Packers Communications l Lambeau Field Atrium l 1265 Lombardi Avenue l Green Bay, WI 54304 920/569-7500 l 920/569-7201 fax Jason Wahlers, Sarah Quick, Tom Fanning, Nathan LoCascio VOL. XXII; NO. 14 REGULAR-SEASON WEEK 12 GREEN BAY (7-3) WITH THE CALL VS. CHICAGO (5-5) NBC will broadcast the game to a national audi- Sunday, Nov. 29, 7:20 p.m. CST ence. Play-by-play man Mike Tirico joins analyst Lambeau Field Tony Dungy with Kathryn Tappen reporting from the sidelines. PACKERS AND BEARS RENEW RIVALRY u Milwaukee’s WTMJ (620 AM), airing Green Bay games The Green Bay Packers will take on the Chicago Bears on since November 1929, heads up the Packers Radio Sunday Night Football, marking the 15th consecutive regu- Network that is made up of 50 stations in four states. lar season that the Packers and Bears have squared off in Wayne Larrivee (play-by-play), two-time Packers primetime, the longest streak in the NFL since the merger Pro Bowler Larry McCarren (analyst) and three-time (Elias Sports Bureau). Packers Pro Bowler and two-time All-Pro u Sunday will mark Game No. 201 in the NFL’s oldest John Kuhn rivalry. The Packers hold a 99-95-6 edge in the series, (sideline) will call the action. McCarren first joined the which includes two playoff games (1-1). team’s broadcasts in 1995 and enters his 25th season u Green Bay has won 10 of the last 12 meetings against calling Packers games. After originally being paired the Bears at Lambeau Field. together in 1999, McCarren and Larrivee enter their 22nd u The Packers have outscored Chicago, 320-170, in the season of broadcasts together. They surpassed Jim last 12 home games, scoring 20-plus points in 10 of Irwin and Max McGee for the most regular-season and those contests. postseason games broadcast for the Packers with 313 at u It is the ninth time in the last 10 years that the Packers- the 2018 season opener against Chicago. Bears game at Lambeau Field will be played in primtime. u The broadcast is also available on Sirius Satellite Radio u Last season, Green Bay swept the regular-season series between the two teams for the 15th time in the last 26 (WTMJ feed), WTMJ.com via desktop computer and on years (since 1994) and the seventh time in the last 11 numerous devices through NFL Game Pass. seasons. u Westwood One Sports will air the game on radio across u Each of the last four matchups between the two teams the country. Ryan Radtke (play-by-play) and James has been decided by eight points or less. Laurinaitis (analyst) will call the action with Scott u It is the third and final home game in November, the Graham hosting the pregame and halftime shows. most for Green Bay in the month of November since 2014. REGULAR SEASON u Green Bay will finish the regular season with four of its Date Opponent Time (CT) TV/Att. last six games at home for the first time since 1977. Sun., Sept. 13 at Minnesota Vikings W, 43-34 0 u The Packers have won 12 of their last 15 regular-season Sun., Sept. 20 DETROIT LIONS W, 42-21 0 games. Sun., Sept. 27 at New Orleans Saints W, 37-30 748 Mon., Oct. 5 ATLANTA FALCONS W, 30-16 0 RODGERS AND THE BEARS Sun., Oct. 11 BYE u With Aaron Rodgers as the starting quarterback, Sun., Oct. 18 at Tampa Bay Buccaneers L, 10-38 15,540 Green Bay is 19-5 (including playoffs) against the Bears, Sun., Oct. 25 at Houston Texans W, 35-20 12,618 with one loss coming in 2013 after Rodgers left the Sun., Nov. 1 MINNESOTA VIKINGS L, 22-28 0 game with an injury after the first series. Thu., Nov. 5 at San Francisco 49ers W, 34-17 0 u In the 24 games against Chicago, Rodgers has an overall Sun., Nov. 15 JACKSONVILLE JAGUARS W, 24-20 0 passer rating of 102.1. Sun., Nov. 22 at Indianapolis Colts L, 31-34 (OT) 12,495 u Of the players that have attempted 250 or more passes against the Bears (including playoffs), Rodgers’ 102.1 Sun., Nov. 29 CHICAGO BEARS 7:20 p.m. NBC Sun., Dec. 6 PHILADELPHIA EAGLES *3:25 p.m. CBS passer rating is No. 1 in league history (No. 2 - Drew Brees, 97.1). Sun., Dec. 13 at Detroit Lions *12 p.m. FOX u Rodgers has posted a 100-plus passer rating in 10 Sat., Dec. 19 CAROLINA PANTHERS 7:15 p.m. NFLN matchups (min. 15 pass att.) and the Packers are 10-0 in Sun., Dec. 27 TENNESSEE TITANS *7:15 p.m. NBC those contests. Rodgers trails Pro Football Hall of Famer Sun., Jan. 3 at Chicago Bears *12 p.m. FOX Brett Favre (11) for the most 100-plus passer-rating *—Start time and broadcast may shift due to NFL flexible scheduling games (min. 15 pass att.) against the Bears since 1950 (stathead.com). NFL POSTSEASON DATES u Rodgers has six games with a passer rating of 125-plus Jan. 9-10 AFC and NFC Wild Card Playoffs against the Bears, the most by any QB against the Bears Jan. 16-17 AFC and NFC Divisional Playoffs in NFL history (min. 15 att.). Rodgers has three more Jan. 24 AFC and NFC Championship Games than any other QB. Feb. 7 Super Bowl LV, Raymond James Stadium, Tampa Bay HEAD COACH MATT LAFLEUR
LAFLEUR LEADS THE PACK u LaFleur joined Jim Caldwell and Steve Mariucci as the Green Bay Packers Head Coach Matt LaFleur (la-flew-er) only head coaches with 13-plus wins to go undefeated is in his second season and building off the success he in their division in their first season. guided the team to in Year 1. u LaFleur tied for the third-most wins by an NFL head u Dating back to 2019, the Packers are tied for the third coach in their first season: best regular-season record in the NFL: Regular-Season Head Coach, First Season Record Regular-Season 1t. Jim Caldwell, IND, 2009 14-2 Team Record (Since 2019) 1t. Kansas City 21-5 (.808) 1t. George Seifert, SF, 1989 14-2 1t. New Orleans 21-5 (.808) 3t. Matt LaFleur, GB, 2019 13-3 3t. Jim Harbaugh, SF, 2011 13-3 3t. Green Bay 20-6 (.769) 3t. Baltimore 20-6 (.769) 3t. Steve Mariucci, SF, 1997 13-3 5t. Pittsburgh/Seattle 18-8 (.692) u LaFleur became the first coach in franchise history to lead his team to a division title in his first season. u LaFleur led Green Bay to a 20-5 record in his first 25 u LaFleur guided Green Bay to a 6-0 record in the NFC regular-season games, which is tied for No. 4 in NFL North. Dating back to 1967, it was just the second time history for the most wins by a head coach in his first (6-0 in 2011) that Green Bay had gone undefeated in 25 regular-season games (Elias Sports Bureau): division games. u Wins in First 25 Dating back to 2002 when the NFC North was formed, the Packers are the only team to go undefeated in the Head Coach Regular-Season Games 1. George Seifert, 1989-90 23 division in a single regular season (2019, 2011). u While LaFleur was the first Packer head coach to lead 2t. Paul Brown, 1946-47 22 his team to the postseason in his first year, he was the 2t. Guy Chamberlin, 1922-23 22 fourth consecutive head coach to win his first postsea- 4t. Matt LaFleur, 2019-20 20 son game. The other three head coaches to win their first 4t. Seven others 20 playoff game led Green Bay to the postseason in their second seasons (Mike McCarthy, Mike Sherman and u Dating back to 2019 (including playoffs), LaFleur has led Mike Holmgren). the Packers to a 12-3 record in games decided by single u Dating back to 1970, LaFleur joined McCarthy as the only digits, an .800 winning percentage that ranks No. 1 in head coaches in franchise history to lead their teams to the NFL over that span (Sportradar). the NFC Championship Game in their first appearance in u LaFleur became the first Packer head coach to start both the postseason. of his first two seasons 3-0. u LaFleur became the first head coach to reach a con- u LaFleur joined Phil Bengston (1968-69) as the only head ference championship in his first season since Jim coaches in franchise history to win the season opener in Harbaugh led San Francisco to the NFC Championship their first two seasons. Game in 2011. u LaFleur led the biggest one-year win improvement in u LaFleur is the first head coach in franchise his- franchise history last season: tory to win seven of his first eight NFL games and the first to win his first three road NFL contests. Seasons Win Improvement u LaFleur is the 19th NFL head coach and the first 1. 2018 (6) to 2019 (13) +7 since Jim Harbaugh in 2011 to win at least seven 2t. 1928 (6) to 1929 (12) +6 of his first eight games (Elias Sports Bureau). 2t. 1958 (1) to 1959 (7) +6 u He joined Vince Lombardi (3-0) as the only head 2t. 1971 (4) to 1972 (10) +6 coaches in franchise history to win their first three 2t. 1988 (4) to 1989 (10) +6 NFL games. u It was the first time since 2015 and just the third time u LaFleur (13-3) finished with the most NFL wins by a (2011) in the last 12 seasons that Green Bay has started Packer head coach in their first season: 3-0. u According to the Elias Sports Bureau, LaFleur joined Regular-Season John Harbaugh (2008) and Don Coryell (1973) as the Head Coach, 1st Season Record only head coaches since the merger (1970) to 1. Matt LaFleur, 2019 13-3 win each of their first two games, both against divisional 2t. Mike Holmgren, 1992 9-7 opponents. 2t. Mike Sherman, 2000 9-7 u With a win at Chicago in Week 1 of 2019, LaFleur became 4t. Forrest Gregg, 1984 8-8 the sixth head coach in franchise history to win 4t. Mike McCarthy, 2006 8-8 his first game, joining Curly Lambeau, Vince Lombardi, 4t. Ray Rhodes, 1999 8-8 Phil Bengston, Forrest Gregg and Ray Rhodes. He joins Lombardi as the only Packers head coaches to beat the 7. Vince Lombardi, 1959 7-5 Bears in their first game. u LaFleur became only the second u LaFleur led Green Bay to seven home wins, the most : coach to make his head-coach- by a Packers head coach in his first season ing debut in the NFL’s prime- Head Coach, First Season Home Record time kickoff game (since 2002), joining Jim Zorn, who made his 1. Matt LaFleur, 2019 7-1 2t. Mike Holmgren, 1992 6-2 debut with Washington in a los- ing effort against the New York 2t. Mike Sherman, 2000 6-2 Giants (16-7) in 2008.
Two years after he co-founded the Packers with Curly Lambeau, George Calhoun began writing a piece called The Dope Sheet, which served as the official press release from 1921-24. 2 HOME SWEET HOME u QB Aaron Rodgers ranks in the top five in the NFL in Green Bay has a long tradition of playing well at Lambeau passer rating at home this season (min. 50 pass att.): Field, and it has continued this season, as it is one of 10 NFL teams with one or fewer losses at home in 2020. Passer Rating u Dating back to 2019, the Packers are 10-2 at home dur- Player At Home (2020) ing the regular season, a .833 winning percentage that 1. Russell Wilson, SEA 127.3
is No. 1 in the NFL over that span. Green Bay’s two 2. Aaron Rodgers, GB 119.3 3. Ryan Tannehill, TEN 117.7 losses are the fewest at home in the NFL since 2019. 4. Patrick Mahomes, KC 117.2 Team Record At Home (Since 2019) Pct.
1. Green Bay 10-2 .833 u Rodgers has started 90 home games during the regular 2. New Orleans 11-3 .786 season for Green Bay, with the Packers holding a 71-18- 3. Pittsburgh 10-3 .769 1 record in those contests. He has completed 2,019 of 4. L.A. Rams 9-3 .750 3,055 passes (66.1 pct.) for 24,496 yards (272.2 per 5t. Five teams 9-4 .692 game), 206 touchdowns, 36 interceptions and a passer u The Packers’ 7-1 record at home in 2019 was their best rating of 108.1. since finishing 8-0 in 2014. u Rodgers ranks No. 1 in the NFL since 1950 in passer u Green Bay has 236 victories at Lambeau Field, the most rating at home as a starter (min. 500 pass att.), accord- home wins by any franchise at one stadium in NFL his- ing to Sportradar: tory. u Green Bay has won 16 of the last 19 games it has played Passer Rating against an AFC team at Lambeau Field. Player At Home (Since 1950) u Green Bay has won eight straight home openers (2013- 1. Aaron Rodgers, GB 108.1 20), further extending the longest streak in team history. 2. Patrick Mahomes, KC 108.0 Since 2007, the Packers are 13-1 in their first game of 3. Deshaun Watson, HOU 107.6 the season at Lambeau Field. 4. Russell Wilson, SEA 105.2 u Green Bay ranks in the top 10 in the NFL in points per 5. Drew Brees, SD/NO 104.0 game and point differential at home this season: u Rodgers has led Green Bay to a 20-4-1 record in his last Points Per Game 25 starts at home, recording a passer rating of 100-plus Team At Home (2020) in 14 of those games, including the first perfect passer 1. Pittsburgh 33.2 rating (158.3) of his career in a Week 7 win over Oakland 2. Seattle 33.0 last season. 3. Kansas City 32.0 u RB Aaron Jones has played in 22 home games in his 4. Arizona 30.6 career and has scored 23 touchdowns (20 rushing and 5. Tennessee 30.3 three receiving). 6. Minnesota 29.8 u Jones ranks in the top five in the NFL in both rushing 7. Green Bay 29.5 TDs and total TDs at home since 2017 (Sportradar):
Point Differential/Game Rushing TDs Team At Home (2020) 1. Pittsburgh 15.6 Player At Home (Since 2017) 1. Todd Gurley, LAR/ATL 24 2. Kansas City 10.0 2. Derrick Henry, TEN 23
3. Green Bay 8.3 3. Aaron Jones, GB 20 u Green Bay ranks No. 10 in the NFL this season in 4t. Dalvin Cook, MIN 17 points allowed per game at home (21.3). 4t. Christian McCaffrey, CAR 17 u Green Bay has given up four sacks at home this sea- son, tied for the second fewest in the NFL. The Total TDs Packers’ average of one sack allowed per home game is Player At Home (Since 2017) 1. Todd Gurley, LAR/ATL 27 No. 3 in the league. Green Bay tied for No. 5 in the 2. Christian McCaffrey, CAR 25 NFL in sacks allowed at home (12) in 2019. u Green Bay has finished with a record of .500 or better at 3t. Derrick Henry, TEN 24 home in each season from 2007-19: 3t. Alvin Kamara, NO 24 5. Aaron Jones, GB 23 Season Home Record 2020 3-1 u LB has five sacks in four home 2019 7-1 Za’Darius Smith games this season and is tied for the sixth-most 2018 5-2-1 sacks at home in the NFL. 2017 4-4 u Since 2007, Green Bay ranks No. 2 in the NFL at 2016 6-2 home during the regular season: 2015 5-3 2014 8-0 Record At 2013 4-3-1 Team Home (Since 2007) Pct. 2012 7-1 1. New England 93-16 .853 2011 8-0 2. Green Bay 81-25-2 .759 2010 7-1 3. Pittsburgh 80-29 .734 2009 6-2 4. Baltimore 78-31 .716 2008 4-4 5. Seattle 75-34 .688 2007 7-1 33 DIVISION DOMINANCE u The Packers scored 43 points at Minnesota in Week 1 u Green Bay started off the 2020 season with continued and 42 points versus Detroit in Week 2 this season. It success in the NFC North, winning two of its first three was only the third time Green Bay has scored 40-plus games against division foes. points in back-to-back divisional games (1984, 2014). u Green Bay’s eight-game divisional winning streak ended Dating back to 2002, it was the sixth-most points and in Week 8 this year, but it tied for the second tied for the seventh-most points Green Bay has scored longest for the franchise since the league went to a in a division game: divisional format in 1967: Point Scored In A Divisional Year/Opp. NFC North Game (Since 2002) Seasons Winning Streak 1. 2014 vs. Chicago 55 1. 2010-12 12 2. 2008 at Detroit 48 2t. 2019-20 8 3t. 2011 vs. Detroit 45 2t. 1996-97 8 3t. 2011 vs. Minnesota 45 2t. 2001-02 8 5. 2013 at Minnesota 44 5. 1997-98 7 6. 2020 at Minnesota 43 7t. 2020 vs. Detroit 42 u In 2019, the Packers clinched their 24th division title and 7t. 2014 vs. Minnesota 42 first since 2016. 9. 2002 vs. Detroit 40 u Matt LaFleur was the first head coach in team history to lead the Packers to a division title in his first season. u QB Aaron Rodgers ranks No. 5 in the NFL (min. 50 u It was the sixth division title Green Bay has won with pass att.) with a passer rating of 119.7 in division games Aaron Rodgers as the starting quarterback. this season (Sportradar). u LaFleur is one of four head coaches to debut in the Super u WR Davante Adams has five receiving TDs in three Bowl era to win his first eight divisional games with a division games to lead the NFL this season: team. All coaches listed below were in their first career head-coaching positions (via the Elias Sports Bureau): Receiving TDs Against Player Division Opp. (2020) Divisional Wins 1. Davante Adams, GB 5 In a Row To Start 2t. Tyler Lockett, SEA 4 Head Coach Head-Coaching Career 2t. D.J. Moore, CAR 4 1. Steve Mariucci, SF, 1997-98 12 2t. Adam Thielen, MIN 4 2. Chan Gailey, DAL, 1998-99 10 3. Raymond Berry, NE, 1984-85 9 u RB Aaron Jones registered five rushing TDs against 4. Matt LaFleur, GB, 2019-20 8 division opponents last year, the most by a Packer since 5t. Jim Haslett, NO, 2000 7 Ahman Green in 2003 (six) and tied for No. 4 in the 5t. Barry Switzer, DAL, 1994 7 NFL in 2019. Jones has three rushing TDs in three NFC North games this season (tied for No. 5 in the NFL) uDating back to 1995, the Packers have the second- and his eight since the start of last season are tied for : most division titles in the NFL No. 4 in the NFL: Team Division Titles (Since 1995) 1. New England 19* Rushing TDs Against Player Division Opp. (2019-20) 2. Green Bay 13* 1. Dalvin Cook, MIN 12 3. Pittsburgh 12 2. Derrick Henry, TEN 10 4. Indianapolis 10 3. Josh Jacobs, LV 9 5t. Philadelphia 9*
5t. Seattle 9 4t. Aaron Jones, GB 8 4t. Todd Gurley, LAR/ATL 8 7t. Dallas 8 7t. Denver 8 u LB Za’Darius Smith recorded a sack in two of the 7t. Kansas City 8* three division games this season and has 5.5 sacks in *2019 Division Champion his last four NFC North games. Smith is tied for No. 5 against division opponents since 2019: u The Packers finished with a 6-0 division record in 2019 in sacks for just the second time (2011) since 1967. Sacks Against u Green Bay joined Kansas City (6-0) as the only teams to Player Division Opp. (2019-20) be undefeated in division games during the 2019 regular 1. Cameron Jordan, NO 10.5 season. 2. Bud Dupree, PIT 9.5 u From 2011-19, the Packers were one of four NFL 3t. Shaquil Barrett, TB 9.0 teams (Denver, Indianapolis, Kansas City) to go unde- 3t. T.J. Watt, PIT 9.0 feated in division games in two seasons. 5t. Za’Darius Smith, GB 7.5 u Green Bay allowed the third-fewest points in division 5t. Chandler Jones, ARI 7.5 games in the NFL in 2019 (84). Dating back to 2002 u Dating back to 2019, the Packers have 25 sacks against when the NFC North was formed, 2019 marked the third NFC North teams, the most among teams in the time that the Packers gave up less than 100 points to division opponents in a single season (83 in 2010 and NFC North division over that time span (Minnesota, 90 in 2006): 22.0 / Chicago, 18.0 / Detroit, 12.0). u With a Week 17 win at Detroit last season, the Packers Points Allowed In became the third NFL team with 100 regular-season wins Season Division Games (2002-19) against one opponent (Chicago, 101 vs. Detroit and New 1. 2010 83 York Giants, 102 vs. Washington). 2. 2019 84 3. 2006 90 4 QB LONGEVITY INDIVIDUAL HISTORY IN 2020 u QB Aaron Rodgers played in his 191st regular-season u QB Aaron Rodgers’ 29 TD passes on the season game in Week 11, moving into the top five for the most are the second most in team history through 10 games games played in franchise history: behind only the 31 TD passes he threw in 2011. u Rodgers (29/4 in 2020, 28/3 in 2014 and 31/4 in 2011) Packer Games Played and Tom Brady (38/4 in 2007) are the only QBs since 1. Brett Favre, 1992-2007 255 1950 to throw 28-plus TD passes with four or fewer 2. Mason Crosby, 2007-20 218 INTs in a team’s first 10 games of a season (stathead. 3. Donald Drive, 1999-2012 205 com). 4. Bart Starr, 1956-71 196 u Rodgers has nine games with at least two TD passes 5. Aaron Rodgers, 2005-20 191 and a rating of 100-plus this season, marking the third 6. Ray Nitschke, 1958-72 190 time, second by Rodgers (10 games in 2011), that a quarterback has done so in at least nine u The 642 combined games played between Favre/Starr/ of his first 10 games of a season in NFL history Rodgers are the most by a club’s QB trio in NFL (Tom Brady, nine games in 2007). history, and the Packers are the only team in the NFL to u Rodgers joined Russell Wilson (four games - 2020), have three different QBs play in 175-plus career games Patrick Mahomes (five games - 2018) and Peyton for that franchise: Manning (four games - 2012) as the only NFL play- ers since 1950 to record a four-plus passing touch- Team QBs Games Played down game four or more times in a team’s first eight 1. Green Bay Favre (255) 642 games of a season (stathead.com). Starr (196) u Rodgers’ 78-yard TD pass in Week 10 against Rodgers (191) Jacksonville was his 19th career TD pass of 70-plus 2. Miami Marino (242) 566 yards, which tied Saints QB Drew Brees for the most in Strock (163) NFL history. Griese (161) u Rodgers’ 5-yard TD run against the Jaguars was his 3. L.A./S.D. Rivers (228) 563 29th career rushing TD, which matched Tobin Rote’s Fouts (181) franchise mark among quarterbacks. Hadl (154) u WR Davante Adams is on a run of five straight 4. N.Y. Giants Manning (236) 561 games with seven-plus catches and a TD, becoming the Simms (164) fourth player in NFL history with at least seven Conerly (161) receptions and a TD catch in five consecutive games, 5. New England Brady (285) 558 joining Pro Football Hall of Famer Cris Carter (1999), T.J. Grogan (149) Houshmanzadeh (2007) and Adam Thielen (2018). Bledsoe (124) u Adams is the first player in NFL history to post 65-plus receptions (68), 800-plus receiving yards (847) and 10-plus receiving TDs (10) in his first eight games. SOME TEAM HISTORY THIS SEASON u Adams (499) ranks No. 5 spot in team history for The Packers set some all-time marks with their performance career receptions, trailing James Lofton (530) for the so far this season. No. 4 spot. He (54) passed WR Greg Jennings (53) for u The 308 points scored by Green Bay this season are No. 6 in franchise history in receiving TDs and is tied with 1962 for the fourth most through 10 three behind Antonio Freeman (57) for No. 5 in franchise games in team history behind only 2011 (355), history. 2014 (330) and 1961 (309). u Adams (three) and Minnesota WR Adam Thielen (four) u Green Bay joined the 2007 Patriots as the only NFL are the only players in the league this season teams since 1980 to score on their opening drive on to have at least three games with two-plus TD catches. each of the first eight games of the season (Elias Sports Since 1950, Adams joins Billy Howton (1956), Freeman Bureau). (1998) and James Jones (2012) as the only Packers u The Packers have scored 30-plus points in seven of to have three games with two-plus TD receptions in the team’s first 10 games of the season. 10 games this season, (1963 and tied for the most u For the first time in franchise history, Green Bay has 2011) by Green Bay in its first 10 games since 1940 had three different players (RB in Week (stathead.com). Aaron Jones 2, Adams in Week 8, TE Robert Tonyan in Week 4) u Green Bay was the first team in NFL history to score 150- register three TDs in a game in the same season. plus points with no turnovers in the first four games of a u WR Marquez Valdes-Scantling has registered a season. reception of 45-plus yards in three straight games u The Packers scored 152 points in the first four contests, (Weeks 9-11), tying Max McGee (1958-59) and James the most in team history through four games since Lofton (1984) for third-longest streak by a Packer since Green Bay joined the NFL in 1921 (previous high was 1950 (Elias Sports Bureau). 148 in 2011). u Valdes-Scantling has 14 receptions for 40-plus yards in u Green Bay posted four consecutive games with 30-plus his career, marking the second-most 40-yard recep- points and no turnovers (Weeks 1-4) for just the sec- tions by a Packer in their first three seasons (WR Greg ond time in franchise history (Weeks 14-17 in 2016). Jennings, 17) over the last 40 seasons. u TE became the fourth Packer TE since According to the Elias Sports Bureau, it tied for the Robert Tonyan 1950 to register six or more receiving TDs in the team’s second-longest streak in the NFL since turnovers were first 10 games of the season, joining Paul Coffman first tracked in 1933 (2010 New England Patriots did it (1983-84) and keith Jackson (1996) and Bubba Franks in seven straight games). (2001).
