DOCSLIB.ORG

Bio-Functional Analysis of Ubiquitin Ligase UBE3D

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Bio-Functional Analysis of Ubiquitin Ligase UBE3D Bio-Functional Analysis of Ubiquitin Ligase UBE3D by Adam William Penn A thesis submitted in conformity with the requirements for the degree of Masters of Science Department of Medical Biophysics University of Toronto © Copyright by Adam William Penn 2020 ii Bio-Functional Analysis of Ubiquitin Ligase UBE3D Adam William Penn Masters of Science Department of Medical Biophysics University of Toronto 2020 Abstract The ubiquitin system is comprised of a reversible three step process: E1 activating enzyme, E2 conjugating enzyme and an E3 ligase, leading to ubiquitin molecules being post-translationally modified onto substrate proteins leading to a plethora of downstream effects (localization, function and half-life). UBE3D, a HECT (homologous to E6-AP carboxylic terminus) E3 ligase, has a relatively elusive regulatory role within the cell. Here, we systematically analyze and characterize UBE3D as well as its highest confidence interactor, Dynein axonemal assembly factor (DNAAF2) through: Autoubiquitylation assay; intracellular localization with immunofluorescence; interaction network using proximity-dependent biotin identification (BioID) to better understand the relationship of these two proteins. DNAAF2 protein interaction mapping allowed for insight into PIH domain. In summary, I have used multiple approaches to gain novel knowledge and insight into the potential functional role of UBE3D within the cell, and its putative partner protein, DNAAF2. ii iii Table of Contents 1 Introduction 1 1.1 The Ubiquitin System 1 1.1.1 E1 Ubiquitin Activating Enzyme 3 1.1.2 E2 Conjugating Enzyme 3 1.1.3 E3 Ubiquitin Ligases 4 1.2 HECT E3 Ubiquitin Ligases 4 1.2.1 E2 conjugating enzyme interactions with HECT E3 ligase enzymes 7 1.2.2 Mechanism and Biological Impact of Ub Chain Formation 8 1.2.3 Determining Ub linkage specificity 9 1.2.4 Analysis of ubiquitin linkage by mass spectrometry 9 1.3 UBE3D, a member of the E6-AP HECT E3 ligase family 10 1.3.1 Age-Related Macular Degeneration (AMD) and UBE3D 11 1.3.2 UBE3D implicated in East-Asian AMD 12 1.4 Cilia, Dynein Motors and associated proteins 13 1.4.1 Cilia 13 1.4.2 Dynein motors 16 1.4.3 DNAAF2 and the assembly of axonemal dynein motors 17 1.5 Identifying protein:protein interactions using BioID coupled to mass spectrometry 18 1.5.1 Analysis of protein interaction data 19 1.6 Research hypothesis and thesis outline 20 2 Results 21 2.1 Identifying the Ub Chain Building Activity of UBE3D 21 iii iv 2.1.1 Conducting an E2-UBE3D HECT E3 functional analysis 21 2.1.2 Characterization of Ub chain linkages in UBE2D3 E2 – UBE3D HECT E3 reactions24 2.1.3 Summary 24 2.1.4 Experimental Details 24 2.2 Identifying potential UBE3D Protein Interactors 27 2.2.1 Using BioID to identify UBE3D protein interactors 27 2.2.2 Using IF to identify UBE3D subcellular localization 31 2.2.3 Using siRNA to evaluate UBE3D function in ciliation 37 2.2.4 Summary 41 2.2.5 Experimental Details 41 2.3 Characterization of the relationship of DNAAF2 with UBE3D 47 2.3.1 Using BioID to identify DNAAF2 protein interactors 47 2.3.2 DNAAF2 Localization in hTERT RPE1 cells 51 2.3.3 DNAAF2 N-terminal (PIH domain) BioID Results 54 2.3.4 DNAAF2 C-Terminal BioID Results 58 2.3.5 Summary 62 2.3.6 Experimental Details 69 3 Discussion 64 3.1 Novel insights on the regulation of ciliation by UBE3D 64 3.2 Characterization of DNAAF2 reveals new insights on Axonemal Dynein assembly 67 iv Introduction 1.1 The Ubiquitin System Ubiquitin (Ub) is a 76 amino acid polypeptide that is only found in eukaryotes and is highly conserved. Ubiquitin can be covalently conjugated to a protein substrate through a multistep cascade (ubiquitylation), which, in turn leads to distinct downstream effects of the fate and/or function of the targeted molecule. Ubiquitylation of a substrate is a complex and highly regulated cascade