Étude Des Profils De Méthylation Et D'expression Des

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Étude des profils de méthylation et d’expression des lymphocytes T CD4+ dans l’asthme Mémoire Anne-Marie Boucher-Lafleur Maîtrise en sciences cliniques et biomédicales de l’Université Laval offerte en extension à l’Université du Québec à Chicoutimi Maître ès sciences (M.Sc.) Québec, Canada © Anne-Marie Boucher-Lafleur, 2019 Étude des profils de méthylation et d’expression des lymphocytes T CD4+ dans l’asthme Mémoire Anne-Marie Boucher-Lafleur Sous la direction de : Catherine Laprise, directrice de recherche RÉSUMÉ L’asthme est une maladie respiratoire chronique impliquant de l’inflammation, de l’hyperréactivité bronchique et un remodelage des voies respiratoires. Il s’agit d’un trait complexe résultant d’interactions entre des facteurs génétiques et environnementaux. La portion génétique de l’asthme a été bien décrite, avec une héritabilité estimée jusqu’à 60% selon les études. Une portion de l’héritabilité manquante dans l’asthme pourrait être expliquée par des facteurs épigénétiques, comme la méthylation de l’ADN. Comme la méthylation est spécifique à chaque tissu, il est logique d’étudier des cellules ayant un rôle important dans l’asthme. C’est le cas des lymphocytes T CD4+ qui contribuent activement à la pathophysiologie de l’asthme. L’objectif du présent projet était donc d’étudier les lymphocytes T CD4+ dans un contexte d’asthme, plus particulièrement leur patron de méthylation ainsi que leur patron d’expression. Ces lymphocytes ont été isolés du sang de plus de 200 individus faisant partie de la Cohorte familiale d’asthme du Saguenay–Lac-Saint-Jean. La méthylation et l’expression a ensuite été mesurée par séquençage. Après des contrôles de qualité, des données étaient disponibles pour 173 individus (107 asthmatiques, 66 témoins). Il a ainsi été possible d’identifier 2 146 sites CpG différemment méthylés chez les asthmatiques et 3 756 chez les asthmatiques allergiques (FDR≤0,05, -meth ≥ 5%). Pour l’expression, 57 et 33 gènes sont différemment exprimés chez les asthmatiques et les asthmatiques allergiques, respectivement (FDR≤0,05). L’intégration des données génétique et d’expression ont permis d’identifier 2 253 eQTL significatifs (FDR≤0,049). Ces résultats ont permis d’identifier l’implication de la voie de NF-B ainsi que celle de l’IL-17 et -25 dans ces cellules, mais aussi l’implication de la famille de chemokine CXC et de EGF. En somme, cette étude a permis de caractériser plus précisément un type cellulaire dans l’asthme, toujours dans le but de mieux comprendre les mécanismes sous-jacents impliqués dans cette condition. ii TABLE DES MATIÈRES RÉSUMÉ ............................................................................................................................................................. ii TABLE DES MATIÈRES ..................................................................................................................................... iii LISTE DES FIGURES .......................................................................................................................................... v LISTE DES TABLEAUX ...................................................................................................................................... vi LISTE DES ABRÉVIATIONS ............................................................................................................................. vii REMERCIEMENTS ............................................................................................................................................ xi INTRODUCTION ................................................................................................................................................ 1 1. Asthme................................................................................................................................................... 1 1.1 Épidémiologie....................................................................................................................................... 1 1.2 Phénotypes .......................................................................................................................................... 2 1.3 Physiopathologie .................................................................................................................................. 3 1.3.1 Sensibilisation à un allergène ....................................................................................................... 3 1.3.2 Phase précoce de l’inflammation .................................................................................................. 6 1.3.2.1 L’épithélium bronchique......................................................................................................... 6 1.3.2.2 Réexposition .......................................................................................................................... 6 1.3.3 Phase tardive de l’inflammation .................................................................................................... 8 1.3.3.1 Lymphocytes T CD4+ ............................................................................................................ 8 1.3.3.2 Éosinophiles et neutrophiles ................................................................................................ 11 1.3.4 Le remodelage des voies respiratoires ....................................................................................... 12 2. Composante génétique ............................................................................................................................ 15 3. Composante environnementale ................................................................................................................ 18 3.1 Épigénétique ...................................................................................................................................... 18 3.1.1 Méthylation de l’ADN .................................................................................................................. 20 3.3 Facteurs de risque ............................................................................................................................. 21 3.3.1 Âge et sexe ................................................................................................................................. 22 3.3.2 Obésité ....................................................................................................................................... 23 3.3.3 Qualité de l’air ............................................................................................................................. 23 3.3.4 Tabagisme .................................................................................................................................. 25 4. Population à l’étude .................................................................................................................................. 25 4.1 Historique ........................................................................................................................................... 25 4.2 La cohorte familiale d’asthme du Saguenay−Lac-Saint-Jean ............................................................ 27 5. Hypothèse et objectifs .............................................................................................................................. 29 CHAPITRE 1 – MÉTHODOLOGIE ................................................................................................................... 30 1.1 Recrutement des participants............................................................................................................. 30 1.2 Isolation des lymphocytes T CD4+ ..................................................................................................... 30 1.3 Données de méthylation .................................................................................................................... 32 1.3.1 Séquençage (MCC-seq) ............................................................................................................. 32 1.3.2 Alignement et contrôles qualités ................................................................................................. 34 1.4 Données d’expression ........................................................................................................................ 35 1.4.1 Séquençage de l’ARN ................................................................................................................ 35 1.4.2 Alignement et contrôles qualités ................................................................................................. 37 1.5 Données génétiques .......................................................................................................................... 38 1.6 Analyses ............................................................................................................................................. 38 1.6.1 Méthylation ................................................................................................................................. 38 1.6.2 Expression .................................................................................................................................. 40 1.6.3 Corrélations méthylation – expression ........................................................................................ 40 1.6.4 eQTL ........................................................................................................................................... 41 CHAPITRE
Recommended publications
  • Bincard Shrna Plasmid (M): Sc-141706-SH