55 OFFENSE AMONG THE BEST u Green Bay is one of only three teams (Pittsburgh-four, The Packers rank near the top of the league in numerous Seattle-three) to have at least three different play- offensive categories. They are one of three teams to average ers (WR Davante Adams, TE Robert Tonyan, 30-plus points per game this season: WR Marquez Valdes-Scantling) with four-plus TD catches this season. Team Points Per Game u 1. Seattle 32.1 Valdes-Scantling the only player in the NFL in 2. Kansas City 31.8 2020 with three TD catches of 40-plus yards (45, 52, 3. Green Bay 30.8 78) and has a league-high five receptions of 40-plus 4. Pittsburgh 29.8 yards. Among players with 25-plus receptions, Valdes- 5. New Orleans 29.5 Scantling ranks No. 1 in the NFL in yards per catch (20.7 avg.) this season. Team 40-Point Games u Green Bay has scored 28 touchdowns on 38 red-zone
1t. Green Bay 2 drives, TDs on red-zone 1t. Tampa Bay 2 tied for the third-most 1t. Tennessee 2 drives in the NFL, and its red-zone drive-TD percentage 3t. Eight teams 1 of 73.7 ranks No. 4 in the league this season. u The Packers rank No. 2 in the NFL in offensive points u Dating back to 1940, Green Bay is tied for the sixth-most scored on drives started in the final two minutes of the 40-plus point games it has recorded in a single season. half and game (55), and are No. 1 in the league with In 2011, the Packers registered the most with six (pro- seven passing TDs, according to Sportradar. football-reference.com). u The Packers have scored points on their first drive in u Green Bay ranks in the top 10 in the NFL in total eight games this season (four field goals, four TDs), yards per game (392.9, No. 7), yards per play (6.25, No. leading the NFL with 40 points scored on opening 3), passing yards per game (277.0, No. 6) and passing drives this year (Sportradar). yards per play (7.87, No. 3), as well as: u The Packers are one of 15 NFL teams to have a positive points per game differential, and their plus-5.0 point dif- Team Avg. Time of Possession ferential per game ranks No. 9 in the league. 1. Green Bay 32:27 2. Pittsburgh 32:10 u The Packers’ average field position after kickoffs is 26.5 3. L.A. Chargers 32:04 this season, ranking No. 10 in the NFL. 4. Cincinnati 32:02 5. L.A. Rams 31:56 DEVELOPING DEFENSE Green Bay’s defense has developed as the season has Team 30-Point Games progressed.
1t. Green Bay 7 u 1t. Kansas City 7 The Packers have limited the big plays, ranking in the 1t. Seattle 7 top five in the NFL in plays allowed of 20 or more yards 4t. Arizona 6 (Sportradar): 4t. Las Vegas 6 20-Plus Yard Team 3rd-Down Pct. Team Plays Allowed 1. Las Vegas 51.61% 1. L.A. Rams 20 2. Kansas City 50.41% 2t. Cleveland 31 3. Buffalo 50.00% 2t. N.Y. Giants 31
4. Green Bay 47.90% 4t. Green Bay 33 5. New Orleans 46.92% 4t. Indianapolis 33 4t. Washington Football Team 33 u The Packers have given up one sack/zero sacks in u Green Bay is tied for No. 5 in the NFL in games hold- nine games this year, the most by an NFL team ing opponents to 21 points or less this season (stathead. through 10 games since 2008 (Denver, New com): Orleans, Tennessee). Games Allowing u Green Bay ranks in the top five in both sacks allowed Team 21 Or Less Points and sacks/pass attempt this season: 1t. Kansas City 7 Team Sacks Allowed 1t. Miami 7 1t. Indianapolis 10 1t. Pittsburgh 7 1t. Pittsburgh 10 4. L.A. Rams 6 3. Green Bay 12 5t. Green Bay, five others 5 4t. Kansas City 13 u 4t. L.A. Rams 13 The Packers are 5-0 when holding their opponents to 21 points or less. Team Sacks Per Pass Attempt u Green Bay ranks in the top half of the league in: 1. Pittsburgh 2.60% total yards per game (No. 12, 344.3), sacks per pass 2. Indianapolis 2.82% attempt (No. 14, 6.56%), third-down percentage (No. 3. Kansas City 3.40% 12, 39.47%). 4. Green Bay 3.41% 5. Tampa Bay 3.46% 6 THE DOPE ON NOTABLE CONNECTIONS Packers S Adrian Amos was drafted by Chicago in 2015 and played THIS WEEK’S with the Bears for four seasons (2015-18)…Bears TE Jimmy Graham OPPONENT: played for the Packers for two seasons (2018-19)…Bears OL Jason Spriggs was drafted by the Packers in 2016 and spent four seasons Packers vs. Bears: (2016-19) with the team…Green Bay players with connections to Regular season, all-time: 98-94-6 Illinois include: DL Dean Lowry (Rockford, Northwestern), DL Tyler All-time, Postseason: 1-1 Lancaster (Plainfield, Northwestern), TE Robert Tonyan (McHenry)… All-time, at home: 49-42-4 (28-20-0 at Lambeau Field) Bears assistant wide receivers/offensive quality control coach Chris Streaks: The Packers are 16-4 against Chicago in 20 regular- Jackson appeared in two games for the Packers at wide receiver during season meetings since the start of the 2010 season the 2002-03 seasons…Bears Bill Walsh coaching fellow Henry Burris Last meeting, regular season: was a backup quarterback for the Packers during the 2001 season… Dec. 15, 2019, Lambeau Field, Packers won, 21-13 Bears TE Demetrius Harris played basketball at the University of Wisconsin - Milwaukee for two seasons (2011-13)…LB Za’Darius Smith (2015-18), T Rick Wagner (2013-16) and Bears DB Brent Urban COACHES CAPSULES (2014-18) played together for the Ravens…Wagner also played with Matt LaFleur: 21-6-0, .778; (1-1 postseason); 2nd NFL season Bears LS Patrick Scales for Baltimore in 2014…Bears offensive line Matt Nagy: 25-17-0, .595 (0-1 postseason); 3rd NFL season coach Juan Castillo held the same position in Baltimore from 2013-16 Head to Head: LaFleur 2-0 vs. Nagy when Smith and Wagner were on the roster…Castillo was an offensive vs. Opponent: LaFleur 2-0 vs. Packers; Nagy 1-3 vs. Packers analyst at Michigan in 2019 while Packers G Jon Runyan played for the school…Bears quarterbacks coach John DeFilippo served as the MATT LaFLEUR…In his second season as the Packers’ 15th quarterbacks coach/offensive coordinator at San Jose State in 2011 head coach. when Packers RB Tyler Ervin played for the team…Packers assistant u In his 12th season in the NFL, having previously served as an offensive line coach Luke Butkus is from Bloom Township, Illinois, and offensive coordinator for two seasons (Los Angeles Rams, 2017; attended the University of Illinois…Butkus was signed as a rookie free Tennessee Titans, 2018), a quarterbacks coach for six seasons agent by the Bears in 2002 and is the nephew of Hall of Fame linebacker (Washington Redskins, 2010-13; Atlanta Falcons, 2015-16), and Dick Butkus…Butkus was also the offensive line coach at his alma an offensive assistant for two seasons (Houston Texans, 2008-09). mater (2012, 2016-18) and served as the Bears’ assistant offensive line coach from 2007-09…Packers S Will Redmond was coached by Bears u In his first season leading the Packers in 2019, because the first secondary coach Deshea Townsend at Mississippi State from 2013-15… coach in club history to lead the team to the playoffs in his debut Packers special teams quality control coach Rayna Stewart served as a season. Also led the largest one-year win improvement in team graduate assistant at Northwestern from 2007-08...Chicago assistant history (plus-seven wins). offensive line coach Donovan Raiola played for the Wisconsin Badgers u Became only the fifth coach in NFL history to win 13-plus regular- from 2002-05...Packers defensive quality control coach Wendel Davis season games in his first season as a head coach (Jim Caldwell, coached Bears LB Roquan Smith while serving as a defensive graduate George Seifert, Jim Harbaugh, Steve Mariucci). assistant at Georgia during the 2016-17 seasons…Packers special u Guided the Titans’ offense in 2018 to a No. 7 league ranking in teams coordinator Shawn Mennenga (2011-17), assistant defensive rushing (126.4 ypg) as Tennessee registered 11 games with 100- backs coach Ryan Downard (2014-15), LB Christian Kirksey (2014-19), plus rushing yards, tied for No. 2 in the NFL. DL Billy Winn (2012-15) and Bears DB Tashaun Gipson Sr. (2012-15), u Helped the Rams lead the league in scoring with an average of 29.9 LB Barkevious Mingo (2013-15), DB Buster Skrine (2011-14), special points per game in 2017, more than doubling their average from teams coordinator Chris Tabor (2011-17) and DeFilippo (2015) all spent 2016 (14.0 ppg). time with the Browns while Packers defensive coordinator Mike Pettine served as the team’s head coach during the 2014-15 seasons…Kirksey u Tutored QB Matt Ryan, who led the league in passer rating (117.1) and Harris both spent time on Cleveland’s roster in 2019…Pettine also in 2016 on his way to being named NFL Most Valuable Player by worked with Bears defensive coordinator Chuck Pagano in Baltimore The Associated Press, and QB Robert Griffin III, who became the (2008)…Packers defensive backs coach Jerry Gray, Packers inside first QB in Washington franchise history to win AP Offensive Rookie linebackers coach Kirk Olivadotti and Bears offensive coordinator Bill of the Year in 2012. Lazor coached together for the Washington Football Teams during the 2006-07 seasons…Lazor served as the Dolphins’ offensive coordinator MATT NAGY…In his third year as the Bears’ 16th head coach. when Packers G/T Billy Turner was on the roster in 2014-15…Bears u Led the Bears to a 12-4 regular-season record in his first season tight ends coach Clancy Barone served as the Broncos’ offensive line as head coach, earning a postseason appearance and taking home coach when Turner and Winn played for the team in 2016…Green Bay Associated Press and PFWA Coach of the Year honors in 2018. TE Marcedes Lewis (2006-17), offensive coordinator Nathaniel Hackett u Guided a Chiefs offense that ranked No. 5 in the NFL in total offense (2015-18) and Butkus (2013-15) spent time with Chicago WR Allen with 375.4 yards per game and finished sixth in the league in points Robinson II (2014-17) in Jacksonville…Lewis and Hackett were also per game (25.9) in 2017. with the Jaguars when Gipson (2016-18) was on the team’s roster... Packers defensive line coach Jerry Montgomery held the same position u Owns over 10 years of NFL coaching experience, serving on the at the University of Wyoming from 2009-10 when Gipson was on Philadelphia Eagles’ staff from 2008-12 and working with the campus…Packers outside linebackers coach Mike Smith (2016-18), Kansas City Chiefs from 2013-17, including one year (2017) as Redmond (2017), Bears head coach Matt Nagy (2013-17), QB Nick Foles offensive coordinator. (2016), Harris (2013-18) and K Cairo Santos (2014-17) all spent time u Played six seasons at quarterback in the Arena Football League, together while with the Chiefs organization...Bears wide receivers coach completing 65.5 percent of his passes for 18,866 yards, 374 Matt Furrey played for the Washington Football Team when Packers head touchdowns and a quarterback rating of 115.1. coach Matt LaFleur and Olivadotti were on the staff in 2010…Bears LB Robert Quinn (2011-17) crossed paths with LaFleur (2017) and Packers THE PACKERS-BEARS SERIES running backs coach Ben Sirmans (2012-15) while playing for the u One of the most storied rivalries in professional sports, the two Rams…During Bears general manager Ryan Pace and Packers executive franchises have met 200 times (regular season and playoffs) enter- vice president/director of football operations Russ Ball served together ing Sunday’s game - the most in NFL history. in the Saints’ front office from 2002-07…Packers personnel executive u Starting in 1923, the clubs met for 59 straight years until both Lee Gissendaner played wide receiver at Northwestern (1990-93)...Bears games in 1982 were canceled as part of a strike-shortened season. director of player engagement Lamar Campbell also played collegiately at Wisconsin (1994-97)...Packers president/CEO Mark Murphy was the u Have only met in the postseason twice, with the last meeting com- athletic director at Northwestern from 2003-07… ing following the 2010 season. With a berth in Super Bowl XLV on Former college teammates include: Packers P JK Scott and Bears DB Eddie Jackson the line, the Packers emerged victorious, 21-14, at Soldier Field. (Alabama); Winn and Bears OL Charles Leno Jr. (Boise State); Packers u With two wins over the Bears in 2017, Green Bay took and main- WR Allen Lazard and Bears RB David Montgomery (Iowa State); Packers tained the advantage in the series for the first time since leading S Darnell Savage and Bears LB Josh Woods (Maryland); Packers WR 11-10-4 following the 1932 season. Equanimeous St. Brown, Bears OL Alex Bars, TE Cole Kmet and OL Sam u Green Bay is 19-5 against Chicago with QB Aaron Rodgers as the Mustipher (Notre Dame); Amos and Bears WR Allen Robinson II (Penn State); starter. Packers DL Kingsley Keke and Bears OL Germain Ifedi (Texas A&M).