involving an E1 activating enzyme, an E2 conjugating enzyme, and an E3 ligation reaction(1). In the ubiquitylation process, an isopeptide bond occurs between the carboxyl group of Ub and the amine group of a lysine residue on the protein substrate (2-4). There are many examples demonstrating that specific deregulation of the Ub system can result in many pathological effects such as cancers, inflammation, diabetes and neurodegenerative disorders (5). This is not surprising as many critical cellular processes are regulated by substrate ubiquitylation. The specific directionality of the downstream effects of ubiquitylation is dependent on the type of Ub linkage conjugated to the substrate. Ub can be conjugated either as a single Ub molecule (monoubiquitylation), single Ub molecules on multiple substrate lysine residues (multiubiquitylation), or as a chain of multiple Ubs connected through internal lysine residues found within the Ub molecule (polyubiquitylation). Each manner of Ub conjugation that occurs leads to unique downstream effect(s) on the substrate, including localization, function and half-life(2). Monoubiquitylation on substrate proteins has experimentally been implicated in DNA damage signaling, transcriptional control, membrane-associated processes and endocytosis. Monoubiquitylation often occurs on newly synthesized proteins to be directed to the transGolgi where they are either sent for lysosomal degradation or transported to the plasma membrane(6). Multiubiquitylation has also been shown to be involved in mechanisms of membrane-protein internalization and endocytic sorting (6). Polyubiquitylation, the process of Ub conjugation, has several unique configurations which each lead to unique downstream effects to protein substrates as well as biological processes. Ub molecules contain 7 internal lysine residues (K6, K11, K27, K29, K33, K48 and K63), which all have the ability to be ubiquitylated. Upon ubiquitylation of a Ub molecule, a Ub chain is formed. The Ub lysine residue being ubiquitylated as well as length of the chain cause unique downstream effects(3, 7-9). Several of the most biologically prevalent categories of polyubiquitylation have been elucidated but many remain to be fully understood. The best-described category of polyubiquitylation is the lysine-48 (K48)- linked Ub chains. Protein substrates conjugated with K48 linked Ub chains are targeted to the 26S 1 2 proteasome for degradation(10). In addition, lysine-6 (K6), lysine-11 (K11), lysine-27 (K27) and lysine- 29 (K29) Ub linkages upon substrate conjugation are also believed to function as targeting modifications for 26S proteasomal degradation amongst other effects(11-14). Another well-described Ub linkage is lysine-63 (K63)-linked Ub chains. K63 chains have been shown to contribute to multiple biological activities including endocytosis, aggresome formation, proteasomal degradation and DNA damage response (15). Thus, the linkage specificity of Ub chain formation can regulate protein substrate activity and/or degradation. ATP Ub Ub SH S S E1 E1 E2 Ub Ub Ub Ub K Ub S K S Ub E2 Cys Target Target E2 HECT E3 RING-E3 Ub Ub Ub K Ub K K K Ub Ub K Ub Ub Ub K Ub K K Ub K K K Ub K Target Target Target Target MonoUbiquiAlaAon MulA-mono-ubiquiAnaAon Poly-ubiquiAnaAon Poly-ubiquiAnaAon (Branched) Figure 1.1.1 A schematic representation of the general ubiquitin system and different classes of ubiquitin linkages. 3 1.1.1 E1 Ubiquitin Activating Enzyme The first step in the ubiquitylation cascade is performed by the E1 activating enzyme. In mammals there are two known E1 enzymes, UBE1 (predominantly) and UBA6 (16-18). E1 activating enzymes function by first creating an adenylate-intermediate through binding of MgATP and Ub (a bond between the C- terminal carboxylate of the Ub and AMP) (3) (4) Ub is then transferred to the active cysteine site found in the catalytic domain of UBA1 to form the activated Ub-UBA1 complex via a thiol-ester bond (4, 19). The activated Ub-UBA1 complex binds a second Ub molecule to the adenylation domain and subsequently converts it to an Ub-adenylate. Upon the E1 complex being doubly bound by Ub it is then recognized by an E2 conjugating enzyme. Only the thiol-ester Ub from the E1 activating enzyme is transferred to the E2 conjugating enzyme to form a Ub-charged E2 complex. 