    Bincard Shrna Plasmid (M): Sc-141706-SH

    SANTA CRUZ BIOTECHNOLOGY, INC. BinCARD shRNA Plasmid (m): sc-141706-SH BACKGROUND PRODUCT BinCARD (Bcl10-interacting CARD protein) is a 228 amino acid protein that BinCARD shRNA Plasmid (m) is a target-specific lentiviral vector plasmid exists as two alternatively spiced isoforms. BinCARD localizes to nucleus encoding a 19-25 nt (plus hairpin) shRNA designed to knock down gene and is expressed in ovary, testis, placenta, skeletal muscle, kidney, lung, heart, expression. Each plasmid contains a puromycin resistance gene for the liver, thymus and brain. Containing a CARD domain, BinCARD plays a role in selection of cells stably expressing shRNA. Each vial contains 20 µg of inhibiting the effects of Bcl10-induced activation of NFκB possibly by inhibit- lyophilized shRNA plasmid DNA. Suitable for up to 20 transfections. Also ing the phosphorylation of Bcl10 in a CARD-dependent manner. The BinCARD see BinCARD siRNA (m): sc-141706 and BinCARD shRNA (m) Lentiviral gene maps to chromosome 9q22.31. Chromosome 9 consists of about 145 Particles: sc-141706-V as alternate gene silencing products. million bases and 4% of the human genome and encodes nearly 900 genes. Notably, chromosome 9 encompasses the largest interferon family gene clus- STORAGE AND RESUSPENSION ter. Considered to play a role in gender determination, deletion of the distal Store lyophilized shRNA plasmid DNA at 4° C with desiccant. Stable for portion of 9p can lead to development of male to female sex reversal, the at least one year from the date of shipment. Once resuspended, store at phenotype of a female with a male X,Y genotype.
  • Bincard CRISPR/Cas9 KO Plasmid (M): Sc-427067

