CCBP2 (Human) Recombinant repeated freezing and thawing. GeneID: 1238

Catalog Number: H00001238-G01 Symbol: CCBP2

Regulation Status: For research use only (RUO) Gene Alias: CCR10, CCR9, CMKBR9, D6, MGC126678, MGC138250, hD6 Product Description: Human CCBP2 full-length ORF (NP_001287.2) recombinant protein without tag. Gene Summary: This gene encodes a beta receptor, which is predicted to be a seven Sequence: transmembrane protein similar to -coupled MAATASPQPLATEDADSENSSFYYYDYLDEVAFMLCR receptors. and their receptor-mediated KDAVVSFGKVFLPVFYSLIFVLGLSGNLLLLMVLLRYVP signal transduction are critical for the recruitment of RRRMVEIYLLNLAISNLLFLVTLPFWGISVAWHWVFGS effector immune cells to the inflammation site. This gene FLCKMVSTLYTINFYSGIFFISCMSLDKYLEIVHAQPYH is expressed in a range of tissues and hemopoietic cells. RLRTRAKSLLLATIVWAVSLAVSIPDMVFVQTHENPKG The expression of this receptor in lymphatic endothelial VWNCHADFGGHGTIWKLFLRFQQNLLGFLLPLLAMIFF cells and overexpression in vascular tumors suggested YSRIGCVLVRLRPAGQGRALKIAAALVVAFFVLWFPYN its function in chemokine-driven recirculation of LTLFLHTLLDLQVFGNCEVSQHLDYALQVTESIAFLHC leukocytes and possible chemokine effects on the CFSPILYAFSSHRFRQYLKAFLAAVLGWHLAPGTAQAS development and growth of vascular tumors. This LSSCSESSILTAQEEMTGMNDLGERQSENYPNKEDVG receptor appears to bind the majority of beta-chemokine NKSA family members; however, its specific function remains Host: Wheat Germ (in vitro) unknown. This gene is mapped to 3p21.3, a region that includes a cluster of Theoretical MW (kDa): 43.4 . [provided by RefSeq]

Applications: AP (See our web site product page for detailed applications information)

Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols

Form: Liquid

Preparation Method: in vitro wheat germ expression system with proprietary liposome technology

Purification: None

Recommend Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.

Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Storage Instruction: Store at -80°C. Aliquot to avoid

Page 1/1

Powered by TCPDF (www.tcpdf.org)