77 2020 SCHEDULE NOTES
NFL Regular-Season Rank was the fifth matchup between the Packers and Texans, Offense Defense with Green Bay improving to 4-1 in the series, including a 3-0 mark in Houston. at Minnesota Vikings (4-6) 8 22 u Green Bay returned home and to an NFC North opponent Detroit Lions (4-6) 25 27 in Week 8 when it hosted the Vikings, marking the first time since 2009 that Minnesota and Green Bay squared at New Orleans Saints (8-2) 12 3 off twice by Week 8. u Atlanta Falcons (3-7) 9 29 The Packers faced a long trip on a short turnaround, traveling west to take on the San Francisco 49ers on a at Tampa Bay Buccaneers (7-4) 18 5 Thursday night in Week 9. It was the first-ever Thursday meeting between the teams. at Houston Texans (3-7) 17 31 u The Packers next took on the first of two straight AFC at San Francisco 49ers (4-6) 15 7 South teams, hosting the Jacksonville Jaguars in Week 10 before visiting the Indianapolis Colts in Week 11. The Jacksonville Jaguars (1-9) 27 30 Packers improved to 5-2 all-time against the Jaguars, winning for the third straight time (2012 in Green Bay at Indianapolis Colts (7-3) 13 2 and 2016 in Jacksonville). Chicago Bears (5-5) 31 9 u Green Bay returns to Lambeau Field, finishing the regular season with four of its last six games at home for the Philadelphia Eagles (3-6-1) 26 10 first time since 1977. u The matchup against Chicago in Week 12 on a Sunday Carolina Panthers (4-7) 19 18 night at Lambeau Field marks the 15th consecutive Tennessee Titans (7-3) 10 25 regular season that the Packers and Bears have squared off in primetime. It also will be the third and final home A LOOK AT THE SCHEDULE game in November, the most for Green Bay in the month The Green Bay Packers’ 2020 NFL regular-season schedule of November since 2014. is highlighted by five prime-time contests (subject to flex- u The Packers stay at home to face the Philadelphia Eagles ible scheduling) on the original schedule for the seventh in Week 13. It is the Eagles’ first visit to Lambeau Field in straight year (2014-20). the month of December. In the last six meetings in Green u The Packers opened the season at the Minnesota Bay, four have been decided by seven points or less. Vikings for the first time in team history, marking the u In Week 14, Green Bay goes to Detroit to face the Lions. third straight year that Green Bay faced a divisional foe The Packers swept the season series last season for the in Week 1, which last happened in 1996-98 when the ninth time in the last 16 years. Packers were in the NFC Central. The previous time the u Week 15 brings a game against the Carolina Panthers two teams met in Week 1 was in 2008 on Monday Night that will take place on either Saturday or Sunday. The Football at Lambeau Field. date and time will be determined at least four weeks u For the third consecutive year, Green Bay opened the in advance of the game. Five of the last six matchups season with two NFC North games as they hosted the between the teams have been decided by eight points or Detroit Lions in Week 2. It was the earliest the Lions had less, including a 24-16 victory by Green Bay last season visited Green Bay since 2003 (Week 2). at Lambeau Field. The Packers have a 5-2 mark at home u In Week 3, Green Bay traveled to New Orleans to face vs. Carolina, scoring 30-plus points in five of those the Saints in a Sunday night contest, marking the third games. straight prime-time meeting at the Saints (2008 on MNF, u Green Bay’s last regular-season home game is slated 2014 on SNF). The winning team had scored 34-plus for a Sunday night versus the Tennessee Titans in Week points in seven of the previous nine matchups and that 16, the second-ever prime-time game against the Titans continued this season as Green Bay won, 37-30. (MNF in 2004). It is one of two prime-time contests u The Packers had another night game in Week 4, this time in 2020 for Green Bay against teams that played in against the Atlanta Falcons, marking the second time in the conference championship games last season (San three years (2018) that Green Bay had a MNF contest Francisco). going into its bye. u For the fourth time in the last five years, Green Bay will u After the third Week 5 bye (1995, 2009) for the Packers, end the regular season on the road, traveling to Chicago they will play their only set of back-to-back road games, to take on the Bears. It is the first time since 2013 that the fewest in a season for Green Bay since 2013 (zero). the Packers will close out the regular season at Chicago u The Packers made their first trip to Tampa since a 20-3 and marks only the second regular-season meeting win in 2014 to take on the Buccaneers in Week 6 and between the teams at Soldier Field in the month of then headed to Houston to face the Texans in Week 7. It January (2004 season).
88 CONSECUTIVE-SELLOUT STREAK ON PAUSE Due to health-and-safety concerns, the Packers made the decision to not sell tickets to the first five games of the GREEN BAY’S ROSTER ...
2020 season, which puts a pause to the franchise’s sellout BY AGE (as of November 29, 2020) streak at 350 regular-season games (not including replace- 21-24 18 players ment games). 25-28 25 players u The league’s longest-tenured stadium, Lambeau Field 29-32 5 players is hosting its 64th season of football in 2020. For the 33-plus 3 players victory over Seattle in the Divisional round of the 2019 playoffs, 78,998 Packers fans filled Lambeau Field for BY EXPERIENCE the second-highest paid attendance in stadium history R-1 7 players (79,704 in the Divisional round of the 2014 playoffs 2-3 22 players versus Dallas). 4-5 10 players u Across American professional sports, only Boston’s 6-9 10 players Fenway Park (1912) and Chicago’s Wrigley Field (1914) 10-plus 3 players have longer tenures. BY DRAFT ROUND BREAKING DOWN THE ROSTER 1st 7 players The Packers enter Week 12 of the 2020 season with a 2nd/3rd 11 players 52-man active roster that is composed of 23 offensive 4th/5th 13 players players, 26 defensive players and three specialists. 6th/7th 9 players u Of the 52 players on Green Bay’s active roster, 30 of Undrafted 12 players them (57.7 percent) were draft picks of the Packers. Green Bay has seven players that were drafted in the first BY COLLEGIATE CONFERENCE round, including six that were selected by the Packers. Big 10 11 players u Green Bay has 12 players on the active roster that began SEC 11 players their careers as undrafted free agents. Pac-12 6 players u Over 40 percent of the players (21 of 52, 40.4 percent) ACC 5 players on Green Bay’s active roster entered the league as a NCAA Division I FCS 5 players sixth-round or seventh-round pick or as an undrafted Mountain West 4 players player. Big 12 3 players u Of the 52 players on the active roster, 43 of them (82.7 FBS Independents 2 player percent) are 28 years old or younger (as of November American 1 players 22, 2020) and 18 players (34.6 percent) are 24 years old Conference USA 1 player or younger. MAC 1 player u Of the 52 players on the active roster, 16 of them (30.8 NCAA Division II 1 player percent) played collegiately outside of the “Power Five” Sun Belt 1 player conferences (ACC, Big 10, Big 12, Pac-12 and SEC).
PRONUNCIATION GUIDE
PLAYERS COACHES Montravius Adams ...... mon-TRAY-vee-us Wendel Davis ...... WEN-del Jaire Alexander ...... ji-air. Ryan Downard ...... DOWN-erd Adrian Amos ...... AY-miss Kevin Koger ...... KO-ger David Bakhtiari ...... bock-tee-R-ee Matt LaFleur ...... la-flew-er Reggie Begelton ...... BEG-ul-tin Mark Lovat ...... luh-VOTT Josiah Deguara ...... duh-gwa-rah Ruvell Martin ...... ROO-vell Kabion Ento ...... kay-be-on N-toe Shawn Mennenga ...... MEN-in-guh Devin Funchess ...... FUN-chess Kirk Olivadotti ...... ah-luh-vuh-DOT-ee Tipa Galeai ...... tee-puh nah-lee-eye Justin Outten ...... OW-ten Ka’dar Hollman ...... kuh-DARR. HOLE-man Mike Pettine ...... PETT-in Elgton Jenkins ...... EL-ton. Adam Stenavich ...... STEN-uh-vitch Kingsley Keke ...... KEE-KEE Rayna Stewart ...... ruh-NAY. Allen Lazard ...... luh-ZARD. John Lovett ...... love-it Kamal Martin ...... kuh-MALL Yosh Nijman ...... (rhymes with Josh) NY-man Willington Previlon ...... PREV-ih-lahn KeiVarae Russell ...... kee-VAR-ay Za’Darius Smith ...... zuh-DARE-ee-us Equanimeous St . Brown . . . . . eck-wah-nihm-ee-ous Simon Stepaniak ...... step-uh-nack Jace Sternberger ...... JAYCE Chandon Sullivan ...... CHAN-din Robert Tonyan ...... TUN-yin Marquez Valdes-Scantling ...... mar-KWEZ
9 NO. NAME POS. HT. WT. AGE EXP. COLLEGE HOMETOWN HOW ACQ. 17 Adams, Davante WR 6-1 215 27 7 Fresno State Palo Alto, Calif. D2-14 90 Adams, Montravius DL 6-4 304 25 4 Auburn Vienna, Ga. D3-17 23 Alexander, Jaire CB 5-10 196 23 3 Louisville Charlotte, N.C. D1-18 31 Amos, Adrian S 6-0 214 27 6 Penn State Baltimore, Md. UFA-19 (CHI) 69 Bakhtiari, David T 6-4 310 29 8 Colorado San Mateo, Calif. D4a-13 8 Boyle, Tim QB 6-4 232 26 3 Eastern Kentucky Middletown, Conn. FA-18 43 Bradley, Hunter LS 6-3 241 26 3 Mississippi State Collierville, Tenn. D7b-18 57 Burgess, James LB 6-0 236 26 4 Louisville Homestead, Fla. FA-20 42 Burks, Oren LB 6-3 233 25 3 Vanderbilt Lorton, Va. D3-18 97 Clark, Kenny DL 6-3 314 25 5 UCLA Rialto, Calif. D1-16 2 Crosby, Mason K 6-1 207 36 14 Colorado Georgetown, Texas D6c-07 32 Ervin, Tyler RB 5-10 192 27 5 San Jose State Colton, Calif. W (JAX)-19 53 Garvin, Jonathan LB 6-4 257 21 R Miami Lake Worth, Fla. D7b-20 52 Gary, Rashan LB 6-5 277 22 2 Michigan Paramus, N.J. D1a-19 24 Greene, Raven S 5-11 197 25 3 James Madison Virginia Beach, Va. FA-18 29 Hollman, Ka'dar CB 6-0 196 26 2 Toledo Burlington, N.J. D6a-19 37 Jackson, Josh CB 6-0 196 24 3 Iowa Corinth, Texas D2-18 74 Jenkins, Elgton G 6-5 311 24 2 Mississippi State Clarksdale, Miss. D2-19 33 Jones, Aaron RB 5-9 208 25 4 Texas-El Paso El Paso, Texas D5b-17 96 Keke, Kingsley DL 6-3 288 24 2 Texas A&M Richmond, Texas D5-19 20 King, Kevin CB 6-3 200 25 4 Washington Oakland, Calif. D2a-17 58 Kirksey, Christian LB 6-2 235 28 7 Iowa St. Louis, Mo. FA-20 95 Lancaster, Tyler DL 6-3 313 26 3 Northwestern Plainfield, Ill. FA-18 13 Lazard, Allen WR 6-5 227 24 2 Iowa State Urbandale, Iowa FA-18 (PS-Jax.) 89 Lewis, Marcedes TE 6-6 267 36 15 UCLA Long Beach, Calif. FA-18 63 Linsley, Corey C 6-3 301 29 7 Ohio State Boardman, Ohio D5a-14 10 Love, Jordan QB 6-4 219 22 R Utah State Bakersfield, Calif. D1-20 94 Lowry, Dean DL 6-6 296 26 5 Northwestern Rockford, Ill. D4b-16 54 Martin, Kamal LB 6-3 240 22 R Minnesota Burnsville, Minn. D5-20 73 Nijman, Yosh T 6-7 314 24 1 Virginia Tech Maplewood, N.J. FA-19 62 Patrick, Lucas G 6-3 313 27 4 Duke Brentwood, Tenn. FA-16 56 Ramsey, Randy LB 6-3 238 25 1 Arkansas Fort Lauderdale, Fla. FA-19 25 Redmond, Will S 5-11 186 26 5 Mississippi State Memphis, Tenn. FA-18 12 Rodgers, Aaron QB 6-2 225 36 16 California Chico, Calif. D1-05 76 Runyan, Jon G 6-4 307 23 R Michigan Philadelphia, Pa. D6a-20 26 Savage, Darnell S 5-11 198 23 2 Maryland Bear, Del. D1b-19 6 Scott, JK P 6-6 208 25 3 Alabama Denver, Colo. D5b-18 36 Scott, Vernon S 6-2 202 23 R TCU Arlington, Texas D7a-20 82 Shepherd, Darrius WR 5-11 186 25 2 North Dakota State Blue Springs, Mo. FA-19 91 Smith, Preston LB 6-5 265 28 6 Mississippi State Stone Mountain, Ga. UFA-19 (WAS) 55 Smith, Za'Darius LB 6-4 272 28 6 Kentucky Greenville, Ala. UFA-19 (BAL) 19 St. Brown, Equanimeous WR 6-5 214 24 3 Notre Dame Anaheim, Calif. D6-18 87 Sternberger, Jace TE 6-4 251 24 2 Texas A&M Kingfisher, Okla. D3-19 39 Sullivan, Chandon CB 5-11 189 24 3 Georgia State Winder, Ga. FA-19 44 Summers, Ty LB 6-1 241 24 2 TCU San Antonio, Texas D7-19 86 Taylor, Malik WR 6-1 220 24 1 Ferris State Montrose, Mich. FA-19 85 Tonyan, Robert TE 6-5 237 26 3 Indiana State McHenry, Ill. FA-17 77 Turner, Billy G/T 6-5 310 29 7 North Dakota State Arden Hills, Minn. UFA-19 (DEN) 83 Valdes-Scantling, Marquez WR 6-4 206 26 3 South Florida St. Petersburg, Fla. D5c-18 71 Wagner, Rick T 6-6 315 31 8 Wisconsin West Allis, Wis. FA-20 30 Williams, Jamaal RB 6-0 213 25 4 Brigham Young Fontana, Calif. D4b-17 93 Winn, Billy DL 6-4 305 31 8 Boise State Las Vegas, Nev. FA-20
Practice Squad (16) 84 Begelton, Reggie WR 6-0 200 27 1 Lamar Beaumont, Texas FA-20 41 Black, Henry S 6-0 204 23 R Baylor Shreveport, La. FA-20 64 Braden, Ben G 6-6 329 26 2 Michigan Rockford, Mich. FA-20 49 Dafney, Dominique TE 6-2 243 23 R Indiana State West Des Moines, Iowa FA-20 50 Galeai, Tipa LB 6-5 229 23 R Utah State Euless, Texas FA-20 59 Harris, De'Jon LB 6-0 231 23 R Arkansas Marrero, La. FA-20 68 Johnson, Zack G 6-6 301 23 R North Dakota State Spring Lake Park, Minn. FA-20 78 Pope, Ryan T 6-7 320 24 1 San Diego State Lakewood, Calif. FA-20 99 Previlon, Willington DL 6-5 287 23 R Rutgers Orange, N.J. FA-20 80 Raymond, Dax TE 6-5 246 25 1 Utah State Provo, Utah FA-20 11 Roberts, Seth WR 6-2 195 29 6 West Alabama Tallahassee, Fla. FA-20 34 Russell, KeiVarae CB 5-11 194 27 4 Notre Dame Everett, Wash. FA-20 46 Samuels, Stanford CB 6-1 187 21 R Florida State Pembroke Pines, Fla. FA-20 98 Scott, Delontae DL 6-5 246 23 R SMU Irving, Texas FA-20 38 Weber, Mike RB 5-10 211 23 1 Ohio State Detroit, Mich. FA-20 88 Winfree, Juwann WR 6-1 210 24 2 Colorado Englewood, N.J. FA-20
Reserve/NFIN (2) 72 Stepaniak, Simon G 6-4 316 23 R Indiana Hamilton, Ohio D6c-20 27 Taylor, Patrick RB 6-2 217 22 R Memphis Humble, Texas FA-20
Injured Reserve (5) 81 Deguara, Josiah TE 6-2 238 23 R Cincinnati Folsom, Calif. D3-20 48 Ento, Kabion CB 6-1 187 24 1 Colorado Pine Bluff, Ark. FA-19 45 Lovett, John TE 6-2 234 24 2 Princeton Hyattsville, Md. W (KC)-20 35 Nickerson, Parry CB 5-10 182 26 3 Tulane Harvey, La. FA-20 65 Taylor, Lane G 6-3 324 31 8 Oklahoma State Arlington, Texas FA-13
Reserve/COVID-19 (2) 51 Barnes, Krys LB 6-2 229 22 R UCLA Bakersfield, Calif. FA-20 28 Dillon, AJ RB 6-0 247 22 R Boston College Groton, Mass. D2-20