1.1.2 E2 Conjugating Enzyme The broad overarching function of E2 conjugating enzymes is to accept the activated Ub from E1 enzyme and then subsequently bind E3 ligases and facilitate the Ub transfer to substrates (3). There are approximately 40 E2 conjugating enzymes encoded by the human genome (both active and inactive E2 variants). These 40 E2s are responsible for conjugation of Ub to over 800 E3 ligases (each with their own specific substrate profile).(20) It has been shown that each E2 can cooperate with several E3 ligases and each E3 can cooperate with several E2 conjugating enzymes (21, 22). Structural characteristics of the E2 conjugating family of enzymes are key to their activity have been well described for the majority of family members (20). The ubiquitin conjugation domain (UBC) is conserved amongst all E2s. The UBC consists of ~150 amino acid residues including the cysteine residue to which the active Ub molecule is accepted from the E1. The UBC domain is responsible for catalysis and Ub binding (22). The UBC is made up of 4 alpha-helices with a 310 helix extension and 4 corresponding anti- parallel beta-sheets. The main mechanism in most E2 conjugating enzymes requires a standard E2 fold of the UBC (22). The less conserved residues in the E2 conjugating enzymes mostly occurs in the two loop regions, which confer the majority of variability in length, sequence and conformation. These two loop regions are responsible for E1 and E3 binding. They play a central role in aligning the substrate lysine toward the E2 4 catalytic cysteine (20, 23, 24).
Load more

Recommended publications
  • The Effect of Temperature Adaptation on the Ubiquitin–Proteasome Pathway in Notothenioid Fishes Anne E
    © 2017. Published by The Company of Biologists Ltd | Journal of Experimental Biology (2017) 220, 369-378 doi:10.1242/jeb.145946 RESEARCH ARTICLE The effect of temperature adaptation on the ubiquitin–proteasome pathway in notothenioid fishes Anne E. Todgham1,*, Timothy A. Crombie2 and Gretchen E. Hofmann3 ABSTRACT proliferation to compensate for the effects of low temperature on ’ There is an accumulating body of evidence suggesting that the sub- aerobic metabolism (Johnston, 1989; O Brien et al., 2003; zero Antarctic marine environment places physiological constraints Guderley, 2004). Recently, there has been an accumulating body – on protein homeostasis. Levels of ubiquitin (Ub)-conjugated proteins, of literature to suggest that protein homeostasis the maintenance of – 20S proteasome activity and mRNA expression of many proteins a functional protein pool has been highly impacted by evolution involved in both the Ub tagging of damaged proteins as well as the under these cold and stable conditions. different complexes of the 26S proteasome were measured to Maintaining protein homeostasis is a fundamental physiological examine whether there is thermal compensation of the Ub– process, reflecting a dynamic balance in synthetic and degradation proteasome pathway in Antarctic fishes to better understand the processes. There are numerous lines of evidence to suggest efficiency of the protein degradation machinery in polar species. Both temperature compensation of protein synthesis in Antarctic Antarctic (Trematomus bernacchii, Pagothenia borchgrevinki)and invertebrates (Whiteley et al., 1996; Marsh et al., 2001; Robertson non-Antarctic (Notothenia angustata, Bovichtus variegatus) et al., 2001; Fraser et al., 2002) and fish (Storch et al., 2005). In notothenioids were included in this study to investigate the zoarcid fishes, it has been demonstrated that Antarctic eelpouts mechanisms of cold adaptation of this pathway in polar species.