    Bincard CRISPR/Cas9 KO Plasmid (M): Sc-427067

    SANTA CRUZ BIOTECHNOLOGY, INC. BinCARD CRISPR/Cas9 KO Plasmid (m): sc-427067 BACKGROUND APPLICATIONS The Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) and BinCARD CRISPR/Cas9 KO Plasmid (m) is recommended for the disruption of CRISPR-associated protein (Cas9) system is an adaptive immune response gene expression in mouse cells. defense mechanism used by archea and bacteria for the degradation of foreign genetic material (4,6). This mechanism can be repurposed for other 20 nt non-coding RNA sequence: guides Cas9 functions, including genomic engineering for mammalian systems, such as to a specific target location in the genomic DNA gene knockout (KO) (1,2,3,5). CRISPR/Cas9 KO Plasmid products enable the U6 promoter: drives gRNA scaffold: helps Cas9 identification and cleavage of specific genes by utilizing guide RNA (gRNA) expression of gRNA bind to target DNA sequences derived from the Genome-scale CRISPR Knock-Out (GeCKO) v2 library developed in the Zhang Laboratory at the Broad Institute (3,5). Termination signal Green Fluorescent Protein: to visually REFERENCES verify transfection CRISPR/Cas9 Knockout Plasmid CBh (chicken β-Actin 1. Cong, L., et al. 2013. Multiplex genome engineering using CRISPR/Cas hybrid) promoter: drives systems. Science 339: 819-823. 2A peptide: expression of Cas9 allows production of both Cas9 and GFP from the 2. Mali, P., et al. 2013. RNA-guided human genome engineering via Cas9. same CBh promoter Science 339: 823-826. Nuclear localization signal 3. Ran, F.A., et al. 2013. Genome engineering using the CRISPR-Cas9 system. Nuclear localization signal SpCas9 ribonuclease Nat. Protoc. 8: 2281-2308.
  • The CARD-CC/Bcl10/Paracaspase Signaling Complex Is Functionally Conserved Since the Last Common Ancestor of Planulozoa

    The CARD-CC/Bcl10/Paracaspase Signaling Complex Is Functionally Conserved Since the Last Common Ancestor of Planulozoa

    bioRxiv preprint doi: https://doi.org/10.1101/046789; this version posted December 29, 2016. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. Article - Discoveries The CARD-CC/Bcl10/paracaspase signaling complex is functionally conserved since the last common ancestor of Planulozoa. Jens Staal*,1,2,7, Yasmine Driege1,2,7, Alice Borghi1,2,7, Paco Hulpiau1,2,8, Laurens Lievens1,2,7, Ismail Sahin Gul1,2,9, Srividhya Sundararaman1,2,9, Amanda Gonçalves1,2,4, Ineke Dhondt5, Bart P. Braeckman5, Ulrich Technau6 Yvan Saeys1,3,8, Frans van Roy1,2,9 and Rudi Beyaert1,2,7 1 VIB-UGent Center for Inflammation Research, VIB, Ghent, Belgium. 2 Department of Biomedical Molecular Biology, Ghent University, Ghent, Belgium. 3 Department of Respiratory Medicine, Ghent University, Ghent, Belgium. 4 VIB Bio Imaging Core Gent, Ghent, Belgium. 5 Laboratory for Aging Physiology and Molecular Evolution, Biology Department, Ghent University, Ghent, Belgium. 6 Department of Molecular Evolution and Development, Faculty of Life Sciences, University of Vienna, Vienna, Austria. 7 Inflammation Research Center, Unit of Molecular Signal Transduction in Inflammation, VIB, Ghent, Belgium 8 Inflammation Research Center, Unit of Data Mining and Modeling for Biomedicine, VIB, Ghent, Belgium 9 Inflammation Research Center, Unit of Molecular Cell Biology, VIB, Ghent, Belgium * Corresponding author: E-mail: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/046789; this version posted December 29, 2016.
  • Inhibition of Bcl10-Mediated Activation of NF-Jb by Bincard, a Bcl10-Interacting CARD Protein

    Inhibition of Bcl10-Mediated Activation of NF-Jb by Bincard, a Bcl10-Interacting CARD Protein