Reserve/Opt-Out (1) 11 Funchess, Devin WR 6-4 225 26 6 Michigan Farmington Hills, Mich. UFA-20 (IND)
2020 GREEN BAY PACKERS 13 ROSTER/ALPHABETICAL NO. NAME POS. HT. WT. AGE EXP. COLLEGE HOMETOWN HOW ACQ. 2 Mason Crosby K 6-1 207 36 14 Colorado Georgetown, Texas D6c-07 6 JK Scott P 6-6 208 25 3 Alabama Denver, Colo. D5b-18 8 Tim Boyle QB 6-4 232 26 3 Eastern Kentucky Middletown, Conn. FA-18 10 Jordan Love QB 6-4 219 22 R Utah State Bakersfield, Calif. D1-20 12 Aaron Rodgers QB 6-2 225 36 16 California Chico, Calif. D1-05 13 Allen Lazard WR 6-5 227 24 2 Iowa State Urbandale, Iowa FA-18 (PS-Jax.) 17 Davante Adams WR 6-1 215 27 7 Fresno State Palo Alto, Calif. D2-14 19 Equanimeous St. Brown WR 6-5 214 24 3 Notre Dame Anaheim, Calif. D6-18 20 Kevin King CB 6-3 200 25 4 Washington Oakland, Calif. D2a-17 23 Jaire Alexander CB 5-10 196 23 3 Louisville Charlotte, N.C. D1-18 24 Raven Greene S 5-11 197 25 3 James Madison Virginia Beach, Va. FA-18 25 Will Redmond S 5-11 186 26 5 Mississippi State Memphis, Tenn. FA-18 26 Darnell Savage S 5-11 198 23 2 Maryland Bear, Del. D1b-19 29 Ka'dar Hollman CB 6-0 196 26 2 Toledo Burlington, N.J. D6a-19 30 Jamaal Williams RB 6-0 213 25 4 Brigham Young Fontana, Calif. D4b-17 31 Adrian Amos S 6-0 214 27 6 Penn State Baltimore, Md. UFA-19 (CHI) 32 Tyler Ervin RB 5-10 192 27 5 San Jose State Colton, Calif. W (JAX)-19 33 Aaron Jones RB 5-9 208 25 4 Texas-El Paso El Paso, Texas D5b-17 36 Vernon Scott S 6-2 202 23 R TCU Arlington, Texas D7a-20 37 Josh Jackson CB 6-0 196 24 3 Iowa Corinth, Texas D2-18 39 Chandon Sullivan CB 5-11 189 24 3 Georgia State Winder, Ga. FA-19 42 Oren Burks LB 6-3 233 25 3 Vanderbilt Lorton, Va. D3-18 43 Hunter Bradley LS 6-3 241 26 3 Mississippi State Collierville, Tenn. D7b-18 44 Ty Summers LB 6-1 241 24 2 TCU San Antonio, Texas D7-19 52 Rashan Gary LB 6-5 277 22 2 Michigan Paramus, N.J. D1a-19 53 Jonathan Garvin LB 6-4 257 21 R Miami Lake Worth, Fla. D7b-20 54 Kamal Martin LB 6-3 240 22 R Minnesota Burnsville, Minn. D5-20 55 Za'Darius Smith LB 6-4 272 28 6 Kentucky Greenville, Ala. UFA-19 (BAL) 56 Randy Ramsey LB 6-3 238 25 1 Arkansas Fort Lauderdale, Fla. FA-19 57 James Burgess LB 6-0 236 26 4 Louisville Homestead, Fla. FA-20 58 Christian Kirksey LB 6-2 235 28 7 Iowa St. Louis, Mo. FA-20 62 Lucas Patrick G 6-3 313 27 4 Duke Brentwood, Tenn. FA-16 63 Corey Linsley C 6-3 301 29 7 Ohio State Boardman, Ohio D5a-14 69 David Bakhtiari T 6-4 310 29 8 Colorado San Mateo, Calif. D4a-13 71 Rick Wagner T 6-6 315 31 8 Wisconsin West Allis, Wis. FA-20 73 Yosh Nijman T 6-7 314 24 1 Virginia Tech Maplewood, N.J. FA-19 74 Elgton Jenkins G 6-5 311 24 2 Mississippi State Clarksdale, Miss. D2-19 76 Jon Runyan G 6-4 307 23 R Michigan Philadelphia, Pa. D6a-20 77 Billy Turner G/T 6-5 310 29 7 North Dakota State Arden Hills, Minn. UFA-19 (DEN) 82 Darrius Shepherd WR 5-11 186 25 2 North Dakota State Blue Springs, Mo. FA-19 83 Marquez Valdes-Scantling WR 6-4 206 26 3 South Florida St. Petersburg, Fla. D5c-18 85 Robert Tonyan TE 6-5 237 26 3 Indiana State McHenry, Ill. FA-17 86 Malik Taylor WR 6-1 220 24 1 Ferris State Montrose, Mich. FA-19 87 Jace Sternberger TE 6-4 251 24 2 Texas A&M Kingfisher, Okla. D3-19 89 Marcedes Lewis TE 6-6 267 36 15 UCLA Long Beach, Calif. FA-18 90 Montravius Adams DL 6-4 304 25 4 Auburn Vienna, Ga. D3-17 91 Preston Smith LB 6-5 265 28 6 Mississippi State Stone Mountain, Ga. UFA-19 (WAS) 93 Billy Winn DL 6-4 305 31 8 Boise State Las Vegas, Nev. FA-20 94 Dean Lowry DL 6-6 296 26 5 Northwestern Rockford, Ill. D4b-16 95 Tyler Lancaster DL 6-3 313 26 3 Northwestern Plainfield, Ill. FA-18 96 Kingsley Keke DL 6-3 288 24 2 Texas A&M Richmond, Texas D5-19 97 Kenny Clark DL 6-3 314 25 5 UCLA Rialto, Calif. D1-16
Practice Squad (16) 11 Seth Roberts WR 6-2 195 29 6 West Alabama Tallahassee, Fla. FA-20 34 KeiVarae Russell CB 5-11 194 27 4 Notre Dame Everett, Wash. FA-20 38 Mike Weber RB 5-10 211 23 1 Ohio State Detroit, Mich. FA-20 41 Henry Black S 6-0 204 23 R Baylor Shreveport, La. FA-20 46 Stanford Samuels CB 6-1 187 21 R Florida State Pembroke Pines, Fla. FA-20 49 Dominique Dafney TE 6-2 243 23 R Indiana State West Des Moines, Iowa FA-20 50 Tipa Galeai LB 6-5 229 23 R Utah State Euless, Texas FA-20 59 De'Jon Harris LB 6-0 231 23 R Arkansas Marrero, La. FA-20 64 Ben Braden G 6-6 329 26 2 Michigan Rockford, Mich. FA-20 68 Zack Johnson G 6-6 301 23 R North Dakota State Spring Lake Park, Minn. FA-20 78 Ryan Pope T 6-7 320 24 1 San Diego State Lakewood, Calif. FA-20 80 Dax Raymond TE 6-5 246 25 1 Utah State Provo, Utah FA-20 84 Reggie Begelton WR 6-0 200 27 1 Lamar Beaumont, Texas FA-20 88 Juwann Winfree WR 6-1 210 24 2 Colorado Englewood, N.J. FA-20 98 Delontae Scott DL 6-5 246 23 R SMU Irving, Texas FA-20 99 Willington Previlon DL 6-5 287 23 R Rutgers Orange, N.J. FA-20
Reserve/NFIN (2) 27 Patrick Taylor RB 6-2 217 22 R Memphis Humble, Texas FA-20 72 Simon Stepaniak G 6-4 316 23 R Indiana Hamilton, Ohio D6c-20
Injured Reserve (5) 35 Parry Nickerson CB 5-10 182 26 3 Tulane Harvey, La. FA-20 45 John Lovett TE 6-2 234 24 2 Princeton Hyattsville, Md. W (KC)-20 48 Kabion Ento CB 6-1 187 24 1 Colorado Pine Bluff, Ark. FA-19 65 Lane Taylor G 6-3 324 31 8 Oklahoma State Arlington, Texas FA-13 81 Josiah Deguara TE 6-2 238 23 R Cincinnati Folsom, Calif. D3-20
Reserve/COVID-19 (2) 28 AJ Dillon RB 6-0 247 22 R Boston College Groton, Mass. D2-20 51 Krys Barnes LB 6-2 229 22 R UCLA Bakersfield, Calif. FA-20
Reserve/Opt-Out (1) 11 Devin Funchess WR 6-4 225 26 6 Michigan Farmington Hills, Mich. UFA-20 (IND)
2020 GREEN BAY PACKERS 14 ROSTER/NUMERICAL QUARTERBACKS (3) 8 Boyle, Tim ...... QB 10 Love, Jordan ...... QB 12 Rodgers, Aaron ...... QB
RUNNING BACKS (3) 30 Williams, Jamaal ...... RB 32 Ervin, Tyler ...... RB 33 Jones, Aaron ...... RB
WIDE RECEIVERS (6) 13 Lazard, Allen ...... WR 17 Adams, Davante ...... WR 19 St. Brown, Equanimeous ...... WR 82 Shepherd, Darrius ...... WR 83 Valdes-Scantling, Marquez ...... WR 86 Taylor, Malik ...... WR
TIGHT ENDS (3) 85 Tonyan, Robert ...... TE 87 Sternberger, Jace ...... TE 89 Lewis, Marcedes ...... TE
OFFENSIVE LINE (8) 62 Patrick, Lucas ...... G 63 Linsley, Corey ...... C 69 Bakhtiari, David ...... T 71 Wagner, Rick ...... T 73 Nijman, Yosh ...... T 74 Jenkins, Elgton ...... G 76 Runyan, Jon ...... G 77 Turner, Billy ...... G/T
LINEBACKERS (10) 42 Burks, Oren ...... LB 44 Summers, Ty ...... LB 52 Gary, Rashan ...... LB 53 Garvin, Jonathan ...... LB 54 Martin, Kamal ...... LB 55 Smith, Za'Darius ...... LB 56 Ramsey, Randy ...... LB 57 Burgess, James ...... LB 58 Kirksey, Christian ...... LB 91 Smith, Preston ...... LB
DEFENSIVE BACKS (10) 20 King, Kevin ...... CB 23 Alexander, Jaire ...... CB 24 Greene, Raven ...... S 25 Redmond, Will ...... S 26 Savage, Darnell ...... S 29 Hollman, Ka'dar ...... CB 31 Amos, Adrian ...... S 36 Scott, Vernon ...... S 37 Jackson, Josh ...... CB 39 Sullivan, Chandon ...... CB
DEFENSIVE LINE (6) 90 Adams, Montravius ...... DL 93 Winn, Billy ...... DL 94 Lowry, Dean ...... DL 95 Lancaster, Tyler ...... DL 96 Keke, Kingsley ...... DL 97 Clark, Kenny ...... DL
SPECIALISTS (3) 2 Crosby, Mason ...... K 6 Scott, JK ...... P 43 Bradley, Hunter ...... LS
2020 GREEN BAY PACKERS 15 ROSTER/POSITIONAL YEAR DRAFTEES (30) FREE AGENTS (13) COLLEGE FREE AGENTS (7) TRADES/WAIVERS (1) PRACTICE SQUAD (1) 2005 QB A. Rodgers (1) 2007 K M. Crosby (6c) 2013 T D. Bakhtiari (4a) 2014 WR D. Adams (2) C C. Linsley (5a) 2016 DL K. Clark (1) G L. Patrick (FA-16) DL D. Lowry (4b) 2017 CB K. King (2a) TE R. Tonyan (FA-17) DL M. Adams (3) RB J. Williams (4b) RB A. Jones (5b) 2018 CB J. Alexander (1) TE M. Lewis (FA-18) QB T. Boyle (FA-18) WR A. Lazard (FA-18 PS- CB J. Jackson (2) S W. Redmond (FA-18) S R. Greene (FA-18) Jax.) LB O. Burks (3) DL T. Lancaster (FA-18) P J. Scott (5b) WR M. Valdes-Scantling (5c) WR E. St. Brown (6) LS H. Bradley (7b) 2019 LB R. Gary (1a) S A. Amos (UFA-19 CHI) T Y. Nijman (FA-19) RB T. Ervin (W JAX -19) S D. Savage (1b) LB P. Smith (UFA-19 WAS) LB R. Ramsey (FA-19) G E. Jenkins (2) LB Z. Smith (UFA-19 BAL) WR D. Shepherd (FA-19) TE J. Sternberger (3) CB C. Sullivan (FA-19) DL K. Keke (5) WR M. Taylor (FA-19) CB K. Hollman (6a) G/T B. Turner (UFA-19 DEN) LB T. Summers (7) 2020 QB J. Love (1) LB J. Burgess (FA-20) LB K. Martin (5) LB C. Kirksey (FA-20) G J. Runyan (6a) T R. Wagner (FA-20) S V. Scott (7a) DL B. Winn (FA-20) LB J. Garvin (7b)
2020 GREEN BAY PACKERS 16 ROSTER/HOW BUILT DEPTH CHART Unofficial, Nov. 24, 2020 OFFENSE WR: 17 Davante Adams 19 Equanimeous St. Brown 86 Malik Taylor LT: 69 David Bakhtiari 73 Yosh Nijman LG: 74 Elgton Jenkins 76 Jon Runyan C: 63 Corey Linsley 62 Lucas Patrick RG: 62 Lucas Patrick 76 Jon Runyan RT: 77 Billy Turner 71 Rick Wagner TE: 89 Marcedes Lewis 87 Jace Sternberger TE: 85 Robert Tonyan WR: 13 Allen Lazard 83 Marquez Valdes-Scantling 82 Darrius Shepherd QB: 12 Aaron Rodgers 8 Tim Boyle 10 Jordan Love RB: 33 Aaron Jones 30 Jamaal Williams 32 Tyler Ervin
DEFENSE DE: 94 Dean Lowry 90 Montravius Adams NT: 97 Kenny Clark 93 Billy Winn DE: 96 Kingsley Keke 95 Tyler Lancaster OLB: 91 Preston Smith 53 Jonathan Garvin 56 Randy Ramsey ILB: 58 Christian Kirksey 42 Oren Burks 57 James Burgess ILB: 54 Kamal Martin 44 Ty Summers OLB: 55 Za’Darius Smith 52 Rashan Gary CB: 23 Jaire Alexander 39 Chandon Sullivan 29 Ka’dar Hollman CB: 20 Kevin King 37 Josh Jackson S: 31 Adrian Amos 25 Will Redmond 36 Vernon Scott S: 26 Darnell Savage 24 Raven Greene
SPECIAL TEAMS K: 2 Mason Crosby P: 6 JK Scott H: 6 JK Scott PR: 32 Tyler Ervin 82 Darrius Shepherd 37 Josh Jackson KR: 32 Tyler Ervin 82 Darrius Shepherd 39 Chandon Sullivan LS: 43 Hunter Bradley ## Rookies are underlined ##
COACH LOCATIONS AT LAMBEAU FIELD
uCoaches’ Box: Butch Barry (senior analyst), Luke Butkus (assistant offensive line), Wendel Davis (defen- sive quality control), Ryan Downard (assistant defensive backs), Nathaniel Hackett (offensive coordinator), Kevin Koger (offensive quality control), Connor Lewis (offensive quality control), Christian Parker (defen- sive quality control) and Rayna Stewart (special teams quality control).
uSideline: Maurice Drayton (assistant special teams), Luke Getsy (quarterbacks/passing game coordi- nator), Jerry Gray (defensive backs), Ruvell Martin (coaching assistant - minority fellowship), Shawn Mennenga (special teams coordinator), Jerry Montgomery (defensive line), Kirk Olivadotti (inside lineback- ers), Justin Outten (tight ends), Mike Pettine (defensive coordinator), Ben Sirmans (running backs), Mike Smith (outside linebackers), Adam Stenavich (offensive line) and Jason Vrable (wide receivers). *Locations may vary in away stadiums
2020 GREEN BAY PACKERS 17 DEPTH CHART 2020 REGULAR SEASON
OFFENSE
DATE OPPONENT WR TE LT LG C RG RT TE WR WR QB RB RB
9/13 at Minnesota D. Adams M. Lewis D. Bakhtiari L. Patrick C. Linsley L. Taylor E. Jenkins J. Deguara A. Lazard -- A. Rodgers A. Jones --
9/20 Detroit D. Adams M. Lewis D. Bakhtiari E. Jenkins C. Linsley L. Patrick R. Wagner R. Tonyan A. Lazard -- A. Rodgers A. Jones --
9/27 at New Orleans M. Valdes-Scantling M. Lewis D. Bakhtiari E. Jenkins C. Linsley L. Patrick B. Turner R. Tonyan A. Lazard -- A. Rodgers A. Jones --
10/5 Atlanta M. Taylor -- D. Bakhtiari E. Jenkins C. Linsley L. Patrick B. Turner R. Tonyan M. Valdes-Scantling -- A. Rodgers A. Jones J. Williams
10/18 at Tampa Bay D. Adams M. Lewis D. Bakhtiari E. Jenkins C. Linsley L. Patrick B. Turner R. Tonyan M. Valdes-Scantling -- A. Rodgers A. Jones --
10/25 at Houston D. Adams M. Lewis B. Turner E. Jenkins C. Linsley L. Patrick R. Wagner R. Tonyan M. Valdes-Scantling -- A. Rodgers J. Williams --
11/1 Minnesota D. Adams M. Lewis B. Turner E. Jenkins C. Linsley L. Patrick R. Wagner R. Tonyan M. Valdes-Scantling -- A. Rodgers J. Williams --
11/5 at San Francisco D. Adams M. Lewis B. Turner E. Jenkins C. Linsley L. Patrick R. Wagner R. Tonyan M. Valdes-Scantling -- A. Rodgers A. Jones --
11/15 Jacksonville D. Adams M. Lewis D. Bakhtiari E. Jenkins C. Linsley L. Patrick B. Turner R. Tonyan M. Valdes-Scantling -- A. Rodgers A. Jones --
11/22 at Indianapolis D. Adams M. Lewis D. Bakhtiari E. Jenkins C. Linsley L. Patrick B. Turner -- M. Valdes-ScantlingE. St. Brown A. Rodgers A. Jones --
11/29 Chicago ------
12/6 Philadelphia ------
12/13 at Detroit ------
12/20 Carolina ------
12/27 Tennessee ------
1/3 at Chicago ------
2020 REGULAR SEASON
DEFENSE
DATE OPPONENT DE NT DE OLB OLB ILB ILB OLB CB CB CB S S
9/13 at Minnesota D. Lowry K. Clark K. Keke -- P. Smith C. Kirksey K. Barnes Z. Smith J. Alexander K. King -- A. Amos D. Savage
9/20 Detroit D. Lowry T. Lancaster K. Keke -- P. Smith C. Kirksey -- Z. Smith J. Alexander K. King C. Sullivan A. Amos D. Savage
9/27 at New Orleans D. Lowry T. Lancaster -- R. Gary P. Smith C. Kirksey K. Barnes Z. Smith J. Alexander K. King -- A. Amos D. Savage
10/5 Atlanta D. Lowry T. Lancaster K. Keke -- P. Smith K. Barnes T. Summers Z. Smith J. Alexander K. King -- A. Amos D. Savage
10/18 at Tampa Bay D. Lowry K. Clark K. Keke -- P. Smith K. Barnes -- Z. Smith J. Alexander J. Jackson C. Sullivan A. Amos D. Savage
10/25 at Houston D. Lowry K. Clark -- -- P. Smith K. Barnes K. Martin Z. Smith J. Alexander J. Jackson C. Sullivan A. Amos W. Redmond
11/1 Minnesota D. Lowry K. Clark K. Keke -- P. Smith K. Barnes K. Martin Z. Smith J. Alexander J. Jackson -- A. Amos D. Savage
11/5 at San Francisco D. Lowry K. Clark K. Keke -- P. Smith K. Barnes -- Z. Smith J. Alexander J. Jackson C. Sullivan A. Amos D. Savage
11/15 Jacksonville D. Lowry K. Clark K. Keke -- P. Smith C. Kirksey -- Z. Smith C. Sullivan J. Jackson K. Hollman A. Amos D. Savage
11/22 at Indianapolis D. Lowry K. Clark -- -- P. Smith C. Kirksey K. Martin Z. Smith J. Alexander K. King C. Sullivan A. Amos D. Savage
11/29 Chicago ------
12/6 Philadelphia ------
12/13 at Detroit ------
12/20 Carolina ------
12/27 Tennessee ------
1/3 at Chicago ------
Rookies underlined.