    [Show full text]
  • Ciliopathiesneuromuscularciliopathies Disorders Disorders Ciliopathiesciliopathies
    NeuromuscularCiliopathiesNeuromuscularCiliopathies Disorders Disorders CiliopathiesCiliopathies AboutAbout EGL EGL Genet Geneticsics EGLEGL Genetics Genetics specializes specializes in ingenetic genetic diagnostic diagnostic testing, testing, with with ne nearlyarly 50 50 years years of of clinical clinical experience experience and and board-certified board-certified labor laboratoryatory directorsdirectors and and genetic genetic counselors counselors reporting reporting out out cases. cases. EGL EGL Genet Geneticsics offers offers a combineda combined 1000 1000 molecular molecular genetics, genetics, biochemical biochemical genetics,genetics, and and cytogenetics cytogenetics tests tests under under one one roof roof and and custom custom test testinging for for all all medically medically relevant relevant genes, genes, for for domestic domestic andand international international clients. clients. EquallyEqually important important to to improving improving patient patient care care through through quality quality genetic genetic testing testing is is the the contribution contribution EGL EGL Genetics Genetics makes makes back back to to thethe scientific scientific and and medical medical communities. communities. EGL EGL Genetics Genetics is is one one of of only only a afew few clinical clinical diagnostic diagnostic laboratories laboratories to to openly openly share share data data withwith the the NCBI NCBI freely freely available available public public database database ClinVar ClinVar (>35,000 (>35,000 variants variants on on >1700 >1700 genes) genes) and and is isalso also the the only only laboratory laboratory with with a a frefree oen olinnlein dea dtabtaabsaes (eE m(EVmCVlaCslas)s,s f)e, afetuatruinrgin ag vaa vraiarniatn ctl acslasisfiscifiactiaotino sne saercahrc ahn adn rde rpeoprot rrte rqeuqeuset sint tinetrefarcfaec, ew, hwichhic fha cfailcitialiteatse rsa praidp id interactiveinteractive curation curation and and reporting reporting of of variants.
    [Show full text]
  • UBE2D3 Antibody Order 021-34695924 [email protected] Support 400-6123-828 50Ul [email protected] 100 Ul √ √ Web
    TD2261 UBE2D3 Antibody Order 021-34695924 [email protected] Support 400-6123-828 50ul [email protected] 100 uL √ √ Web www.ab-mart.com.cn Description: Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'-linked polyubiquitination. Cooperates with the E2 CDC34 and the SCF(FBXW11) E3 ligase complex for the polyubiquitination of NFKBIA leading to its subsequent proteasomal degradation. Acts as an initiator E2, priming the phosphorylated NFKBIA target at positions 'Lys-21' and/or 'Lys- 22' with a monoubiquitin. Ubiquitin chain elongation is then performed by CDC34, building ubiquitin chains from the UBE2D3-primed NFKBIA-linked ubiquitin. Acts also as an initiator E2, in conjunction with RNF8, for the priming of PCNA. Monoubiquitination of PCNA, and its subsequent polyubiquitination, are essential events in the operation of the DNA damage tolerance (DDT) pathway that is activated after DNA damage caused by UV or chemical agents during S-phase. Associates with the BRCA1/BARD1 E3 ligase complex to perform ubiquitination at DNA damage sites following ionizing radiation leading to DNA repair. Targets DAPK3 for ubiquitination which influences promyelocytic leukemia protein nuclear body (PML-NB) formation in the nucleus. In conjunction with the MDM2 and TOPORS E3 ligases, functions ubiquitination of p53/TP53. Supports NRDP1-mediated ubiquitination and degradation of ERBB3 and of BRUCE which triggers apoptosis. In conjunction with the CBL E3 ligase, targets EGFR for polyubiquitination at the plasma membrane as well as during its internalization and transport on endosomes. In conjunction with the STUB1 E3 quality control E3 ligase, ubiquitinates unfolded proteins to catalyze their immediate destruction.