    FEBS 29030 FEBS Letters 578 (2004) 239–244 Inhibition of Bcl10-mediated activation of NF-jB by BinCARD, a Bcl10-interacting CARD protein Ha-Na Wooa, Gil-Sun Honga, Joon-Il Juna, Dong-Hyung Choa, Hyun-Woo Choia, Ho-June Leea, Chul-Woong Chunga, In-Ki Kima, Dong-Gyu Joa, Jong-Ok Pyoa, John Bertinb, Yong-Keun Junga,* a Department of Life Science, Gwangju Institute of Science and Technology, Buk-gu, Gwangju 500-712, Republic of Korea b Millennium Pharmaceuticals, Inc., Cambridge, MA 02139, USA Received 6 October 2004; accepted 17 October 2004 Available online 17 November 2004 Edited by Robert Barouki ated lymphoid tissue [7]. ASC, apoptosis-associated speck-like Abstract We have identified a novel CARD-containing protein from EST database, BinCARD (Bcl10-interacting protein with protein-containing CARD, is also associated with familiar CARD). BinCARD was ubiquitously expressed. Co-immunopre- Mediterranean fever [8]. cipitation, In vitro binding, mammalian two-hybrid, and immu- Bcl10 (also known as CIPER/c-CARMEN/CLAP/c-E10) nostaining assays revealed that BinCARD interacted with has found to be essential for NF-jB activation in T or B cells Bcl10 through CARD. BinCARD potently suppressed NF-jB [3,9]. Bcl10 (À/À) lymphocytes fail to activate NF-jB in re- activation induced by Bcl10 and decreased the amounts of phos- sponse to CD3, CD3/CD28, and IgM ligation [10]. Several phorylated Bcl10. Mutations at the residue Leu17 or Leu65, CARD family proteins also have been described to drive which is highly conserved in CARD, abolished the inhibitory ef- NF-jB activation through association with Bcl10 [5].
  • The Structure of the Caspase Recruitment Domain of Crystallography Bincard Reveals That All Three Cysteines Can Be ISSN 0907-4449 Oxidized

    The Structure of the Caspase Recruitment Domain of Crystallography Bincard Reveals That All Three Cysteines Can Be ISSN 0907-4449 Oxidized

    research papers Acta Crystallographica Section D Biological The structure of the caspase recruitment domain of Crystallography BinCARD reveals that all three cysteines can be ISSN 0907-4449 oxidized Kai-En Chen,a‡§ Ayanthi A. The caspase recruitment domain (CARD) is present in death- Received 27 November 2012 Richards,b,c‡ Tom T. Caradoc- domain superfamily proteins involved in inflammation and Accepted 16 January 2013 Davies,d Parimala R. Vajjhala,c apoptosis. BinCARD is named for its ability to interact with a Gautier Robin, } Linda H. L. Bcl10 and inhibit downstream signalling. Human BinCARD is PDB References: caspase Lua,d Justine M. Hill,c,e Kate expressed as two isoforms that encode the same N-terminal recruitment domain of BinCARD, native, 4dwn; Schroder,b Matthew J. Sweet,b CARD region but which differ considerably in their C-termini. Both isoforms are expressed in immune cells, although SeMet-labelled, 4fh0 Stuart Kellie,b,c,f* Bostjan BinCARD-2 is much more highly expressed. Crystals of the Kobea,c,f and Jennifer Martina,c* CARD fold common to both had low symmetry (space group P1). Molecular replacement was unsuccessful in this low- aDivision of Chemistry and Structural Biology, symmetry space group and, as the construct contains no Institute for Molecular Bioscience, University of methionines, first one and then two residues were engineered Queensland, Brisbane, Queensland 4072, to methionine for MAD phasing. The double-methionine b Australia, Division of Molecular Genetics and variant was produced as a selenomethionine derivative, which Development, Institute for Molecular Bioscience, University of Queensland, Brisbane, was crystallized and the structure was solved using data Queensland 4072, Australia, cSchool of measured at two wavelengths.
  • Expressing Knowledge About Protein Interactions in Attempto Controlled English

    Expressing Knowledge About Protein Interactions in Attempto Controlled English

    Expressing Knowledge about Protein Interactions in Attempto Controlled English Diploma Thesis in Computer Science submitted by Tobias Kuhn Zurich, Switzerland [email protected] Student ID: 01-711-332 Department of Informatics University of Zurich, Switzerland Prof. Dr. Michael Hess Advisors: Dr. Norbert E. Fuchs (Zurich, Switzerland) Prof. Dr. Michael Schroeder (Dresden, Germany) Date of submission: 5 January 2006 Abstract Scientists are challenged by an ever-increasing number of scientific papers which makes it hard for them to keep track of the relevant literature. A promising solution of this problem is to provide scientists with computational support accessing and evaluating scientific results. A well-known approach is to use natural language processing (NLP) together with the techniques of text mining and summarizing. In this thesis we suggest another approach: the results of scientific papers are summarized by its authors in a formal language, and these formal summaries are added to the papers. In this way we make the results of scientific papers readable and – to some degree – understandable by computers. As formal language we use Attempto Controlled English (ACE) that is a con- trolled natural language [7]. Controlled natural languages combine the natural look and feel of natural languages with the processability of formal languages. This makes them to prime candidates for the formal representation of scientific results. Since they are easy to learn and understand, a researcher has not to spend a lot of time learning a complicated formal language. To demonstrate the practicality of our approach, we build an ontology for protein interactions in ACE and show how scientific results can be expressed using this ontology.
  • Ancient Origin of the CARD–Coiled Coil/Bcl10/MALT1-Like Paracaspase Signaling Complex Indicates Unknown Critical Functions