2020 GREEN BAY PACKERS 18 GAME-BY-GAME STARTERS 2020 REGULAR SEASON GREEN BAY PACKERS PLAYER PARTICIPATION @ MIN DET @ NO ATL @ TB @ HOU MIN @ SF JAX @ IND CHI PHI @ DET CAR TEN @ CHI PLAYERS 9/13 9/20 9/27 10/5 10/18 10/25 11/1 11/5 11/15 11/22 11/29 12/6 12/13 12/20 12/27 1/3 GP GS DNP IN Adams, Davante WR WR GXGI GXGI WR WR WR WR WR WR ------8 8 0 2 Adams, Montravius GXGI PPPPPPPP GXGI ------8 0 0 2 Alexander, Jaire CB CB CB CB CB CB CB CB GXGI CB ------9 9 0 1 Amos, Adrian SSSSSSSSSS ------10 10 0 0 Bakhtiari, David LT LT LT LT LT GXGI GXGI GXGI LT LT ------7 7 0 3 Barnes, Krys ILB P ILB ILB ILB ILB ILB ILB R/C19 R/C19 ------8 7 0 0 Begelton, Reggie PS PS PS P PS PS PS PS PS PS ------1 0 0 0 Black, Henry PS PS PS PS PS PPPP PS ------4 0 0 0 Boyle, Tim PP X PPP X P XX ------6 0 4 0 Braden, Ben ^ ^ ^ ^ ^ X PS P PS PS ------1 0 1 0 Bradley, Hunter P P P P P P P P P P ------10 0 0 0 Burgess, James ^ ^ ^ ^ ^ GXGD PPPP------4 0 0 1 Burks, Oren P P P P P P P P P P ------10 0 0 0 Clark, Kenny NT GXGI GXGI GXGI NT NT NT NT NT NT ------7 7 0 3 Crosby, Mason P P P P P P P P P P ------10 0 0 0 Dafney, Dominique ^ ^ ^ ^ PS PS PS PS PS PS ------0 0 0 0 Deguara, Josiah TE GXGI GXGI P IR IR IR IR IR IR ------2 1 0 2 Dillon, AJ PPPPPPP R/C19 R/C19 R/C19 ------7 0 0 0 Ento, Kabion IR IR IR IR IR IR IR IR IR IR ------0 0 0 0 Ervin, Tyler PPPP GXGI GXGI PPP GXGI ------7 0 0 3 Galeai, Tipa P PS PS PS PS PS PS PS PS PS ------1 0 0 0 Garvin, Jonathan PPPPPPPP NN ------8 0 0 2 Gary, Rashan PP OLB GXGI PPPPPP------91 0 1 Greene, Raven GXGI PPPPP GXGI P P P ------8 0 0 2 Hanson, Jake PS PS PS PS PSIR PSIR PSIR PSIR PSIR PSIR ------0 0 0 0 Harris, De'Jon PS PS PS P PS PS PS PS PS PS ------1 0 0 0 Hollman, Ka'dar PPPPPPPP CB GXGI ------9 1 0 1 Jackson, Josh PPPP CB CB CB CB CB P ------10 5 0 0 Jenkins, Elgton RT LG LG LG LG LG LG LG LG LG ------10 10 0 0 Johnson, Zack PS PS PS PS PS PS PS PS PS PS ------0 0 0 0 Jones, Aaron RB RB RB RB RB GXGI GXGI RB RB RB ------8 8 0 2 Keke, Kingsley DE DE P DE DE P DE DE DE P ------10 7 0 0 King, Kevin CB CB CB CB GXGI GXGI GXGI GXGI GXGI CB ------5 5 0 5 Kirksey, Christian ILB ILB ILB IR IR IR IR IR ILB ILB ------5 5 0 0 Lancaster, Tyler P NT NT NT P GXGI PPPP------93 0 1 Lazard, Allen WR WR WR IR IR IR IR IR IR P ------4 3 0 0 Lewis, Marcedes TE TE TE GXGI TE TE TE TE TE TE ------9 9 0 1 Linsley, Corey CCCCCCCCCC ------10 10 0 0 Love, Jordan NNNNNNNNNN ------0 0 0 10 Lovett, John PPPPPPPP IR IR ------8 0 0 0 Lowry, Dean DE DE DE DE DE DE DE DE DE DE ------10 10 0 0 Martin, Kamal IR IR IR IR IR ILB ILB R/C19 P ILB ------4 3 0 0 Nickerson, Parry NNNN P IR IR IR IR IR ------1 0 0 4 Nijman, Yosh P P P P P P P P P P ------10 0 0 0 Patrick, Lucas LG RG RG RG RG RG C RG RG RG ------10 10 0 0 Pope, Ryan ^ PS PS PS PS PS PS PS PS PS ------0 0 0 0 Previlon, Willington PS X PS PS PS PS PS PS PS PS ------0 0 1 0 Ramsey, Randy GXGI GXGI GXGI PPP N P P P ------6 0 0 4 Raymond, Dax ^ ^ ^ ^ ^ ^ ^ PS PS PS ------0 0 0 0 Redmond, Will PPPPP S P GXGI GXGI P ------8 1 0 2 Rodgers, Aaron QB QB QB QB QB QB QB QB QB QB ------10 10 0 0 Runyan, Jon P P P P P P P P P P ------10 0 0 0 Russell, KeiVarae ^ ^ ^ ^ ^ ^ PS PS P PS ------1 0 0 0 Samuels, Stanford PS PS PS PS PS PS PS PP PS ------2 0 0 0 Savage, Darnell SSSSS GXGI SSSS ------9 9 0 1 Scott, Delontae PS PS PS PS PS PS PS PS PS PS ------0 0 0 0 Scott, JK P P P P P P P P P P ------10 0 0 0 Scott, Vernon PPP Active Active Active Active Active Active Active ------12 0 0 1 Shepherd, Darrius PS PS PPPPPP GXGI P ------7 0 0 1 Smith, Preston OLB OLB OLB OLB OLB OLB OLB OLB OLB OLB ------10 10 0 0 Smith, Za'Darius OLB OLB OLB OLB OLB OLB LB OLB OLB OLB ------10 10 0 0 St. Brown, E. GXGI IR IR IR PPPPP WR ------6 1 0 1 Stepaniak, Simon R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN ------0 0 0 0 Sternberger, Jace P P P P P P P P P P ------10 0 0 0 Sullivan, Chandon P CB PP CB CB P CB CB CB ------10 6 0 0 Summers, Ty PPP ILB P P P P P P ------10 1 0 0 Sunderland, Will NOT NOT NOT NOT NOT NOT NOT NOT NOT PS ------0 0 0 0 Taylor, Lane RG GXGI IR IR IR IR IR IR IR IR ------1 1 0 1 Taylor, Malik PPP WR P P P P P P ------10 1 0 0 Taylor, Patrick R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN R/NFIN ------0 0 0 0 Tonyan, Robert P TE TE TE TE TE TE TE TE P ------10 8 0 0 Turner, Billy GXGI X RT RT RT LT RT LT RT RT ------8 8 1 1 Valdes-Scantling, M. PP WR WR WR WR WR WR WR WR ------10 8 0 0 Wagner, Rick P RT PPP RT RT RT P P ------10 4 0 0 Weber, Mike ^ ^ ^ ^ ^ ^ ^ ^ PS X ------0 0 1 0 Williams, Dexter PS PS PS PS PS P PS P PSIR PSIR ------2 0 0 0 Williams, Jamaal PPP RB P RB RB R/C19 P P ------9 3 0 0 Winfree, Juwann ^ ^ ^ ^ PS PS PS PS P PS ------1 0 0 0 Winn, Billy NOT PS PP PS P NNN P ------4 0 0 3 LEGEND: CAPS=Starter, GXGI=Game Inactive/Injury, P=Player was a substitution, N=On Inactive List, X=Did Not Play (Non-injury), GXGD=Game Inactive, IR=Injured Reserve, R/C19=Reserve/COVID-19, NOT=Not on Roster, PS=Practice Squad, PSIR=Practice Squad/Injured Reserve, R/NFIN=Reserve/NFIN, ^=With Other Team
2020 GREEN BAY PACKERS 19 PLAYER PARTICIPATION WEEKLY INACTIVES
9/13 at Minnesota: M. Adams, R. Greene, J. Love, P. Nickerson, R. Ramsey, E. St. Brown, B. Turner 9/20 Detroit: K. Clark, J. Deguara, J. Love, P. Nickerson, R. Ramsey, L. Taylor 9/27 at New Orleans: D. Adams, K. Clark, J. Deguara, J. Love, P. Nickerson, R. Ramsey 10/5 Atlanta: D. Adams, K. Clark, R. Gary, J. Love, M. Lewis, P. Nickerson 10/18 at Tampa Bay: T. Ervin, K. King, J. Love 10/25 at Houston: D. Bakhtiari, T. Ervin, A. Jones, K. King, T. Lancaster, J. Love, D. Savage 11/1 Minnesota: D. Bakhtiari, R. Greene, A. Jones, K. King, J. Love, R. Ramsey, B. Winn 11/5 at San Francisco: D. Bakhtiari, K. King, J. Love, W. Redmond, V. Scott, B. Winn 11/15 Jacksonville: J. Alexander, J. Garvin, K. King, J. Love, W. Redmond, D. Shepherd, B. Winn 11/22 at Indianapolis: M. Adams, T. Ervin, J. Garvin, K. Hollman, D. Kaser, J. Love 11/29 Chicago: 12/6 Philadelphia: 12/13 at Detroit: 12/19 or 12/20 Carolina: 12/27 Tennessee: 1/3/21 at Chicago: SEASON TOTALS: D. Adams, (2), M. Adams (2), J. Alexander (1), D. Bakhtiari (3), K. Clark (3), J. Deguara (2), T. Ervin (3), J. Garvin (2), R. Gary (1), R. Greene (2), K. Hollman (1), A. Jones (2), D. Kaser (1), K. King (5), T. Lancaster (1), M. Lewis (1), J. Love (10), P. Nickerson (4), R. Ramsey (4), W. Redmond (2), D. Savage (1), V. Scott (1), D. Shepherd (1), E. St. Brown (1), L. Taylor (1), B. Turner (1), B. Winn (3)
2020 GREEN BAY PACKERS 20 GAME-BY-GAME INACTIVES Supplemental Stats GREEN BAY PACKERS / REGULAR SEASON WEEK 11 / THROUGH SUNDAY, NOVEMBER 22, 2020
WON 7, LOST 3 MATT LAFLEUR (10 GAMES) RUSHING NO. YDS AVG LONG TD A. Jones 113 534 4.7 75t 6 09/13 W 43-34 at Minnesota J. Williams 81 336 4.1 25 1 09/20 W 42-21 Detroit A. Dillon 23 97 4.2 20 0 09/27 W 37-30 at New Orleans A. Rodgers 17 78 4.6 13 1 10/05 W 30-16 Atlanta T. Ervin 13 67 5.2 21 0 10/18 L 10-38 at Tampa Bay 15,540 A. Lazard 2 17 8.5 19 0 10/25 W 35-20 at Houston 12,618 M. Valdes-Scantling 2 13 6.5 9 0 11/01 L 22-28 Minnesota M. Taylor 1 9 9.0 9 0 11/05 W 34-17 at San Francisco D. Williams 2 8 4.0 5 0 11/15 W 24-20 Jacksonville J. Lovett 3 6 2.0 4 0 11/22 L 31-34 (OT) at Indianapolis 12,495 T. Boyle 8 -6 -0.8 0 0 2020 TEAM STATISTICS TEAM 265 1,159 4.4 75t 8 GB OPP. OPPONENTS 256 1,137 4.4 49 11 FIRST DOWNS 220 206 RECEIVING TD Rushing 60 76 TAR NO. YDS AVG LONG 89 68 847 12.5 49 Passing 139 111 D. Adams 10 43 32 261 8.2 30 Penalty 21 19 A. Jones 2 37 32 391 12.2 45 Third Down-Made/Att 57/119 45/114 R. Tonyan 6 31 27 212 7.9 29 Third Down Efficiency 47.9% 39.5% J. Williams 1 51 25 518 20.7 78t Fourth Down-Made/Att 8/15 6/13 M. Valdes-Scantling 4 21 15 272 18.1 72 Fourth Down Efficiency 53.3% 46.2% A. Lazard 2 15 11 84 7.6 24 TOTAL NET YARDS 3,929 3,443 T. Ervin 0 14 11 109 9.9 27 Avg. Per Game 392.9 344.3 J. Sternberger 1 10 5 40 8.0 18t Total Plays 629 597 M. Lewis 2 8 5 46 9.2 19 Avg. Per Play 6.2 5.8 D. Shepherd 0 5 4 52 13.0 26 NET YARDS RUSHING 1,159 1,137 M. Taylor 1 6 2 35 17.5 23 Avg. Per Game 115.9 113.7 E. St. Brown 0 2 1 12 12.0 12 Total Rushes 265 256 J. Deguara 0 1 1 16 16.0 16 Avg. Per Rush 4.4 4.4 A. Dillon 0 1 1 -6 -6.0 -6 NET YARDS PASSING 2,770 2,306 A. Rodgers 0 334 240 2,889 12.0 78t Avg. Per Game 277.0 230.6 TEAM 29 Sacked/Yards Lost 12/119 21/153 OPPONENTS 310 217 2,459 11.3 52t 17 Gross Yards 2,889 2,459 INTERCEPTIONS NO. YDS AVG LONG TD Attempts/Completions 352/240 320/217 A. Amos 1 23 23.0 23 0 Pct. of Completion 68.2% 67.8% R. Greene 1 17 17.0 17 0 Had Intercepted 4 5 C. Kirksey 1 8 8.0 8 0 PUNTS/AVERAGE 30/44.8 37/44.9 C. Sullivan 1 7 7.0 7t 1 Net Punting Average 35.6 41.7 J. Alexander 1 -4 -4.0 -4 0 PUNT RETURN/AVG. 7/5.6 13/15.2 TEAM 5 51 10.2 23 1 KICKOFF RETURN/AVG. 21/18.1 24/21.8 OPPONENTS 4 70 17.5 37 1 INTERCEPTION RETURN/AVG. 5/10.2 4/17.5 PENALTIES/YARDS 55/489 55/522 FUMBLES FUM LST FF REC TD FUMBLES/BALL LOST 8/5 7/4 A. Rodgers 2 2 0 0 0 TOUCHDOWNS 38 30 M. Valdes-Scantling 1 1 0 0 0 Rushing 8 11 D. Adams 1 1 0 0 0 Passing 29 17 D. Shepherd 1 1 0 0 0 Returns 1 2 T. Boyle 1 0 0 1 0 EXTRA POINTS/ATTEMPTS 35/36 25/26 A. Jones 2 0 0 0 0 TWO POINT CONVERSION/ATT. 2/2 4/4 TEAM 8 5 0 1 0 FIELD GOALS/ATTEMPTS 13/13 15/18 OPPONENTS 8 4 0 1 0 AVG. TIME OF POSSESSION 32:29 27:31 PUNTING NO. YDS AVG NET TB IN LG B SCORE BY PERIODS Q1 Q2 Q3 Q4 OT PTS J. Scott 30 1,343 44.8 35.6 2 9 62 1 TEAM 54 129 62 63 0 308 TEAM 30 1,343 44.8 35.6 2 9 62 1 OPPONENTS 48 65 65 77 3 258 OPPONENTS 37 1,663 44.9 41.7 4 13 67 0
SCORING TD RU PA RT K-PAT FG 2PT S PTS PUNT RETURNS RET FC YDS AVG LONG TD M. Crosby 0 0 0 0 35/36 13/13 0 0 74 T. Ervin 4 7 20 5.0 11 0 D. Adams 10 0 10 0 0/0 0/0 0 0 60 J. Jackson 2 0 13 6.5 7 0 A. Jones 8 6 2 0 0/0 0/0 0 0 48 D. Shepherd 1 6 6 6.0 6 0 R. Tonyan 6 0 6 0 0/0 0/0 0 0 36 TEAM 7 13 39 5.6 11 0 M. Valdes-Scantling 4 0 4 0 0/0 0/0 0 0 24 OPPONENTS 13 3 198 15.2 91t 1 J. Williams 2 1 1 0 0/0 0/0 2 0 16 KICKOFF RETURNS TD A. Lazard 2 0 2 0 0/0 0/0 0 0 12 NO. YDS AVG LONG D. Shepherd 11 227 20.6 30 0 M. Lewis 2 0 2 0 0/0 0/0 0 0 12 T. Ervin 8 141 17.6 34 0 A. Rodgers 1 1 0 0 0/0 0/0 0 0 6 M. Taylor 1 8 8.0 8 0 J. Sternberger 1 0 1 0 0/0 0/0 0 0 6 J. Lovett 1 5 5.0 5 0 C. Sullivan 1 0 0 1 0/0 0/0 0 0 6 21 381 18.1 34 M. Taylor 1 0 1 0 0/0 0/0 0 0 6 TEAM 0 24 522 21.8 38 J. Alexander 0 0 0 0 0/0 0/0 0 1 2 OPPONENTS 0 TEAM 38 8 29 1 35/36 13/13 2 1 308 FIELD GOALS 1-19 20-29 30-39 40-49 50+ OPPONENTS 30 11 17 2 25/26 15/18 4 0 258 M. Crosby 1/1 1/1 5/5 4/4 2/2 1/1 1/1 5/5 4/4 2-Pt Conv: J. Williams 2, TM 2-2, OPP 4-4 TEAM 2/2 OPPONENTS 0/0 3/3 8/8 2/3 2/4 M. Crosby: (31G, 43G) (43G, 35G) (52G, 33G, 49G) (48G) (39G) (-) (-) (19G, 53G) (39G) (26G) OPP: (35G) (57WR) (45G, 35G, 34G) (23G) (50G) (41WL, 38G, 29G) (22G) (52G, 31G) (50CR, 37G, 32G, 43G, 39G)
PASSING ATT CMP YDS CMP% YDS/ATT TD TD% INT INT% LONG SACK/ LOST RATING A. Rodgers 352 240 2,889 68.2 8.2 29 8.2 4 1.1 78t 11/ 108 115.8 T. Boyle 0 0 0 --- -- 0 --- 0 ------1/ 11 --- TEAM 352 240 2,889 68.2 8.2 29 8.2 4 1.1 78t 12/ 119 115.8 OPPONENTS 320 217 2,459 67.8 7.7 17 5.3 5 1.6 52t 21/ 153 101.8
2020 GREEN BAY PACKERS 22 TEAM STATS 2020 REGULAR SEASON GREEN BAY PACKERS DEFENSIVE STATS (THROUGH WEEK 11) PLAYER SOLO ASST. TOTAL TFL SACKS/YDS. QBH FR FF INT./YDS. PD K. Barnes 25 23 48 3 1.0/5.0 1 0 0 0/0 0 C. Kirksey 29 16 45 0 0.0/0.0 0 0 0 1/8 1 A. Amos 33 11 44 3 1.0/12.0 2 1 0 1/23 3 D. Savage 30 13 43 1 0.0/0.0 0 1 0 0/0 5 Z. Smith 28 11 39 10 8.0/59.0 17 2 2 0/0 1 J. Alexander 25 6 31 2 1.0/4.0 1 0 0 1/-4 5 R. Greene 24 7 31 1 1.0/11.0 1 0 1 1/17 4 T. Summers 19 8 27 0 0.0/0.0 0 0 0 0/0 0 P. Smith 19 7 26 4 1.5/12.5 5 0 0 0/0 1 C. Sullivan 19 6 25 0 0.0/0.0 0 0 0 1/7 4 J. Jackson 21 3 24 1 0.0/0.0 0 0 0 0/0 2 K. King 17 6 23 0 0.0/0.0 0 0 0 0/0 0 K. Clark 16 6 22 1 1.0/8.0 2 0 0 0/0 0 W. Redmond 11 6 17 0 0.0/0.0 2 0 0 0/0 1 K. Keke 9 8 17 1 2.0/13.0 3 0 1 0/0 1 R. Gary 9 7 16 2 2.5/18.5 7 0 0 0/0 1 D. Lowry 8 8 16 1 1.0/9.0 1 0 0 0/0 1 T. Lancaster 5 11 16 0 0.0/0.0 0 0 0 0/0 1 K. Martin 10 3 13 1 0.0/0.0 0 0 0 0/0 0 M. Adams 6 5 11 2 0.0/0.0 0 0 0 0/0 0 O. Burks 7 3 10 1 0.0/0.0 0 0 1 0/0 0 K. Hollman 7 1 8 0 0.0/0.0 0 0 0 0/0 3 J. Garvin 2 3 5 0 0.0/0.0 0 0 0 0/0 0 H. Black 3 0 3 0 0.0/0.0 0 0 1 0/0 0 V. Scott 3 0 3 2 1.0/1.0 1 0 0 0/0 0 B. Winn 1 2 3 0 0.0/0.0 0 0 0 0/0 2 S. Samuels 2 0 2 0 0.0/0.0 0 0 0 0/0 0 TOTALS 388 180 568 36 21.0/153.0 43 4 6 5/51 36 DEFENSIVE SCORES INT (1) (8:37) M.Stafford pass short left intended for D.Amendola INTERCEPTED by C.Sullivan at DET 7. C.Sullivan for 7 yards. vs. DET (09/20/20) FR (0) Safety (1) (11:43) K.Cousins sacked in End Zone for -4 yards, SAFETY (J.Alexander). @ MIN (09/13/20) SPECIAL TEAMS BIG PLAYS FR (0) Regular Season defensive and special teams statistics are based on press box statistics.