    [Show full text]
  • Bayesian Hierarchical Modeling of High-Throughput Genomic Data with Applications to Cancer Bioinformatics and Stem Cell Differentiation
    BAYESIAN HIERARCHICAL MODELING OF HIGH-THROUGHPUT GENOMIC DATA WITH APPLICATIONS TO CANCER BIOINFORMATICS AND STEM CELL DIFFERENTIATION by Keegan D. Korthauer A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Statistics) at the UNIVERSITY OF WISCONSIN–MADISON 2015 Date of final oral examination: 05/04/15 The dissertation is approved by the following members of the Final Oral Committee: Christina Kendziorski, Professor, Biostatistics and Medical Informatics Michael A. Newton, Professor, Statistics Sunduz Kele¸s,Professor, Biostatistics and Medical Informatics Sijian Wang, Associate Professor, Biostatistics and Medical Informatics Michael N. Gould, Professor, Oncology © Copyright by Keegan D. Korthauer 2015 All Rights Reserved i in memory of my grandparents Ma and Pa FL Grandma and John ii ACKNOWLEDGMENTS First and foremost, I am deeply grateful to my thesis advisor Christina Kendziorski for her invaluable advice, enthusiastic support, and unending patience throughout my time at UW-Madison. She has provided sound wisdom on everything from methodological principles to the intricacies of academic research. I especially appreciate that she has always encouraged me to eke out my own path and I attribute a great deal of credit to her for the successes I have achieved thus far. I also owe special thanks to my committee member Professor Michael Newton, who guided me through one of my first collaborative research experiences and has continued to provide key advice on my thesis research. I am also indebted to the other members of my thesis committee, Professor Sunduz Kele¸s,Professor Sijian Wang, and Professor Michael Gould, whose valuable comments, questions, and suggestions have greatly improved this dissertation.
    [Show full text]
  • Defining Functional Interactions During Biogenesis of Epithelial Junctions
    ARTICLE Received 11 Dec 2015 | Accepted 13 Oct 2016 | Published 6 Dec 2016 | Updated 5 Jan 2017 DOI: 10.1038/ncomms13542 OPEN Defining functional interactions during biogenesis of epithelial junctions J.C. Erasmus1,*, S. Bruche1,*,w, L. Pizarro1,2,*, N. Maimari1,3,*, T. Poggioli1,w, C. Tomlinson4,J.Lees5, I. Zalivina1,w, A. Wheeler1,w, A. Alberts6, A. Russo2 & V.M.M. Braga1 In spite of extensive recent progress, a comprehensive understanding of how actin cytoskeleton remodelling supports stable junctions remains to be established. Here we design a platform that integrates actin functions with optimized phenotypic clustering and identify new cytoskeletal proteins, their functional hierarchy and pathways that modulate E-cadherin adhesion. Depletion of EEF1A, an actin bundling protein, increases E-cadherin levels at junctions without a corresponding reinforcement of cell–cell contacts. This unexpected result reflects a more dynamic and mobile junctional actin in EEF1A-depleted cells. A partner for EEF1A in cadherin contact maintenance is the formin DIAPH2, which interacts with EEF1A. In contrast, depletion of either the endocytic regulator TRIP10 or the Rho GTPase activator VAV2 reduces E-cadherin levels at junctions. TRIP10 binds to and requires VAV2 function for its junctional localization. Overall, we present new conceptual insights on junction stabilization, which integrate known and novel pathways with impact for epithelial morphogenesis, homeostasis and diseases. 1 National Heart and Lung Institute, Faculty of Medicine, Imperial College London, London SW7 2AZ, UK. 2 Computing Department, Imperial College London, London SW7 2AZ, UK. 3 Bioengineering Department, Faculty of Engineering, Imperial College London, London SW7 2AZ, UK. 4 Department of Surgery & Cancer, Faculty of Medicine, Imperial College London, London SW7 2AZ, UK.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Potential Microrna-Related Targets in Clearance Pathways of Amyloid-Β