    Ancient Origin of the CARD–Coiled Coil/Bcl10/MALT1-Like Paracaspase Signaling Complex Indicates Unknown Critical Functions

    ORIGINAL RESEARCH published: 24 May 2018 doi: 10.3389/fimmu.2018.01136 Ancient Origin of the CARD–Coiled Coil/Bcl10/MALT1-Like Paracaspase Signaling Complex Indicates Unknown Critical Functions Jens Staal 1,2*, Yasmine Driege 1,2, Mira Haegman1,2, Alice Borghi 1,2, Paco Hulpiau2,3, Laurens Lievens1,2, Ismail Sahin Gul2,4, Srividhya Sundararaman2,4, Amanda Gonçalves2,5, Ineke Dhondt6, Jorge H. Pinzón7, Bart P. Braeckman6, Ulrich Technau8, Yvan Saeys3,9, Frans van Roy2,4 and Rudi Beyaert 1,2 1 Unit of Molecular Signal Transduction in Inflammation, VIB-UGent Center for Inflammation Research (IRC), Ghent, Belgium, 2 Department of Biomedical Molecular Biology, Ghent University, Ghent, Belgium, 3 Unit of Data Mining and Modeling for Biomedicine, VIB-UGent Center for Inflammation Research (IRC), Ghent, Belgium, 4 Unit of Molecular Cell Biology, VIB-UGent Center for Inflammation Research (IRC), Ghent, Belgium, 5 VIB Bio Imaging Core Gent, VIB-UGent Center for Inflammation Research (IRC), Ghent, Belgium, 6 Laboratory for Aging Physiology and Molecular Evolution, Biology Department, Ghent Edited by: University, Ghent, Belgium, 7 Department of Biology, University of Texas Arlington, Arlington, TX, United States, 8 Department Frederic Bornancin, of Molecular Evolution and Development, Faculty of Life Sciences, University of Vienna, Vienna, Austria, 9 Department of Novartis (Switzerland), Applied Mathematics, Computer Science and Statistics, Ghent University, Ghent, Belgium Switzerland Reviewed by: The CARD–coiled coil (CC)/Bcl10/MALT1-like paracaspase (CBM) signaling complexes Liangsheng Zhang, Fujian Agriculture and Forestry composed of a CARD–CC family member (CARD-9, -10, -11, or -14), Bcl10, and the type 1 University, China paracaspase MALT1 (PCASP1) play a pivotal role in immunity, inflammation, and cancer.
  • Crystal Structure of Caspase Recruiting Domain (CARD) of Apoptosis Repressor with CARD (ARC) and Its Implication in Inhibition of Apoptosis

    Crystal Structure of Caspase Recruiting Domain (CARD) of Apoptosis Repressor with CARD (ARC) and Its Implication in Inhibition of Apoptosis

    OPEN Crystal structure of caspase recruiting SUBJECT AREAS: domain (CARD) of apoptosis repressor NANOCRYSTALLOGRAPHY STRUCTURAL BIOLOGY with CARD (ARC) and its implication in inhibition of apoptosis Received 17 November 2014 Tae-ho Jang1*, Seong Hyun Kim1*, Jae-Hee Jeong2*, Sunghwan Kim3 , Yeon-Gil Kim2{ & Hyun Ho Park1{ Accepted 23 March 2015 1Department of Biochemistry, Yeungnam University, Gyeongsan, 712-749, South Korea, 2Pohang Accelerator Laboratory, Pohang 3 Published University of Science and Technology, Pohang, 790-784, South Korea, New Drug Development Center, Daegu-Gyungpook 3 June 2015 Medical Innovation Foundation, Daegu, 701-310, South Korea. Apoptosis repressor with caspase recruiting domain (ARC) is a multifunctional inhibitor of apoptosis that is Correspondence and unusually over-expressed or activated in various cancers and in the state of the pulmonary hypertension. requests for materials Therefore, ARC might be an optimal target for therapeutic intervention. Human ARC is composed of two distinct domains, N-terminal caspase recruiting domain (CARD) and C-terminal P/E (proline and glutamic should be addressed to acid) rich domain. ARC inhibits the extrinsic apoptosis pathway by interfering with DISC formation. ARC H.H.P. (hyunho@ynu. CARD directly interacts with the death domains (DDs) of Fas and FADD, as well as with the death effector ac.kr) or Y.G.K. domains (DEDs) of procaspase-8. Here, we report the first crystal structure of the CARD domain of ARC at (ygkim76@postech. a resolution of 2.4 A˚ . Our structure was a dimer with novel homo-dimerization interfaces that might be ac.kr) critical to its inhibitory function. Interestingly, ARC did not exhibit a typical death domain fold.
  • Fcγriib Mediates Amyloid-Β Neurotoxicity and Memory Impairment in Alzheimer’S Disease