2020 GREEN BAY PACKERS 23 DEFENSIVE STATS 2020 REGULAR SEASON SPECIAL TEAMS STATS PLAYER TACKLES SOLO ASSISTS FOR FUMBLES FUMBLE REC BLKD FG BLKD PAT BLKD PUNT Oren Burks 6 5 1 1 0 0 0 0 Ty Summers 5 2 3 0 0 0 0 0 Henry Black 4 2 2 0 0 0 0 0 John Lovett 4 3 1 0 0 0 0 0 Randy Ramsey 4 2 2 0 0 0 0 0 James Burgess 3 3 0 0 0 0 0 0 Raven Greene 3 1 2 0 0 0 0 0 Will Redmond 3 2 1 0 0 0 0 0 Vernon Scott 3 3 0 0 0 0 0 0 Krys Barnes 2 2 0 0 0 0 0 0 Jamaal Williams 2 2 0 0 0 0 0 0 Hunter Bradley 1 0 1 0 0 0 0 0 Equanimeous St. Brown 1 1 0 0 0 0 0 0 Ka'dar Hollman 1 0 1 0 0 0 0 0 Josh Jackson 1 0 1 0 0 0 0 0 Stanford Samuels 1 1 0 0 0 0 0 0 Malik Taylor 1 1 0 0 0 0 0 0 Dexter Williams 1 1 0 0 0 0 0 0 2020 TOTALS 46 31 15 1 0 0 0 0 OPPONENTS 34 22 12 1 2 0 0 1
2020 GREEN BAY PACKERS 24 SPECIAL TEAMS STATS CHICAGO BEARS / REGULAR SEASON WEEK 10 / THROUGH MONDAY, NOVEMBER 16, 2020
WON 5, LOST 5 MATT NAGY (10 GAMES) RUSHING NO. YDS AVG LONG TD D. Montgomery 131 472 3.6 38 1 09/13 W 27-23 at Detroit C. Patterson 41 118 2.9 13 0 09/20 W 17-13 N.Y. Giants M. Trubisky 9 90 10.0 45 0 09/27 W 30-26 at Atlanta T. Cohen 14 74 5.3 17 0 10/04 L 11-19 Indianapolis B. Mingo 1 11 11.0 11 0 10/08 W 20-19 Tampa Bay A. Miller 1 9 9.0 9 0 10/18 W 23-16 at Carolina 5,240 A. Pierce 3 9 3.0 6 0 10/26 L 10-24 at L.A. Rams N. Foles 14 3 0.2 7 1 11/01 L 23-26 (OT) New Orleans R. Nall 1 0 0.0 0 0 11/08 L 17-24 at Tennessee 13,871 A. Robinson II 1 -1 -1.0 -1 0 11/16 L 13-19 Minnesota D. Mooney 1 -3 -3.0 -3 0 2020 TEAM STATISTICS TEAM 217 782 3.6 45 2 CHI OPP. OPPONENTS 287 1,151 4.0 37 6 FIRST DOWNS 188 205 RECEIVING TD Rushing 43 61 TAR NO. YDS AVG LONG 95 63 755 12.0 42 Passing 127 114 A. Robinson II 3 56 33 351 10.6 50 Penalty 18 30 D. Mooney 2 57 34 349 10.3 34 Third Down-Made/Att 42/135 48/144 A. Miller 2 57 35 302 8.6 29 Third Down Efficiency 31.1% 33.3% J. Graham 5 41 30 212 7.1 28t Fourth Down-Made/Att 9/18 8/12 D. Montgomery 1 21 19 124 6.5 25 Fourth Down Efficiency 50.0% 66.7% C. Patterson 0 11 7 86 12.3 38 TOTAL NET YARDS 3,009 3,401 C. Kmet 1 8 7 57 8.1 18 Avg. Per Game 300.9 340.1 R. Nall 1 14 7 45 6.4 9 Total Plays 644 658 D. Harris 0 9 6 41 6.8 20 Avg. Per Play 4.7 5.2 T. Cohen 0 6 3 40 13.3 29 NET YARDS RUSHING 782 1,151 T. Ginn Jr. 0 8 5 35 7.0 12 Avg. Per Game 78.2 115.1 J. Wims 1 2 2 23 11.5 18 Total Rushes 217 287 R. Ridley 0 2 2 6 3.0 7 Avg. Per Rush 3.6 4.0 L. Miller 0 1 1 4 4.0 4 NET YARDS PASSING 2,227 2,250 B. Massie 0 388 254 2,430 9.6 50 Avg. Per Game 222.7 225.0 TEAM 16 Sacked/Yards Lost 25/203 21/135 OPPONENTS 336 214 2,385 11.1 63 12 Gross Yards 2,430 2,385 INTERCEPTIONS NO. YDS AVG LONG TD Attempts/Completions 402/254 350/214 T. Gipson Sr. 2 10 5.0 9 0 Pct. of Completion 63.2% 61.1% K. Mack 1 33 33.0 33 0 Had Intercepted 11 6 D. Bush 1 10 10.0 10 0 PUNTS/AVERAGE 48/46.6 44/46.2 K. Fuller 1 5 5.0 5 0 Net Punting Average 39.5 39.9 D. Houston-Carson 1 0 0.0 0 0 PUNT RETURN/AVG. 19/8.2 21/12.4 TEAM 6 58 9.7 33 0 KICKOFF RETURN/AVG. 31/27.0 21/22.5 OPPONENTS 11 95 8.6 34 0 INTERCEPTION RETURN/AVG. 6/9.7 11/8.6 PENALTIES/YARDS 64/576 64/599 FUMBLES FUM LST FF REC TD FUMBLES/BALL LOST 12/3 11/5 A. Miller 2 1 0 2 0 TOUCHDOWNS 20 19 D. Harris 1 1 0 0 0 Rushing 2 6 D. Montgomery 1 1 0 0 0 Passing 16 12 B. Massie 0 0 0 1 0 Returns 2 1 N. Foles 2 0 0 2 0 EXTRA POINTS/ATTEMPTS 18/18 17/18 D. Mooney 1 0 0 1 0 TWO POINT CONVERSION/ATT. 1/2 0/1 C. Whitehair 1 0 0 0 0 FIELD GOALS/ATTEMPTS 17/19 26/32 C. Leno Jr. 0 0 0 1 0 AVG. TIME OF POSSESSION 29:48 30:12 A. Bars 1 0 0 0 0 M. Trubisky 1 0 0 0 0 SCORE BY PERIODS Q1 Q2 Q3 Q4 OT PTS C. Patterson 0 0 0 1 0 TEAM 29 56 14 92 0 191 T. Ginn Jr. 1 0 0 1 0 OPPONENTS 49 49 62 46 3 209 J. Graham 1 0 0 0 0 SCORING TD RU PA RT K-PAT FG 2PT S PTS TEAM 12 3 0 9 0 C. Santos 0 0 0 0 18/18 17/19 0 0 69 OPPONENTS 11 5 0 5 0 J. Graham 5 0 5 0 0/0 0/0 0 0 30 PUNTING NO. YDS AVG NET TB IN LG B A. Robinson II 3 0 3 0 0/0 0/0 0 0 18 P. O'Donnell 48 2,237 46.6 39.5 4 20 64 0 D. Montgomery 2 1 1 0 0/0 0/0 1 0 14 TEAM 48 2,237 46.6 39.5 4 20 64 0 A. Miller 2 0 2 0 0/0 0/0 0 0 12 OPPONENTS 44 2,031 46.2 39.9 6 15 65 0 D. Mooney 2 0 2 0 0/0 0/0 0 0 12 N. Foles 1 1 0 0 0/0 0/0 0 0 6 PUNT RETURNS RET FC YDS AVG LONG TD E. Jackson 1 0 0 1 0/0 0/0 0 0 6 D. Harris 10 0 81 8.1 19 0 C. Kmet 1 0 1 0 0/0 0/0 0 0 6 A. Miller 3 1 50 16.7 32 0 R. Nall 1 0 1 0 0/0 0/0 0 0 6 T. Ginn Jr. 5 1 24 4.8 10 0 C. Patterson 1 0 0 1 0/0 0/0 0 0 6 T. Cohen 1 3 0 0.0 0 0 J. Wims 1 0 1 0 0/0 0/0 0 0 6 TEAM 19 5 155 8.2 32 0 TEAM 20 2 16 2 18/18 17/19 1 0 191 OPPONENTS 21 14 260 12.4 42 0 OPPONENTS 19 6 12 1 17/18 26/32 0 0 209 KICKOFF RETURNS NO. YDS AVG LONG TD 2-Pt Conv: D. Montgomery 1, TM 1-2, OPP 0-1 C. Patterson 26 787 30.3 104t 1 R. Nall 3 35 11.7 17 0 D. Harris 1 7 7.0 7 0 J. Holtz 1 7 7.0 7 0 TEAM 31 836 27.0 104t 1 OPPONENTS 21 473 22.5 35 0
FIELD GOALS 1-19 20-29 30-39 40-49 50+ C. Santos 0/0 5/5 6/6 4/5 2/3 TEAM 0/0 5/5 6/6 4/5 2/3 OPPONENTS 0/0 8/9 12/12 6/8 0/3 C. Santos: (35G, 28G) (34G, 50WL) (46WL, 35G) (27G) (47G, 38G) (31G, 55G, 31G) (42G) (44G, 29G, 51G) (22G) (23G, 42G) OPP: (27G, 32G, 44G, 55WR) (57WL, 39G, 37G) (29G, 36G, 48WL) (21G, 30G, 44G, 30G) (39G, 35G, 46G, 25G) (21G, 20G, 54WR, 48G) (22G, 48B) (38G, 27RU, 27G, 39G, 35G) (40G) (37G, 43G)
PASSING ATT CMP YDS CMP% YDS/ATT TD TD% INT INT% LONG SACK/ LOST RATING N. Foles 311 202 1,852 65.0 6.0 10 3.2 8 2.6 50 18/ 145 81.0 M. Trubisky 86 51 560 59.3 6.5 6 7.0 3 3.5 28t 7/ 58 87.4
2020 GREEN BAY PACKERS 25 OPPONENT STATS T. Bray 5 1 18 20.0 3.6 0 0.0 0 0.0 18 0/ 0 42.1 TEAM 402 254 2,430 63.2 6.0 16 4.0 11 2.7 50 25/ 203 81.8 OPPONENTS 350 214 2,385 61.1 6.8 12 3.4 6 1.7 63 21/ 135 85.7
2020 GREEN BAY PACKERS 26 OPPONENT STATS 2020 REGULAR SEASON PACKERS GAME-BY-GAME OFFENSE 09/13 09/20 09/27 10/05 10/18 10/25 11/01 11/05 11/15 11/22 11/29 12/06 12/13 12/20 12/27 01/03 @ @ @ @ @ @ @ @ MIN DET NO ATL TB HOU MIN SF JAX IND CHI PHI DET CAR TEN CHI Totals FIRST DOWNS Total 31 26 24 22 13 22 24 21 16 21 220 Rushing 11 9 6 4 4 5 5 6 3 7 60 Passing 17 13 14 17 9 15 17 13 11 13 139 Penalty 3 4 4 1 0 2 2 2 2 1 21 THIRD DOWNS Attempts 11 12 11 11 17 12 11 12 13 9 119 Converted 6 6 5 6 7 7 5 6 5 4 57 Percentage 54.5% 50.0% 45.5% 54.5% 41.2% 58.3% 45.5% 50.0% 38.5% 44.4% 47.9% FOURTH DOWNS Attempts 2 1 2 2 0 0 5 1 1 1 15 Converted 1 1 1 1 0 0 3 1 0 0 8 Percentage 50.0% 100.0% 50.0% 50.0% 0 0 60.0% 100.0% 0.0% 0.0% 53.3% TOT. OFFENSE Net Yards 522 488 369 403 201 379 400 405 395 367 3,929 Plays 76 66 59 60 61 61 66 63 60 57 629 Avg./Play 6.9 7.4 6.3 6.7 3.3 6.2 6.1 6.4 6.6 6.4 6.2 RUSHING Net Yards 158 259 98 88 94 96 109 111 80 66 1,159 Rush. Att. 32 35 26 26 21 27 24 31 25 18 265 Avg./Att. 4.9 7.4 3.8 3.4 4.5 3.6 4.5 3.6 3.2 3.7 4.4 PASSING Net Yards 364 229 271 315 107 283 291 294 315 301 2,770 Attempts 44 30 32 33 35 34 41 31 34 38 352 Completions 32 18 21 27 16 23 27 25 24 27 240 Intercepted 0 0 0 0 2 0 0 0 1 1 4 Gross Yards 364 240 283 327 160 283 291 305 325 311 2,889 Sacked 0.0 1.0 1.0 1.0 5.0 0.0 1.0 1.0 1.0 1.0 12.0 Yards Lost 0 11 12 12 53 0 0 11 10 10 119 ADVANCES Rushes 32 35 26 26 21 27 24 31 25 18 265 Completions 32 18 21 27 16 23 27 25 24 27 240 Totals 64 53 47 53 37 50 51 56 49 45 505 Total Drives 10 10 11 9 12 11 8 11 13 13 108 PENALTIES Number 6 8 2 3 6 5 9 5 4 7 55 Yards 63 60 10 30 76 40 85 45 35 45 489 FUMBLES Number 1 0 0 0 1 0 1 0 2 3 8 Lost 0 0 0 0 0 0 1 0 1 3 5 PUNTING Net Yards 40 128 38 81 325 207 38 154 215 117 1,343 Punts 1 3 1 2 7 5 1 3 5 3 31 Net Avg. 40.0 42.7 24.0 30.5 42.1 31.3 38.0 40.3 20.4 36.0 39.5 Gross Avg. 40.0 42.7 38.0 40.5 46.4 41.4 38.0 51.3 43.0 39.0 43.3 SCORING Points 43 42 37 30 10 35 22 34 24 31 308 Q1 3 3 3 7 10 7 7 7 0 7 54 Q2 19 14 10 13 0 14 7 14 17 21 129 Q3 7 17 14 7 0 7 0 10 0 0 62 Q4 14 8 10 3 0 7 8 3 7 3 63 OT 0 0 0 0 0 0 0 0 0 0 0 TD Rushing 1 2 1 0 1 1 0 0 1 1 8 TD Passing 4 2 3 4 0 4 3 4 2 3 29 TD KO Returns 0 0 0 0 0 0 0 0 0 0 0 TD Punt Returns 0 0 0 0 0 0 0 0 0 0 0 TD Sp. Teams 0 0 0 0 0 0 0 0 0 0 0 TD Def. Returns 0 1 0 0 0 0 0 0 0 0 1 FG Attempts 2 2 3 1 1 0 0 2 1 1 13 FG Made 2 2 3 1 1 0 0 2 1 1 13 Safety 1 0 0 0 0 0 0 0 0 0 1 2-Pt Attempts 0 1 0 0 0 0 1 0 0 0 2 2-Pt Made 0 1 0 0 0 0 1 0 0 0 2 TOP 41:16 34:46 31:40 29:38 31:37 28:54 32:12 36:30 31:41 27:49 32:36.30
2020 GREEN BAY PACKERS 27 OFFENSE - TEAM STATS - GAME-BY-GAME 2020 REGULAR SEASON PACKERS GAME-BY-GAME DEFENSE 09/13 09/20 09/27 10/05 10/18 10/25 11/01 11/05 11/15 11/22 11/29 12/06 12/13 12/20 12/27 01/03 @ @ @ @ @ @ @ @ MIN DET NO ATL TB HOU MIN SF JAX IND CHI PHI DET CAR TEN CHI Totals FIRST DOWNS Total 25 19 21 24 21 20 20 17 16 23 206 Rushing 10 8 5 8 9 4 11 6 5 10 76 Passing 12 10 14 15 9 15 6 8 10 12 111 Penalty 3 1 2 1 3 1 3 3 1 1 19 THIRD DOWNS Attempts 6 12 11 12 12 14 8 10 13 16 114 Converted 3 6 5 3 5 6 4 3 4 6 45 Percentage 50.0% 50.0% 45.5% 25.0% 41.7% 42.9% 50.0% 30.0% 30.8% 37.5% 39.5% FOURTH DOWNS Attempts 1 1 1 4 0 1 1 1 1 2 13 Converted 0 0 1 2 0 0 1 0 0 2 6 Percentage 0.0% 0.0% 100.0% 50.0% 0 0.0% 100.0% 0.0% 0.0% 100.0% 46.2% TOT. OFFENSE Net Yards 382 307 397 327 324 365 324 337 260 420 3,443 Plays 49 58 58 68 63 64 49 53 61 74 597 Avg./Play 7.8 5.3 6.8 4.8 5.1 5.7 6.6 6.4 4.3 5.7 5.8 RUSHING Net Yards 134 89 122 78 158 79 173 55 109 140 1,137 Rush. Att. 22 21 20 25 35 22 34 17 23 37 256 Avg./Att. 6.1 4.2 6.1 3.1 4.5 3.6 5.1 3.2 4.7 3.8 4.4 PASSING Net Yards 248 218 275 249 166 286 151 282 151 280 2,306 Attempts 25 33 36 39 28 39 14 35 35 36 320 Completions 19 20 29 28 17 29 11 22 18 24 217 Intercepted 1 1 0 0 0 0 0 1 1 1 5 Gross Yards 259 244 288 285 166 309 160 291 169 288 2,459 Sacked 2.0 4.0 2.0 4.0 0.0 3.0 1.0 1.0 3.0 1.0 21.0 Yards Lost 11 26 13 36 0 23 9 9 18 8 153 ADVANCES Rushes 22 21 20 25 35 22 34 17 23 37 256 Completions 19 20 29 28 17 29 11 22 18 24 217 Totals 41 41 49 53 52 51 45 39 41 61 473 Total Drives 10 11 11 9 11 12 7 10 12 14 107 PENALTIES Number 5 7 8 3 0 6 7 4 7 8 55 Yards 20 70 83 23 0 55 36 33 86 116 522 FUMBLES Number 0 0 3 0 0 2 0 1 0 1 7 Lost 0 0 1 0 0 1 0 1 0 1 4 PUNTING Net Yards 80 271 115 122 192 205 113 219 275 71 1,663 Punts 2 5 3 3 5 4 3 4 6 2 37 Net Avg. 40.0 53.0 38.3 37.0 38.4 44.8 34.7 44.8 41.3 35.5 37.4 Gross Avg. 40.0 54.2 38.3 40.7 38.4 51.3 37.7 54.8 45.8 35.5 44.9 SCORING Points 34 21 30 16 38 20 28 17 20 34 258 Q1 7 14 7 0 0 0 7 3 3 7 48 Q2 3 0 10 3 28 0 7 0 7 7 65 Q3 0 0 10 6 10 7 14 0 7 11 65 Q4 24 7 3 7 0 13 0 14 3 6 77 OT 0 0 0 0 0 0 0 0 0 3 3 TD Rushing 2 1 0 2 2 0 3 1 0 0 11 TD Passing 2 2 3 0 2 2 1 1 1 3 17 TD KO Returns 0 0 0 0 0 0 0 0 0 0 0 TD Punt Returns 0 0 0 0 0 0 0 0 1 0 1 TD Sp. Teams 0 0 0 0 0 0 0 0 0 0 0 TD Def. Returns 0 0 0 0 1 0 0 0 0 0 1 FG Attempts 1 1 3 1 1 3 0 1 2 5 18 FG Made 1 0 3 1 1 2 0 1 2 4 15 Safety 0 0 0 0 0 0 0 0 0 0 0 2-Pt Attempts 3 0 0 0 0 0 0 0 0 1 4 2-Pt Made 3 0 0 0 0 0 0 0 0 1 4 TOP 18:44 25:14 28:20 30:22 28:23 31:06 27:48 23:30 28:19 35:01 27:40.70
2020 GREEN BAY PACKERS 28 DEFENSE - TEAM STATS - GAME-BY-GAME 2020 REGULAR SEASON QUARTERBACK SACKS DATE OPPONENT SACKS YARDS PLAYERS 09/13 at Minnesota 2.0 11 Jaire Alexander 1.0-4.0, Za'Darius Smith 1.0-7.0 09/20 Detroit 4.0 26 Rashan Gary 1.5-12.5, Vernon Scott 1.0-1.0, Za'Darius Smith 1.0-10.0, Preston Smith 0.5-2.5 09/27 at New Orleans 2.0 13 Kingsley Keke 2.0-13.0 10/05 Atlanta 4.0 36 Za'Darius Smith 3.0-25.0, Raven Greene 1.0-11.0 10/18 at Tampa Bay 0.0 0 -- 10/25 at Houston 3.0 23 Adrian Amos 1.0-12.0, Krys Barnes 1.0-5.0, Za'Darius Smith 1.0-6.0 11/01 Minnesota 1.0 9 Dean Lowry 1.0-9.0 11/05 at San Francisco 1.0 9 Za'Darius Smith 1.0-9.0 11/15 Jacksonville 3.0 18 Rashan Gary 1.0-6.0, Preston Smith 1.0-10.0, Za'Darius Smith 1.0-2.0 11/22 at Indianapolis 1.0 8 Kenny Clark 1.0-8.0 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------TOTALS 21.0 153 ZA'DARIUS SMITH 8.0-59.0, RASHAN GARY 2.5-18.5, KINGSLEY KEKE 2.0-13.0, PRESTON SMITH 1.5-12.5, VERNON SCOTT 1.0-1.0, JAIRE ALEXANDER 1.0-4.0, KRYS BARNES 1.0-5.0, KENNY CLARK 1.0-8.0, DEAN LOWRY 1.0-9.0, RAVEN GREENE 1.0-11.0, ADRIAN AMOS 1.0-12.0