    Madadi et al. Cell Biosci (2019) 9:91 https://doi.org/10.1186/s13578-019-0354-3 Cell & Bioscience REVIEW Open Access Potential microRNA-related targets in clearance pathways of amyloid-β: novel therapeutic approach for the treatment of Alzheimer’s disease Soheil Madadi1, Heidi Schwarzenbach2, Massoud Saidijam3, Reza Mahjub4 and Meysam Soleimani1* Abstract Imbalance between amyloid-beta (Aβ) peptide synthesis and clearance results in Aβ deregulation. Failure to clear these peptides appears to cause the development of Alzheimer’s disease (AD). In recent years, microRNAs have become established key regulators of biological processes that relate among others to the development and progres- sion of neurodegenerative diseases, such as AD. This review article gives an overview on microRNAs that are involved in the Aβ cascade and discusses their inhibitory impact on their target mRNAs whose products participate in Aβ clear- ance. Understanding of the mechanism of microRNA in the associated signal pathways could identify novel therapeu- tic targets for the treatment of AD. Keywords: Ubiquitin–proteasome system, Autophagy, Aβ-degrading proteases, BBB transporters, Phagocytosis, Heat shock proteins, microRNAs Introduction stage, APP is cleaved to non-toxic proteins by α-secretase Alzheimer’s disease (AD)—the most common form of [6]. Aβ has two major forms: Aβ40 and Aβ42, which are dementia—is a devastating diagnosis that accounts for 40 and 42 amino acid-long fragments, respectively. Since 93,541 deaths in the United States in 2014 [1]. Clinical Aβ42 is more hydrophobic than Aβ40, it is more prone to manifestation of AD is often a loss of memory and cog- aggregate and scafold for oligomeric and fbrillar forms nitive skills.
    [Show full text]
  • Structure of the Molecular Chaperone Prefoldin
    CORE Metadata, citation and similar papers at core.ac.uk Provided by Elsevier - Publisher Connector Cell, Vol. 103, 621±632, November 10, 2000, Copyright 2000 by Cell Press Structure of the Molecular Chaperone Prefoldin: Unique Interaction of Multiple Coiled Coil Tentacles with Unfolded Proteins of newly synthesized bacterial %10ف ,Ralf Siegert,² Michel R. Leroux,²³ 1999). In addition Clemens Scheufler, F. Ulrich Hartl,* proteins complete their folding in the sequestered envi- and Ismail Moarefi* ronment provided by GroEL/GroES (Horwich et al., 1993; Max-Planck Institut fuÈ r Biochemie Ewalt et al., 1997; Houry et al., 1999). The eukaryotic Am Klopferspitz 18a Hsp70 chaperone machine also binds nascent chains D82152 Martinsried (Beckmann et al., 1990; Nelson et al., 1992; Eggers et Germany al., 1997; Thulasiraman et al., 1999), and some proteins, including actins and tubulins, depend on the Group II cytosolic chaperonin TRiC (TCP-1 ring Complex; also Summary termed CCT) for folding (Frydman et al., 1992; Gao et al., 1992; Yaffe et al., 1992; Kubota et al., 1995; Siegers Prefoldin (GimC) is a hexameric molecular chaperone et al., 1999). complex built from two related classes of subunits The archaeal Group II chaperonin (thermosome) is and present in all eukaryotes and archaea. Prefoldin closely related to its eukaryotic homologue TRiC (Gutsche et al., 1999). In contrast, Hsp70 proteins and interacts with nascent polypeptide chains and, in vitro, TF are generally missing from the archaeal kingdom can functionally substitute for the Hsp70 chaperone though some archaea have acquired Hsp70, presumably system in stabilizing non-native proteins for subse- by lateral gene transfer (Gribaldo et al., 1999).