    Fcγriib Mediates Amyloid-Β Neurotoxicity and Memory Impairment in Alzheimer’S Disease

    FcγRIIb mediates amyloid-β neurotoxicity and memory impairment in Alzheimer’s disease Tae-In Kam, … , Junying Yuan, Yong-Keun Jung J Clin Invest. 2013;123(7):2791-2802. https://doi.org/10.1172/JCI66827. Research Article Neuroscience Amyloid-β (Aβ) induces neuronal loss and cognitive deficits and is believed to be a prominent cause of Alzheimer’s disease (AD); however, the cellular pathology of the disease is not fully understood. Here, we report that IgG Fcγ receptor II-b (FcγRIIb) mediates Aβ neurotoxicity and neurodegeneration. We found that FcγRIIb is significantly upregulated in the hippocampus of AD brains and neuronal cells exposed to synthetic Aβ. Neuronal FcγRIIb activated ER stress and caspase-12, and Fcgr2b KO primary neurons were resistant to synthetic Aβ-induced cell death in vitro.F cgr2b deficiency ameliorated Aβ-induced inhibition of long-term potentiation and inhibited the reduction of synaptic density by naturally secreted Aβ. Moreover, genetic depletion of Fcgr2b rescued memory impairments in an AD mouse model. To determine the mechanism of action of FcγRIIb in Aβ neurotoxicity, we demonstrated that soluble Aβ oligomers interact with FcγRIIb in vitro and in AD brains, and that inhibition of their interaction blocks synthetic Aβ neurotoxicity. We conclude that FcγRIIb has an aberrant, but essential, role in Aβ-mediated neuronal dysfunction. Find the latest version: https://jci.me/66827/pdf Research article FcγRIIb mediates amyloid-β neurotoxicity and memory impairment in Alzheimer’s disease Tae-In Kam,1 Sungmin Song,1 Youngdae Gwon,1 Hyejin Park,1 Ji-Jing Yan,2 Isak Im,3 Ji-Woo Choi,4 Tae-Yong Choi,5 Jeongyeon Kim,6 Dong-Keun Song,2 Toshiyuki Takai,7 3 4 5 6 8 Yong-Chul Kim, Key-Sun Kim, Se-Young Choi, Sukwoo Choi, William L.
  • Étude Des Profils De Méthylation Et D'expression Des Lymphocytes T CD4+ Dans L'asthme

    Étude Des Profils De Méthylation Et D'expression Des Lymphocytes T CD4+ Dans L'asthme

    Étude des profils de méthylation et d'expression des lymphocytes T CD4+ dans l'asthme Mémoire Anne-Marie Boucher-Lafleur Maîtrise en sciences cliniques et biomédicales - avec mémoire de l’Université Laval offert en extension à l’Université du Québec à Chicoutimi Maître ès sciences (M. Sc.) Université du Québec à Chicoutimi Chicoutimi, Canada Médecine Université Laval Québec, Canada © Anne-Marie Boucher-Lafleur, 2019 Étude des profils de méthylation et d’expression des lymphocytes T CD4+ dans l’asthme Mémoire Anne-Marie Boucher-Lafleur Sous la direction de : Catherine Laprise, directrice de recherche RÉSUMÉ L’asthme est une maladie respiratoire chronique impliquant de l’inflammation, de l’hyperréactivité bronchique et un remodelage des voies respiratoires. Il s’agit d’un trait complexe résultant d’interactions entre des facteurs génétiques et environnementaux. La portion génétique de l’asthme a été bien décrite, avec une héritabilité estimée jusqu’à 60% selon les études. Une portion de l’héritabilité manquante dans l’asthme pourrait être expliquée par des facteurs épigénétiques, comme la méthylation de l’ADN. Comme la méthylation est spécifique à chaque tissu, il est logique d’étudier des cellules ayant un rôle important dans l’asthme. C’est le cas des lymphocytes T CD4+ qui contribuent activement à la pathophysiologie de l’asthme. L’objectif du présent projet était donc d’étudier les lymphocytes T CD4+ dans un contexte d’asthme, plus particulièrement leur patron de méthylation ainsi que leur patron d’expression. Ces lymphocytes ont été isolés du sang de plus de 200 individus faisant partie de la Cohorte familiale d’asthme du Saguenay–Lac-Saint-Jean.
  • Card19 (NM 026738) Mouse Tagged ORF Clone – MR216276 | Origene