QUARTERBACK HITS DATE OPPONENT QBH PLAYERS 09/13 at Minnesota 4 Rashan Gary 2, Jaire Alexander 1, Za'Darius Smith 1 09/20 Detroit 7 Rashan Gary 2, Za'Darius Smith 2, Will Redmond 1, Vernon Scott 1, Preston Smith 1 09/27 at New Orleans 2 Kingsley Keke 2 10/05 Atlanta 7 Za'Darius Smith 5, Adrian Amos 1, Raven Greene 1 10/18 at Tampa Bay 4 Rashan Gary 1, Will Redmond 1, Preston Smith 1, Za'Darius Smith 1 10/25 at Houston 4 Za'Darius Smith 2, Adrian Amos 1, Krys Barnes 1 11/01 Minnesota 1 Dean Lowry 1 11/05 at San Francisco 5 Preston Smith 2, Za'Darius Smith 2, Kingsley Keke 1 11/15 Jacksonville 4 Za'Darius Smith 2, Rashan Gary 1, Preston Smith 1 11/22 at Indianapolis 5 Kenny Clark 2, Za'Darius Smith 2, Rashan Gary 1 11/29 Chicago -- -- 12/06 Philadelphia -- -- 12/13 at Detroit -- -- 12/20 Carolina -- -- 12/27 Tennessee -- -- 01/03 at Chicago -- -- TOTALS 43 ZA'DARIUS SMITH 17, RASHAN GARY 7, PRESTON SMITH 5, KINGSLEY KEKE 3, KENNY CLARK 2, WILL REDMOND 2, ADRIAN AMOS 2, DEAN LOWRY 1, RAVEN GREENE 1, JAIRE ALEXANDER 1, KRYS BARNES 1, VERNON SCOTT 1
PASSES DEFENSED DATE OPPONENT PD PLAYERS 09/13 at Minnesota 1 Jaire Alexander 1 09/20 Detroit 4 Chandon Sullivan 2, Josh Jackson 1, Will Redmond 1 09/27 at New Orleans 3 Jaire Alexander 1, Kingsley Keke 1, Billy Winn 1 10/05 Atlanta 4 Ka'dar Hollman 2, Adrian Amos 1, Darnell Savage 1 10/18 at Tampa Bay 0 -- 10/25 at Houston 4 Raven Greene 2, Jaire Alexander 1, Chandon Sullivan 1 11/01 Minnesota 0 -- 11/05 at San Francisco 3 Raven Greene 1, Josh Jackson 1, Darnell Savage 1 11/15 Jacksonville 5 Darnell Savage 2, Adrian Amos 1, Ka'dar Hollman 1, Dean Lowry 1 11/22 at Indianapolis 8 Adrian Amos 1, Rashan Gary 1, Christian Kirksey 1, Tyler Lancaster 1, Darnell Savage 1, Za'Darius Smith 1, Chandon Sullivan 1, Billy Winn 1 11/29 Chicago -- -- 12/06 Philadelphia -- -- 12/13 at Detroit -- -- 12/20 Carolina -- -- 12/27 Tennessee -- -- 01/03 at Chicago -- -- TOTALS 32 DARNELL SAVAGE 5, CHANDON SULLIVAN 4, RAVEN GREENE 3, JAIRE ALEXANDER 3, ADRIAN AMOS 3, KA'DAR HOLLMAN 3, JOSH JACKSON 2, BILLY WINN 2, DEAN LOWRY 1, TYLER LANCASTER 1, WILL REDMOND 1, ZA'DARIUS SMITH 1, RASHAN GARY 1, KINGSLEY KEKE 1, CHRISTIAN KIRKSEY 1
2020 GREEN BAY PACKERS 29 SACKS / QB HITS / PASSES DEFENSED INTERCEPTIONS (AS OF NOV 24, 2020, 2:52 PM PST) 2020 : REGULAR SEASON PACKERS INTERCEPTIONS PLAYERS TIMES WHERE/WHEN Jaire Alexander 1 1 at Minnesota - (9/13) Adrian Amos 1 1 Jacksonville - (11/15) Raven Greene 1 1 at San Francisco - (11/5) Christian Kirksey 1 1 at Indianapolis - (11/22) Chandon Sullivan 1 1 Detroit - (9/20) 2020 TOTALS 5
Fumbles
(AS OF NOV 24, 2020, 2:52 PM PST) 2020 : REGULAR SEASON PLAYER FUMBLES LOST OWN RECOVERED OWN REC YARDS FUMBLED GAMES Aaron Jones 2 0 0 0 0 - at Minnesota (9/13); 0 - vs Jacksonville (11/15); Tim Boyle 1 0 1 0 0 - at Tampa Bay (10/18); Aaron Rodgers 2 2 0 -1 1 - vs Minnesota (11/1); 1 - at Indianapolis (11/22); Davante Adams 1 1 0 0 1 - vs Jacksonville (11/15); Marquez Valdes-Scantling 1 1 0 0 1 - at Indianapolis (11/22); Darrius Shepherd 1 1 0 0 1 - at Indianapolis (11/22); 2020 TOTALS 8 5 1 -1 --
2020 GREEN BAY PACKERS 30 INTERCEPTIONS - FUMBLES 2020 REGULAR SEASON INDIVIDUAL GAME-BY-GAME STATS PASSING: TIM BOYLE DATE OPP. ATT CMP YDS CMP% Y/A Y/C TD TD% INT INT% LG SK/YD RATE 09/13 at Minnesota 0 0 0 0.0% 0.0 0.0 0 0.0% 0 0.0% -- 0/0 0.0 09/20 Detroit 0 0 0 0.0% 0.0 0.0 0 0.0% 0 0.0% -- 0/0 0.0 09/27 at New Orleans DID NOT PLAY (NON-INJURY) 10/05 Atlanta 0 0 0 0.0% 0.0 0.0 0 0.0% 0 0.0% -- 0/0 0.0 10/18 at Tampa Bay 0 0 0 0.0% 0.0 0.0 0 0.0% 0 0.0% -- 1/11 0.0 10/25 at Houston 0 0 0 0.0% 0.0 0.0 0 0.0% 0 0.0% -- 0/0 0.0 11/01 Minnesota DID NOT PLAY (NON-INJURY) 11/05 at San Francisco 0 0 0 0.0% 0.0 0.0 0 0.0% 0 0.0% -- 0/0 0.0 11/15 Jacksonville DID NOT PLAY (NON-INJURY) 11/22 at Indianapolis DID NOT PLAY (NON-INJURY) 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 0 0 0 0.0% 0.0 0.0 0 0.0% 0 0.0% 0 1/11 0.0 CAREER TOTALS 4 3 15 75.0% 3.8 0.0 0 0.0% 0 0.0% 7 1/11 80.2
PASSING: JORDAN LOVE DATE OPP. ATT CMP YDS CMP% Y/A Y/C TD TD% INT INT% LG SK/YD RATE 09/13 at Minnesota INACTIVE 09/20 Detroit INACTIVE 09/27 at New Orleans INACTIVE 10/05 Atlanta INACTIVE 10/18 at Tampa Bay INACTIVE 10/25 at Houston INACTIVE 11/01 Minnesota INACTIVE 11/05 at San Francisco INACTIVE 11/15 Jacksonville INACTIVE 11/22 at Indianapolis INACTIVE 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 0 0 0 0.0% 0.0 0.0 0 0.0% 0 0.0% -- 0/0 0.0 CAREER TOTALS 0 0 0 0.0% 0.0 0.0 0 0.0% 0 0.0% 0 0/0 0.0
PASSING: AARON RODGERS DATE OPP. ATT CMP YDS CMP% Y/A Y/C TD TD% INT INT% LG SK/YD RATE 09/13 at Minnesota 44 32 364 72.7% 8.3 11.4 4 9.1% 0 0.0% 45t 0/0 127.5 09/20 Detroit 30 18 240 60.0% 8.0 13.3 2 6.7% 0 0.0% 41 1/11 107.6 09/27 at New Orleans 32 21 283 65.6% 8.8 13.5 3 9.4% 0 0.0% 72 1/12 124.9 10/05 Atlanta 33 27 327 81.8% 9.9 12.1 4 12.1% 0 0.0% 29 1/12 147.5 10/18 at Tampa Bay 35 16 160 45.7% 4.6 10.0 0 0.0% 2 5.7% 20 4/42 35.4 10/25 at Houston 34 23 283 67.6% 8.3 12.3 4 11.8% 0 0.0% 45t 0/0 132.4 11/01 Minnesota 41 27 291 65.9% 7.1 10.8 3 7.3% 0 0.0% 45 1/0 110.9 11/05 at San Francisco 31 25 305 80.6% 9.8 12.2 4 12.9% 0 0.0% 52t 1/11 147.2 11/15 Jacksonville 34 24 325 70.6% 9.6 13.5 2 5.9% 1 2.9% 78t 1/10 108.1 11/22 at Indianapolis 38 27 311 71.1% 8.2 11.5 3 7.9% 1 2.6% 47 1/10 110.7 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 352 240 2,889 68.2% 8.2 12.0 29 8.2% 4 1.1% 78t 11/108 115.8 CAREER TOTALS 6,413 4,153 49,835 64.8% 7.8 0.0 393 6.1% 88 1.4% 93t 459/3,076 103.1
2020 GREEN BAY PACKERS 31 INDIVIDUAL GXG STATS: PASSING 2020 REGULAR SEASON INDIVIDUAL GAME-BY-GAME STATS RUSHING: TIM BOYLE AJ DILLON TYLER ERVIN DATE OPP. NO. YDS AVG LG TD NO. YDS AVG LG TD NO. YDS AVG LG TD 09/13 at Minnesota 2 -2 -1.0 -1 0 2 14 7.0 8 0 3 38 12.7 21 0 09/20 Detroit 2 -1 -0.5 -- 0 5 17 3.4 12 0 0 0 0.0 -- 0 09/27 at New Orleans DID NOT PLAY (NON-INJURY) 0 0 0.0 -- 0 1 5 5.0 5 0 10/05 Atlanta 1 -1 -1.0 -1 0 1 3 3.0 3 0 0 0 0.0 -- 0 10/18 at Tampa Bay 0 0 0.0 -- 0 5 31 6.2 20 0 GAME INACTIVE/INJURY 10/25 at Houston 2 -1 -0.5 -- 0 5 11 2.2 5 0 GAME INACTIVE/INJURY 11/01 Minnesota DID NOT PLAY (NON-INJURY) 5 21 4.2 8 0 0 0 0.0 -- 0 11/05 at San Francisco 1 -1 -1.0 -1 0 RESERVE/COVID-19 8 24 3.0 8 0 11/15 Jacksonville DID NOT PLAY (NON-INJURY) RESERVE/COVID-19 1 0 0.0 -- 0 11/22 at Indianapolis DID NOT PLAY (NON-INJURY) RESERVE/COVID-19 GAME INACTIVE/INJURY 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 8 -6 -0.8 0 0 23 97 4.2 20 0 13 67 5.2 21 0 CAREER TOTALS 13 -13 -1.0 0 0 23 97 4.2 20 0 19 92 4.8 21 0
RUSHING: AARON JONES ALLEN LAZARD JOHN LOVETT DATE OPP. NO. YDS AVG LG TD NO. YDS AVG LG TD NO. YDS AVG LG TD 09/13 at Minnesota 16 66 4.1 15 1 1 19 19.0 19 0 0 0 0.0 -- 0 09/20 Detroit 18 168 9.3 75t 2 0 0 0.0 -- 0 0 0 0.0 -- 0 09/27 at New Orleans 16 69 4.3 19 1 1 -2 -2.0 -2 0 0 0 0.0 -- 0 10/05 Atlanta 15 71 4.7 23 0 INJURED RESERVE 0 0 0.0 -- 0 10/18 at Tampa Bay 10 15 1.5 7 1 INJURED RESERVE 0 0 0.0 -- 0 10/25 at Houston GAME INACTIVE/INJURY INJURED RESERVE 0 0 0.0 -- 0 11/01 Minnesota GAME INACTIVE/INJURY INJURED RESERVE 0 0 0.0 -- 0 11/05 at San Francisco 15 58 3.9 11 0 INJURED RESERVE 3 6 2.0 4 0 11/15 Jacksonville 13 46 3.5 20 0 INJURED RESERVE INJURED RESERVE 11/22 at Indianapolis 10 41 4.1 15 1 0 0 0.0 -- 0 INJURED RESERVE 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 113 534 4.7 75t 6 2 17 8.5 19 0 3 6 2.0 4 0 CAREER TOTALS 563 2,794 5.0 75t 34 3 38 12.7 21 0 3 6 2.0 4 0
RUSHING: AARON RODGERS MALIK TAYLOR MARQUEZ VALDES-SCANTLING DATE OPP. NO. YDS AVG LG TD NO. YDS AVG LG TD NO. YDS AVG LG TD 09/13 at Minnesota 1 2 2.0 2 0 0 0 0.0 -- 0 0 0 0.0 -- 0 09/20 Detroit 2 12 6.0 8 0 0 0 0.0 -- 0 0 0 0.0 -- 0 09/27 at New Orleans 2 12 6.0 13 0 0 0 0.0 -- 0 0 0 0.0 -- 0 10/05 Atlanta 1 5 5.0 5 0 0 0 0.0 -- 0 0 0 0.0 -- 0 10/18 at Tampa Bay 2 14 7.0 8 0 0 0 0.0 -- 0 0 0 0.0 -- 0 10/25 at Houston 0 0 0.0 -- 0 0 0 0.0 -- 0 1 9 9.0 9 0 11/01 Minnesota 2 9 4.5 7 0 0 0 0.0 -- 0 1 4 4.0 4 0 11/05 at San Francisco 1 7 7.0 7 0 1 9 9.0 9 0 0 0 0.0 -- 0 11/15 Jacksonville 3 4 1.3 5t 1 0 0 0.0 -- 0 0 0 0.0 -- 0 11/22 at Indianapolis 3 13 4.3 9 0 0 0 0.0 -- 0 0 0 0.0 -- 0 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 17 78 4.6 13 1 1 9 9.0 9 0 2 13 6.5 9 0 CAREER TOTALS 631 3,200 5.1 35 29 1 9 9.0 9 0 6 51 8.5 21 0
2020 GREEN BAY PACKERS 32 INDIVIDUAL GXG STATS: RUSHING
RUSHING: JAMAAL WILLIAMS DEXTER WILLIAMS DATE OPP. NO. YDS AVG LG TD NO. YDS AVG LG TD 09/13 at Minnesota 7 21 3.0 5 0 PRACTICE SQUAD 09/20 Detroit 8 63 7.9 18 0 PRACTICE SQUAD 09/27 at New Orleans 6 14 2.3 6 0 PRACTICE SQUAD 10/05 Atlanta 8 10 1.3 5 0 PRACTICE SQUAD 10/18 at Tampa Bay 4 34 8.5 25 0 PRACTICE SQUAD 10/25 at Houston 19 77 4.1 13 1 0 0 0.0 -- 0 11/01 Minnesota 16 75 4.7 10 0 PRACTICE SQUAD 11/05 at San Francisco RESERVE/COVID-19 2 8 4.0 5 0 11/15 Jacksonville 8 30 3.8 7 0 PRACTICE SQUAD/INJURED RESERVE 11/22 at Indianapolis 5 12 2.4 4 0 PRACTICE SQUAD/INJURED RESERVE 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 81 336 4.1 25 1 2 8 4.0 5 0 CAREER TOTALS 462 1,816 3.9 45 9 7 19 2.7 5 0
2020 GREEN BAY PACKERS 33 INDIVIDUAL GXG STATS: RUSHING 2020 REGULAR SEASON INDIVIDUAL GAME-BY-GAME STATS RECEIVING: DAVANTE ADAMS JOSIAH DEGUARA AJ DILLON DATE OPP. NO. YDS AVG LG TD NO. YDS AVG LG TD NO. YDS AVG LG TD 09/13 at Minnesota 14 156 11.1 40 2 1 12 12.0 12 0 0 0 0.0 -- 0 09/20 Detroit 3 36 12.0 17 0 GAME INACTIVE/INJURY 0 0 0.0 -- 0 09/27 at New Orleans GAME INACTIVE/INJURY GAME INACTIVE/INJURY 0 0 0.0 -- 0 10/05 Atlanta GAME INACTIVE/INJURY 0 0 0.0 -- 0 0 0 0.0 -- 0 10/18 at Tampa Bay 6 61 10.2 18 0 INJURED RESERVE 0 0 0.0 -- 0 10/25 at Houston 13 196 15.1 45t 2 INJURED RESERVE 0 0 0.0 -- 0 11/01 Minnesota 7 53 7.6 15 3 INJURED RESERVE 1 16 16.0 16 0 11/05 at San Francisco 10 173 17.3 49 1 INJURED RESERVE RESERVE/COVID-19 11/15 Jacksonville 8 66 8.3 22 1 INJURED RESERVE RESERVE/COVID-19 11/22 at Indianapolis 7 106 15.1 33 1 INJURED RESERVE RESERVE/COVID-19 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 68 847 12.5 49 10 1 12 12.0 12 0 1 16 16.0 16 0 CAREER TOTALS 499 6,041 12.1 66t 54 1 12 12.0 12 0 1 16 16.0 16 0
RECEIVING: TYLER ERVIN AARON JONES ALLEN LAZARD DATE OPP. NO. YDS AVG LG TD NO. YDS AVG LG TD NO. YDS AVG LG TD 09/13 at Minnesota 1 6 6.0 6 0 4 10 2.5 6 0 4 63 15.8 38 1 09/20 Detroit 1 4 4.0 4 0 4 68 17.0 30 1 3 45 15.0 25 0 09/27 at New Orleans 2 8 4.0 5 0 2 17 8.5 12 0 6 146 24.3 72 1 10/05 Atlanta 1 8 8.0 8 0 5 40 8.0 23 1 INJURED RESERVE 10/18 at Tampa Bay GAME INACTIVE/INJURY 3 26 8.7 20 0 INJURED RESERVE 10/25 at Houston GAME INACTIVE/INJURY GAME INACTIVE/INJURY INJURED RESERVE 11/01 Minnesota 1 7 7.0 7 0 GAME INACTIVE/INJURY INJURED RESERVE 11/05 at San Francisco 4 48 12.0 24 0 5 21 4.2 15 0 INJURED RESERVE 11/15 Jacksonville 1 3 3.0 3 0 5 49 9.8 14 0 INJURED RESERVE 11/22 at Indianapolis GAME INACTIVE/INJURY 4 30 7.5 14 0 2 18 9.0 10 0 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 11 84 7.6 24 0 32 261 8.2 30 2 15 272 18.1 72 2 CAREER TOTALS 27 186 6.9 24 0 116 963 8.3 67t 6 51 756 14.8 72 5
RECEIVING: MARCEDES LEWIS AARON RODGERS DARRIUS SHEPHERD DATE OPP. NO. YDS AVG LG TD NO. YDS AVG LG TD NO. YDS AVG LG TD 09/13 at Minnesota 0 0 0.0 -- 0 0 0 0.0 -- 0 PRACTICE SQUAD 09/20 Detroit 1 4 4.0 4 0 1 -6 -6.0 -6 0 PRACTICE SQUAD 09/27 at New Orleans 1 18 18.0 18t 1 0 0 0.0 -- 0 0 0 0.0 -- 0 10/05 Atlanta GAME INACTIVE/INJURY 0 0 0.0 -- 0 2 21 10.5 19 0 10/18 at Tampa Bay 0 0 0.0 -- 0 0 0 0.0 -- 0 1 16 16.0 16 0 10/25 at Houston 1 9 9.0 9 0 0 0 0.0 -- 0 0 0 0.0 -- 0 11/01 Minnesota 0 0 0.0 -- 0 0 0 0.0 -- 0 1 6 6.0 6 0 11/05 at San Francisco 1 1 1.0 1t 1 0 0 0.0 -- 0 1 3 3.0 3 0 11/15 Jacksonville 0 0 0.0 -- 0 0 0 0.0 -- 0 GAME INACTIVE/INJURY 11/22 at Indianapolis 1 8 8.0 8 0 0 0 0.0 -- 0 0 0 0.0 -- 0 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 5 40 8.0 18t 2 1 -6 -6.0 -6 0 5 46 9.2 19 0 CAREER TOTALS 398 4,737 11.9 63t 36 2 -7 -3.5 0 0 6 47 7.8 19 0
2020 GREEN BAY PACKERS 34 INDIVIDUAL GXG STATS: RECEIVING