    [Show full text]
  • UBE2E1 (Ubch6) [Untagged] E2 – Ubiquitin Conjugating Enzyme
    UBE2E1 (UbcH6) [untagged] E2 – Ubiquitin Conjugating Enzyme Alternate Names: UbcH6, UbcH6, Ubiquitin conjugating enzyme UbcH6 Cat. No. 62-0019-100 Quantity: 100 µg Lot. No. 1462 Storage: -70˚C FOR RESEARCH USE ONLY NOT FOR USE IN HUMANS CERTIFICATE OF ANALYSIS Page 1 of 2 Background Physical Characteristics The enzymes of the ubiquitylation Species: human Protein Sequence: pathway play a pivotal role in a num- GPLGSPGIPGSTRAAAM SDDDSRAST ber of cellular processes including Source: E. coli expression SSSSSSSSNQQTEKETNTPKKKESKVSMSKN regulated and targeted proteasomal SKLLSTSAKRIQKELADITLDPPPNCSAGP degradation of substrate proteins. Quantity: 100 μg KGDNIYEWRSTILGPPGSVYEGGVFFLDIT FTPEYPFKPPKVTFRTRIYHCNINSQGVI Three classes of enzymes are in- Concentration: 1 mg/ml CLDILKDNWSPALTISKVLLSICSLLTDCNPAD volved in the process of ubiquitylation; PLVGSIATQYMTNRAEHDRMARQWTKRYAT activating enzymes (E1s), conjugating Formulation: 50 mM HEPES pH 7.5, enzymes (E2s) and protein ligases 150 mM sodium chloride, 2 mM The residues underlined remain after cleavage and removal (E3s). UBE2E1 is a member of the E2 dithiothreitol, 10% glycerol of the purification tag. ubiquitin-conjugating enzyme family UBE2E1 (regular text): Start bold italics (amino acid and cloning of the human gene was Molecular Weight: ~23 kDa residues 1-193) Accession number: AAH09139 first described by Nuber et al. (1996). UBE2E1 shares 74% sequence ho- Purity: >98% by InstantBlue™ SDS-PAGE mology with UBE2D1 and contains an Stability/Storage: 12 months at -70˚C; N-terminal extension of approximately aliquot as required 40 amino acids. A tumour suppressor candidate, tumour-suppressing sub- chromosomal transferable fragment Quality Assurance cDNA (TSSC5) is located in the re- gion of human chromosome 11p15.5 Purity: Protein Identification: linked with Beckwith-Wiedemann syn- 4-12% gradient SDS-PAGE Confirmed by mass spectrometry.
    [Show full text]
  • Gain of UBE2D1 Facilitates Hepatocellular Carcinoma
    Zhou et al. Journal of Experimental & Clinical Cancer Research (2018) 37:290 https://doi.org/10.1186/s13046-018-0951-8 RESEARCH Open Access Gain of UBE2D1 facilitates hepatocellular carcinoma progression and is associated with DNA damage caused by continuous IL-6 Chuanchuan Zhou1,2, Fengrui Bi1, Jihang Yuan1, Fu Yang1 and Shuhan Sun1* Abstract Background: Hepatocellular carcinoma (HCC) is the most common type of liver cancer with increasing incidence and poor prognosis. Ubiquitination regulators are reported to play crucial roles in HCC carcinogenesis. UBE2D1, one of family member of E2 ubiquitin conjugating enzyme, mediates the ubiquitination and degradation of tumor suppressor protein p53. However, the expression and functional roles of UBE2D1 in HCC was unknown. Methods: Immunohistochemistry (IHC), western blotting, and real-time PCR were used to detect the protein, transcription and genomic levels of UBE2D1 in HCC tissues with paired nontumor tissues, precancerous lesions and hepatitis liver tissues. Four HCC cell lines and two immortalized hepatic cell lines were used to evaluate the functional roles and underlying mechanisms of UBE2D1 in HCC initiation and progression in vitro and in vivo. The contributors to UBE2D1 genomic amplification were first evaluated by performing a correlation analysis between UBE2D1 genomic levels with clinical data of HCC patients, and then evaluated in HCC and hepatic cell lines. Results: Expression of UBE2D1 was significantly increased in HCC tissues and precancerous lesions and was associated with reduced survival of HCC patients. Upregulation of UBE2D1 promoted HCC growth in vitro and in vivo by decreasing the p53 in ubiquitination-dependent pathway. High expression of UBE2D1 was attributed to the recurrent genomic copy number gain, which was associated with high serum IL-6 level of HCC patients.
