSW, Australia, 4Interdisciplinary Centre of Marine and Environmental Research, CIIMAR/ CIMAR, Faculty of Sciences, University of Porto, Porto, Portugal Venomous molluscs (Superfamily Conoidea) comprise a substantial fraction of tropical marine biodiversity (>15,000 species).
    [Show full text]
  • Conopeptide Production Through Biosustainable Snail Farming A
    Conopeptide Production through Biosustainable Snail Farming A THESIS SUBMITTED TO THE GRADUATE DIVISION OF THE UNIVERSITY OF HAWAI‘I AT MĀNOA IN PARTIAL FULFILLMENT OF THE REQUIREMENTS FOR THE DEGREE OF MASTER OF SCIENCE IN MOLECULAR BIOSCIENCES AND BIOENGINEERING DECEMBER 2012 By Jeffrey W. Milisen Thesis Committee: Jon-Paul Bingham (Chairperson) Harry Ako Cynthia Hunter Keywords: Conus striatus venom variability Student: Jeffrey W. Milisen Student ID#: 1702-1176 Degree: MS Field: Molecular Biosciences and Bioengineering Graduation Date: December 2012 Title: Conopeptide Production through Biosustainable Snail Farming We certify that we have read this Thesis and that, in our opinion, it is satisfactory in scope and quality as a Thesis for the degree of Master of Science in Molecular Biosciences and Bioengineering. Thesis Committee: Names Signatures Jon-Paul Bingham (Chair) ___________________________ Harry Ako ___________________________ Cynthia Hunter ___________________________ ii Acknowledgements The author would like to take a moment to appreciate a notable few out of the army of supporters who came out during this arduously long scholastic process without whom this work would never have been. First and foremost, a “thank you” is owed to the USDA TSTAR program whose funds kept the snails alive and solvents flowing through the RP-HPLC. Likewise, the infrastructure, teachings and financial support from the University of Hawai‘i and more specifically the College of Tropical Agriculture and Human Resources provided a fertile environment conducive to cutting edge science. Through the 3 years over which this study took place, I found myself indebted to two distinct groups of students from Dr. Bingham’s lab. Those who worked primarily in the biochemical laboratory saved countless weekend RP-HPLC runs from disaster through due diligence while patiently schooling me on my deficiencies in biochemical processes and techniques.
    [Show full text]
  • CONIDAE DE POLYNESIE Texte DAVID T OUITOU Et MICHEL BALLETON - Traduction ALAIN ROBIN
    CONIDAE DE POLYNESIE Texte DAVID T OUITOU et MICHEL BALLETON - Traduction ALAIN ROBIN Introduction Difficultés et originalités de la collecte des Introduction The various archipelagoes Les différents archipels. cônes en Polynésie Polynesia is made up of five archipelagoes very La Polynésie est composée de cinq Probablement dû à plusieurs facteurs, la different one to the other, with a total surface archipels très différents les uns des autres Polynésie possède assez peu d’endémisme matching roughly Europe, in the middleof the largest ocean in the world: the Pacific. They dont la superficie totale correspond à peu si l’on fait abstraction des îles include: près à celle de l’Europe, le tout au beau marquisiennes. Si vous passez des - the Society archipelago made up mainly milieu de l’océan le plus vaste du monde : vacances sur Tahiti et Moorea puis faites of high islands, with worldwide recognition le Pacifique. On retrouve donc : un saut dans les Tuamotu, vous ne islands such as Tahiti, Moorea and Bora Bora. - the archipelago of Tuamotus made up - l’archipel de la Société, composé ramènerez que des espèces classiques de mainly of atolls : Rangiroa, Manihi, principalement d’îles dites hautes, dans la zone Indo-Pacifique. Seule une excursion Mururoa, Fakarava or Tikehau. lequel on retrouve les îles mondialement dans l’archipel des Marquises vous - the Australs archipelago composed of connues comme Tahiti, Moorea et Bora permettra de récolter, si la météo est high islands, Rurutu and Tubuaï being the most known. Bora. clémente, les véritables trésors poly- - the archipelago of Gambier composed - l’archipel des Tuamotu, composé nésiens.
    [Show full text]
  • Identifying Gastropod Spawn from DNA Barcodes: Possible but Not Yet Practicable
    Molecular Ecology Resources (2009) doi: 10.1111/j.1755-0998.2009.02576.x DNABlackwell Publishing Ltd BARCODING Identifying gastropod spawn from DNA barcodes: possible but not yet practicable N. PUILLANDRE,* E. E. STRONG,† P. BOUCHET,‡ M.-C. BOISSELIER,* A. COULOUX§ and S. SAMADI* *UMR 7138, Systématique, adaptation, évolution (UPMC/IRD/MNHN/CNRS), Université Pierre et Marie Curie (UPMC), CP26, 57 rue Cuvier, 75231 Paris cedex 05, France, †Department of Invertebrate Zoology, Smithsonian Institution, National Museum of Natural History, MRC 163, PO Box 37012, Washington, DC 20013-7012, USA, ‡Muséum National d’Histoire Naturelle, 57 rue Cuvier, 75231 Paris cedex 05, France, §GENOSCOPE, Centre National de Séquençage, 91000 Evry, France Abstract Identifying life stages of species with complex life histories is problematic as species are often only known and/or described from a single stage. DNA barcoding has been touted as an important tool for linking life-history stages of the same species. To test the current efficacy of DNA barcodes for identifying unknown mollusk life stages, 24 marine gastropod egg capsules were collected off the Philippines in deep water and sequenced for partial fragments of the COI, 16S and 12S mitochondrial genes. Two egg capsules of known shallow- water Mediterranean species were used to calibrate the method. These sequences were compared to those available in GenBank and the Barcode of Life Database (BOLD). Using COI sequences alone, only a single Mediterranean egg capsule was identified to species, and a single Philippine egg capsule was identified tentatively to genus; all other COI sequences recovered matches between 76% and 90% with sequences from BOLD and Gen- Bank.
    [Show full text]