    Card19 (NM 026738) Mouse Tagged ORF Clone – MR216276 | Origene

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for MR216276 Card19 (NM_026738) Mouse Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Card19 (NM_026738) Mouse Tagged ORF Clone Tag: Myc-DDK Symbol: Card19 Synonyms: 1110007C09Rik; AI851695; Bincard Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >MR216276 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGACAGATCAGACCTACTGTGACCGGCTGGTACAGGACACTCCTTTCCTGACGGGACAGGGTCGCCTGA GCGAGCAACAAGTGGACAGGATCATCCTCCAGCTGAACCGTTACTACCCACAGATCCTTACCAACAAGGA GGCTGAAAAGTTCCGGAACCCCAAGGCATCCCTGCGCGTACGGCTCTGTGACCTCCTGAGCCATCTACAG CAGCGTGGGGAACGGCACTGTCAGGAATTTTACCGAGCTCTGTACATCCATGCCCAGCCCCTGCACAGCC ACCTGCCCAGCCGCTACTCTCCTCAAAACTCAGATTGCAGAGAGCTGGACTGGGGCATCGAGAGCCGTGA GCTGAGTGACAGGGGACCCATGAGCTTCCTGGCAGGCCTGGGCCTGGCAGCGGGCCTGGCCCTCCTCCTC TACTGCTGCCCTCCAGACCCCAAAGTGCTGCCCGGAACCCGGCGCGTCCTTGCCTTCTCACCTGTCATCA TTGACCGGCATGTCAGCCGCTACCTGCTGGCTTTCCTGGCAGATGACCTCGGAGGACTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >MR216276 protein sequence Red=Cloning site Green=Tags(s) MTDQTYCDRLVQDTPFLTGQGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQ QRGERHCQEFYRALYIHAQPLHSHLPSRYSPQNSDCRELDWGIESRELSDRGPMSFLAGLGLAAGLALLL
  • Gene Expression in Ovarian Carcinoma and Correlation with Prognostic Factors and Survival

    Gene Expression in Ovarian Carcinoma and Correlation with Prognostic Factors and Survival

    Gene expression in ovarian carcinoma and correlation with prognostic factors and survival A study of mRNA and miRNA profiling and differentiality Bente Vilming Elgaaen, MD Department of Gynaecological Oncology, Women and Children's Division, Oslo University Hospital, The Norwegian Radium Hospital Oslo, Norway Department of Medical Biochemistry, Division of Diagnostics and Intervention, Oslo University Hospital, Ullevaal Oslo, Norway Faculty of Medicine, University of Oslo, Oslo, Norway PhD thesis 2013 © Bente Vilming Elgaaen, 2014 Series of dissertations submitted to the Faculty of Medicine, University of Oslo No. 1718 ISBN 978-82-8264-786-1 All rights reserved. No part of this publication may be reproduced or transmitted, in any form or by any means, without permission. Cover: Inger Sandved Anfinsen. Printed in Norway: AIT Oslo AS. Produced in co-operation with Akademika Publishing. The thesis is produced by Akademika Publishing merely in connection with the thesis defence. Kindly direct all inquiries regarding the thesis to the copyright holder or the unit which grants the doctorate. TABLE OF CONTENTS 1. ACKNOWLEDGEMENTS .............................................................................................. 5 2. LIST OF PAPERS ............................................................................................................. 7 3. ABBREVIATIONS ........................................................................................................... 9 4. INTRODUCTION ..........................................................................................................