    [Show full text]
  • Ciliopathies Gene Panel
    Ciliopathies Gene Panel Contact details Introduction Regional Genetics Service The ciliopathies are a heterogeneous group of conditions with considerable phenotypic overlap. Levels 4-6, Barclay House These inherited diseases are caused by defects in cilia; hair-like projections present on most 37 Queen Square cells, with roles in key human developmental processes via their motility and signalling functions. Ciliopathies are often lethal and multiple organ systems are affected. Ciliopathies are London, WC1N 3BH united in being genetically heterogeneous conditions and the different subtypes can share T +44 (0) 20 7762 6888 many clinical features, predominantly cystic kidney disease, but also retinal, respiratory, F +44 (0) 20 7813 8578 skeletal, hepatic and neurological defects in addition to metabolic defects, laterality defects and polydactyly. Their clinical variability can make ciliopathies hard to recognise, reflecting the ubiquity of cilia. Gene panels currently offer the best solution to tackling analysis of genetically Samples required heterogeneous conditions such as the ciliopathies. Ciliopathies affect approximately 1:2,000 5ml venous blood in plastic EDTA births. bottles (>1ml from neonates) Ciliopathies are generally inherited in an autosomal recessive manner, with some autosomal Prenatal testing must be arranged dominant and X-linked exceptions. in advance, through a Clinical Genetics department if possible. Referrals Amniotic fluid or CV samples Patients presenting with a ciliopathy; due to the phenotypic variability this could be a diverse set should be sent to Cytogenetics for of features. For guidance contact the laboratory or Dr Hannah Mitchison dissecting and culturing, with ([email protected]) / Prof Phil Beales ([email protected]) instructions to forward the sample to the Regional Molecular Genetics Referrals will be accepted from clinical geneticists and consultants in nephrology, metabolic, laboratory for analysis respiratory and retinal diseases.
    [Show full text]
  • Utilization of Genomic Sequencing for Population Screening of Immunodeficiencies in the Newborn
    © American College of Medical Genetics and Genomics ORIGINAL RESEARCH ARTICLE Utilization of genomic sequencing for population screening of immunodeficiencies in the newborn Ashleigh R. Pavey, MD1,2,3, Dale L. Bodian, PhD3, Thierry Vilboux, PhD3, Alina Khromykh, MD3, Natalie S. Hauser, MD3,4, Kathi Huddleston, PhD3, Elisabeth Klein, DNP3, Aaron Black, MS3, Megan S. Kane, PhD3, Ramaswamy K. Iyer, PhD3, John E. Niederhuber, MD3,5 and Benjamin D. Solomon, MD3,4,6 Purpose: Immunodeficiency screening has been added to many Results: WGS provides adequate coverage for most known state-directed newborn screening programs. The current metho- immunodeficiency-related genes. 13,476 distinct variants and dology is limited to screening for severe T-cell lymphopenia 8,502 distinct predicted protein-impacting variants were identified disorders. We evaluated the potential of genomic sequencing to in this cohort; five individuals carried potentially pathogenic augment current newborn screening for immunodeficiency, – variants requiring expert clinical correlation. One clinically including identification of non T cell disorders. asymptomatic individual was found genomically to have comple- Methods: We analyzed whole-genome sequencing (WGS) and ment component 9 deficiency. Of the symptomatic children, one clinical data from a cohort of 1,349 newborn–parent trios by was molecularly identified as having an immunodeficiency condi- genotype-first and phenotype-first approaches. For the genotype- tion and two were found to have other molecular diagnoses. first approach, we analyzed predicted protein-impacting variants in Conclusion: Neonatal genomic sequencing can potentially aug- 329 immunodeficiency-related genes in the WGS data. As a ment newborn screening for immunodeficiency. phenotype-first approach, electronic health records were used to identify children with clinical features suggestive of immunodefi- Genet Med advance online publication 15 June 2017 ciency.
    [Show full text]