RECEIVING: EQUANIMEOUS ST. BROWN JACE STERNBERGER MALIK TAYLOR DATE OPP. NO. YDS AVG LG TD NO. YDS AVG LG TD NO. YDS AVG LG TD 09/13 at Minnesota GAME INACTIVE/INJURY 0 0 0.0 -- 0 0 0 0.0 -- 0 09/20 Detroit INJURED RESERVE 0 0 0.0 -- 0 0 0 0.0 -- 0 09/27 at New Orleans INJURED RESERVE 3 36 12.0 23 0 0 0 0.0 -- 0 10/05 Atlanta INJURED RESERVE 0 0 0.0 -- 0 1 20 20.0 20 0 10/18 at Tampa Bay 0 0 0.0 -- 0 0 0 0.0 -- 0 0 0 0.0 -- 0 10/25 at Houston 0 0 0.0 -- 0 1 3 3.0 3t 1 2 6 3.0 5 1 11/01 Minnesota 1 12 12.0 12 0 3 46 15.3 27 0 1 26 26.0 26 0 11/05 at San Francisco 0 0 0.0 -- 0 1 1 1.0 1 0 0 0 0.0 -- 0 11/15 Jacksonville 0 0 0.0 -- 0 0 0 0.0 -- 0 0 0 0.0 -- 0 11/22 at Indianapolis 1 23 23.0 23 0 3 23 7.7 12 0 0 0 0.0 -- 0 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 2 35 17.5 23 0 11 109 9.9 27 1 4 52 13.0 26 1 CAREER TOTALS 23 363 15.8 54 0 11 109 9.9 27 1 4 52 13.0 26 1
RECEIVING: ROBERT TONYAN MARQUEZ VALDES-SCANTLING JAMAAL WILLIAMS DATE OPP. NO. YDS AVG LG TD NO. YDS AVG LG TD NO. YDS AVG LG TD 09/13 at Minnesota 0 0 0.0 -- 0 4 96 24.0 45t 1 4 21 5.3 15 0 09/20 Detroit 2 25 12.5 14 1 3 64 21.3 41 0 0 0 0.0 -- 0 09/27 at New Orleans 5 50 10.0 16 1 1 5 5.0 5 0 1 3 3.0 3 0 10/05 Atlanta 6 98 16.3 27 3 4 45 11.3 17 0 8 95 11.9 29 0 10/18 at Tampa Bay 3 25 8.3 11 0 3 32 10.7 15 0 0 0 0.0 -- 0 10/25 at Houston 2 32 16.0 31 0 0 0 0.0 -- 0 4 37 9.3 17 0 11/01 Minnesota 5 79 15.8 45 0 1 19 19.0 19 0 6 27 4.5 7 0 11/05 at San Francisco 1 5 5.0 5 0 2 53 26.5 52t 2 RESERVE/COVID-19 11/15 Jacksonville 3 33 11.0 23 0 4 149 37.3 78t 1 3 25 8.3 12 0 11/22 at Indianapolis 5 44 8.8 25t 1 3 55 18.3 47 0 1 4 4.0 4t 1 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 32 391 12.2 45 6 25 518 20.7 78t 4 27 212 7.9 29 1 CAREER TOTALS 46 568 12.3 54t 8 89 1,551 17.4 78t 8 118 937 7.9 54t 8
2020 GREEN BAY PACKERS 35 INDIVIDUAL GXG STATS: RECEIVING 2020 REGULAR SEASON INDIVIDUAL DEFENSIVE GAME-BY-GAME STATS MONTRAVIUS ADAMS JAIRE ALEXANDER ADRIAN AMOS DATE OPP. S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD 09/13 at Minnesota GAME INACTIVE/INJURY 4 1 5 1 4 1.0 4.0 1 0 0 1 1 2 1 3 0 0 0.0 0.0 0 0 0 0 0 09/20 Detroit 0 1 1 0 0 0.0 0.0 0 0 0 0 0 3 1 4 0 0 0.0 0.0 0 0 0 0 0 1 1 2 0 0 0.0 0.0 0 0 0 0 0 09/27 at New Orleans 0 1 1 0 0 0.0 0.0 0 0 0 0 0 3 0 3 1 2 0.0 0.0 0 0 0 0 1 4 1 5 0 0 0.0 0.0 0 0 0 0 0 10/05 Atlanta 0 1 1 0 0 0.0 0.0 0 0 0 0 0 4 2 6 0 0 0.0 0.0 0 0 0 0 0 4 0 4 0 0 0.0 0.0 0 0 0 1 1 10/18 at Tampa Bay 3 1 4 1 0 0.0 0.0 0 0 0 0 0 2 0 2 0 0 0.0 0.0 0 0 0 0 0 0 3 3 0 0 0.0 0.0 0 0 0 0 0 10/25 at Houston 0 1 1 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 1 5 1 6 1 12 1.0 12.0 0 1 0 1 0 11/01 Minnesota 0 0 0 0 0 0.0 0.0 0 0 0 0 0 5 0 5 0 0 0.0 0.0 0 0 0 0 0 6 1 7 1 2 0.0 0.0 0 0 0 0 0 11/05 at San Francisco 2 0 2 1 1 0.0 0.0 0 0 0 0 0 1 0 1 0 0 0.0 0.0 0 0 0 0 0 5 0 5 0 0 0.0 0.0 0 0 0 0 0 11/15 Jacksonville 1 0 1 0 0 0.0 0.0 0 0 0 0 0 GAME INACTIVE/INJURY 2 0 2 0 0 0.0 0.0 1 0 0 0 1 11/22 at Indianapolis GAME INACTIVE/INJURY 3 2 5 0 0 0.0 0.0 0 0 0 0 2 4 3 7 1 2 0.0 0.0 0 0 0 0 1 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 6 5 11 2 1 0.0 0.0 0 0 0 0 0 25 6 31 2 6 1.0 4.0 1 0 0 1 5 33 11 44 3 16 1.0 12.0 1 1 0 2 3 CAREER TOTALS 38 23 61 8 4 1.5 3.5 0 1 1 3 3 127 43 170 7 37 1.5 7.0 4 1 1 2 43 341 95 436 22 55 4.0 25.0 6 4 3 5 30
KRYS BARNES HENRY BLACK OREN BURKS DATE OPP. S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD 09/13 at Minnesota 4 2 6 2 3 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 0 0 0 0 0 0.0 0.0 0 0 0 0 0 09/20 Detroit 1 2 3 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 0 0 0 0 0 0.0 0.0 0 0 0 0 0 09/27 at New Orleans 3 5 8 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 2 0 2 0 0 0.0 0.0 0 0 0 0 0 10/05 Atlanta 4 2 6 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 0 0 0 0 0 0.0 0.0 0 0 0 0 0 10/18 at Tampa Bay 7 3 10 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 1 0 1 0 0 0.0 0.0 0 0 0 0 0 10/25 at Houston 4 4 8 1 5 1.0 5.0 0 0 0 1 0 2 0 2 0 0 0.0 0.0 0 0 1 0 0 1 1 2 0 0 0.0 0.0 0 0 1 0 0 11/01 Minnesota 1 3 4 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 11/05 at San Francisco 1 2 3 0 0 0.0 0.0 0 0 0 0 0 1 0 1 0 0 0.0 0.0 0 0 0 0 0 3 2 5 1 1 0.0 0.0 0 0 0 0 0 11/15 Jacksonville RESERVE/COVID-19 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 11/22 at Indianapolis RESERVE/COVID-19 PRACTICE SQUAD 0 0 0 0 0 0.0 0.0 0 0 0 0 0 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 25 23 48 3 8 1.0 5.0 0 0 0 1 0 3 0 3 0 0 0.0 0.0 0 0 1 0 0 7 3 10 1 1 0.0 0.0 0 0 1 0 0 CAREER TOTALS 25 23 48 3 8 1.0 5.0 0 0 0 1 0 3 0 3 0 0 0.0 0.0 0 0 1 0 0 24 10 34 1 1 0.0 0.0 0 0 1 0 0
KENNY CLARK JONATHAN GARVIN RASHAN GARY DATE OPP. S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD 09/13 at Minnesota 1 1 2 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 1 1 2 0 0 0.0 0.0 0 0 0 2 0 09/20 Detroit GAME INACTIVE/INJURY 0 0 0 0 0 0.0 0.0 0 0 0 0 0 2 2 4 1 10 1.5 12.5 0 0 0 2 0 09/27 at New Orleans GAME INACTIVE/INJURY 1 0 1 0 0 0.0 0.0 0 0 0 0 0 0 1 1 0 0 0.0 0.0 0 0 0 0 0 10/05 Atlanta GAME INACTIVE/INJURY 0 0 0 0 0 0.0 0.0 0 0 0 0 0 GAME INACTIVE/INJURY 10/18 at Tampa Bay 2 2 4 0 0 0.0 0.0 0 0 0 0 0 1 2 3 0 0 0.0 0.0 0 0 0 0 0 1 1 2 0 0 0.0 0.0 0 0 0 1 0 10/25 at Houston 1 0 1 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 11/01 Minnesota 4 0 4 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 11/05 at San Francisco 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 1 1 0 0 0.0 0.0 0 0 0 0 0 1 1 2 0 0 0.0 0.0 0 0 0 0 0 11/15 Jacksonville 3 2 5 0 0 0.0 0.0 0 0 0 0 0 INACTIVE 2 0 2 1 6 1.0 6.0 0 0 0 1 0 11/22 at Indianapolis 5 1 6 1 8 1.0 8.0 0 0 0 2 0 INACTIVE 2 1 3 0 0 0.0 0.0 0 0 0 1 1 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 16 6 22 1 8 1.0 8.0 0 0 0 2 0 2 3 5 0 0 0.0 0.0 0 0 0 0 0 9 7 16 2 16 2.5 18.5 0 0 0 7 1 CAREER TOTALS 167 128 295 30 115 17.5 114.0 0 4 4 47 6 2 3 5 0 0 0.0 0.0 0 0 0 0 0 23 23 46 5 32 4.5 31.5 0 1 0 14 1
RAVEN GREENE KA'DAR HOLLMAN JOSH JACKSON DATE OPP. S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD 09/13 at Minnesota GAME INACTIVE/INJURY 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 09/20 Detroit 2 0 2 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 1 09/27 at New Orleans 0 1 1 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 10/05 Atlanta 4 3 7 1 11 1.0 11.0 0 0 0 1 0 1 0 1 0 0 0.0 0.0 0 0 0 0 2 2 0 2 0 0 0.0 0.0 0 0 0 0 0 10/18 at Tampa Bay 2 0 2 0 0 0.0 0.0 0 0 0 0 0 1 0 1 0 0 0.0 0.0 0 0 0 0 0 5 1 6 0 0 0.0 0.0 0 0 0 0 0 10/25 at Houston 5 2 7 0 0 0.0 0.0 0 0 0 0 2 0 0 0 0 0 0.0 0.0 0 0 0 0 0 4 0 4 1 1 0.0 0.0 0 0 0 0 0 11/01 Minnesota GAME INACTIVE/INJURY 0 0 0 0 0 0.0 0.0 0 0 0 0 0 4 1 5 0 0 0.0 0.0 0 0 0 0 0 11/05 at San Francisco 1 0 1 0 0 0.0 0.0 1 0 0 0 1 1 1 2 0 0 0.0 0.0 0 0 0 0 0 4 0 4 0 0 0.0 0.0 0 0 0 0 1 11/15 Jacksonville 3 0 3 0 0 0.0 0.0 0 0 0 0 1 4 0 4 0 0 0.0 0.0 0 0 0 0 1 2 1 3 0 0 0.0 0.0 0 0 0 0 0 11/22 at Indianapolis 7 1 8 0 0 0.0 0.0 0 0 1 0 0 GAME INACTIVE/INJURY 0 0 0 0 0 0.0 0.0 0 0 0 0 0 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 24 7 31 1 11 1.0 11.0 1 0 1 1 4 7 1 8 0 0 0.0 0.0 0 0 0 0 3 21 3 24 1 1 0.0 0.0 0 0 0 0 2 CAREER TOTALS 30 11 41 2 23 2.0 23.0 1 0 1 2 6 7 1 8 0 0 0.0 0.0 0 0 0 0 3 60 27 87 2 2 0.0 0.0 0 0 0 0 15
2020 GREEN BAY PACKERS 36 INDIVIDUAL GXG STATS: DEFENSIVE
KINGSLEY KEKE KEVIN KING CHRISTIAN KIRKSEY DATE OPP. S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD 09/13 at Minnesota 0 0 0 0 0 0.0 0.0 0 0 0 0 0 4 1 5 0 0 0.0 0.0 0 0 0 0 0 6 6 12 0 0 0.0 0.0 0 0 0 0 0 09/20 Detroit 2 0 2 0 0 0.0 0.0 0 0 0 0 0 3 1 4 0 0 0.0 0.0 0 0 0 0 0 10 2 12 0 0 0.0 0.0 0 0 0 0 0 09/27 at New Orleans 2 0 2 1 7 2.0 13.0 0 0 1 2 1 3 1 4 0 0 0.0 0.0 0 0 0 0 0 3 0 3 0 0 0.0 0.0 0 0 0 0 0 10/05 Atlanta 3 0 3 0 0 0.0 0.0 0 0 0 0 0 2 1 3 0 0 0.0 0.0 0 0 0 0 0 INJURED RESERVE 10/18 at Tampa Bay 0 6 6 0 0 0.0 0.0 0 0 0 0 0 GAME INACTIVE/INJURY INJURED RESERVE 10/25 at Houston 0 1 1 0 0 0.0 0.0 0 0 0 0 0 GAME INACTIVE/INJURY INJURED RESERVE 11/01 Minnesota 0 0 0 0 0 0.0 0.0 0 0 0 0 0 GAME INACTIVE/INJURY INJURED RESERVE 11/05 at San Francisco 0 1 1 0 0 0.0 0.0 0 0 0 1 0 GAME INACTIVE/INJURY INJURED RESERVE 11/15 Jacksonville 0 0 0 0 0 0.0 0.0 0 0 0 0 0 GAME INACTIVE/INJURY 4 3 7 0 0 0.0 0.0 0 0 0 0 0 11/22 at Indianapolis 2 0 2 0 0 0.0 0.0 0 0 0 0 0 5 2 7 0 0 0.0 0.0 0 0 0 0 0 6 5 11 0 0 0.0 0.0 1 0 0 0 1 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 9 8 17 1 7 2.0 13.0 0 0 1 3 1 17 6 23 0 0 0.0 0.0 0 0 0 0 0 29 16 45 0 0 0.0 0.0 1 0 0 0 1 CAREER TOTALS 16 12 28 1 7 2.0 13.0 0 0 1 4 1 101 34 135 6 10 1.0 2.0 6 1 1 0 28 318 190 508 30 96 11.5 49.5 3 3 4 22 17
TYLER LANCASTER DEAN LOWRY KAMAL MARTIN DATE OPP. S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD 09/13 at Minnesota 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 INJURED RESERVE 09/20 Detroit 0 0 0 0 0 0.0 0.0 0 0 0 0 0 1 1 2 0 0 0.0 0.0 0 0 0 0 0 INJURED RESERVE 09/27 at New Orleans 0 2 2 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 INJURED RESERVE 10/05 Atlanta 1 3 4 0 0 0.0 0.0 0 0 0 0 0 0 1 1 0 0 0.0 0.0 0 0 0 0 0 INJURED RESERVE 10/18 at Tampa Bay 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 5 5 0 0 0.0 0.0 0 0 0 0 0 INJURED RESERVE 10/25 at Houston GAME INACTIVE/INJURY 1 1 2 0 0 0.0 0.0 0 0 0 0 0 6 0 6 1 0 0.0 0.0 0 0 0 0 0 11/01 Minnesota 2 2 4 0 0 0.0 0.0 0 0 0 0 0 3 0 3 1 9 1.0 9.0 0 0 0 1 0 1 2 3 0 0 0.0 0.0 0 0 0 0 0 11/05 at San Francisco 1 1 2 0 0 0.0 0.0 0 0 0 0 0 2 0 2 0 0 0.0 0.0 0 0 0 0 0 RESERVE/COVID-19 11/15 Jacksonville 0 2 2 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 1 0 0 0 0 0 0.0 0.0 0 0 0 0 0 11/22 at Indianapolis 1 1 2 0 0 0.0 0.0 0 0 0 0 1 1 0 1 0 0 0.0 0.0 0 0 0 0 0 3 1 4 0 0 0.0 0.0 0 0 0 0 0 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 5 11 16 0 0 0.0 0.0 0 0 0 0 1 8 8 16 1 9 1.0 9.0 0 0 0 1 1 10 3 13 1 0 0.0 0.0 0 0 0 0 0 CAREER TOTALS 45 40 85 6 13 1.5 9.0 0 1 1 3 1 110 73 183 20 86 8.0 72.0 1 3 1 21 10 10 3 13 1 0 0.0 0.0 0 0 0 0 0
WILL REDMOND STANFORD SAMUELS DARNELL SAVAGE DATE OPP. S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD 09/13 at Minnesota 2 0 2 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 3 2 5 0 0 0.0 0.0 0 0 0 0 0 09/20 Detroit 1 0 1 0 0 0.0 0.0 0 0 0 1 1 PRACTICE SQUAD 2 2 4 0 0 0.0 0.0 0 0 0 0 0 09/27 at New Orleans 2 1 3 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 5 2 7 0 0 0.0 0.0 0 0 0 0 0 10/05 Atlanta 3 2 5 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 5 1 6 1 3 0.0 0.0 0 0 0 0 1 10/18 at Tampa Bay 0 0 0 0 0 0.0 0.0 0 0 0 1 0 PRACTICE SQUAD 3 2 5 0 0 0.0 0.0 0 0 0 0 0 10/25 at Houston 3 3 6 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD GAME INACTIVE/INJURY 11/01 Minnesota 0 0 0 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 3 1 4 0 0 0.0 0.0 0 0 0 0 0 11/05 at San Francisco GAME INACTIVE/INJURY 2 0 2 0 0 0.0 0.0 0 0 0 0 0 1 0 1 0 0 0.0 0.0 0 0 0 0 1 11/15 Jacksonville GAME INACTIVE/INJURY 0 0 0 0 0 0.0 0.0 0 0 0 0 0 4 1 5 0 0 0.0 0.0 0 0 0 0 2 11/22 at Indianapolis 0 0 0 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 4 2 6 0 0 0.0 0.0 0 1 0 0 1 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 11 6 17 0 0 0.0 0.0 0 0 0 2 1 2 0 2 0 0 0.0 0.0 0 0 0 0 0 30 13 43 1 3 0.0 0.0 0 1 0 0 5 CAREER TOTALS 34 13 47 1 2 0.0 0.0 0 0 0 2 2 2 0 2 0 0 0.0 0.0 0 0 0 0 0 71 33 104 2 5 0.0 0.0 2 1 2 1 12
VERNON SCOTT PRESTON SMITH ZA'DARIUS SMITH DATE OPP. S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD 09/13 at Minnesota 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 2 0 2 1 7 1.0 7.0 0 0 0 1 0 09/20 Detroit 2 0 2 1 1 1.0 1.0 0 0 0 1 0 2 1 3 0 0 0.5 2.5 0 0 0 1 0 3 1 4 1 10 1.0 10.0 0 0 0 2 0 09/27 at New Orleans 0 0 0 0 0 0.0 0.0 0 0 0 0 0 1 2 3 0 0 0.0 0.0 0 0 0 0 0 1 1 2 0 0 0.0 0.0 0 1 1 0 0 10/05 Atlanta DID NOT PLAY 2 0 2 0 0 0.0 0.0 0 0 0 0 0 6 2 8 4 27 3.0 25.0 0 0 0 5 0 10/18 at Tampa Bay DID NOT PLAY 1 0 1 0 0 0.0 0.0 0 0 0 1 0 0 1 1 0 0 0.0 0.0 0 0 0 1 0 10/25 at Houston DID NOT PLAY 2 1 3 1 1 0.0 0.0 0 0 0 0 0 2 1 3 1 6 1.0 6.0 0 0 0 2 0 11/01 Minnesota DID NOT PLAY 3 0 3 0 0 0.0 0.0 0 0 0 0 0 3 3 6 1 1 0.0 0.0 0 0 0 0 0 11/05 at San Francisco DID NOT PLAY 1 1 2 0 0 0.0 0.0 0 0 0 2 1 2 0 2 0 0 1.0 9.0 0 1 1 2 0 11/15 Jacksonville DID NOT PLAY 4 1 5 2 10 1.0 10.0 0 0 0 1 0 4 1 5 1 2 1.0 2.0 0 0 0 2 0 11/22 at Indianapolis DID NOT PLAY 3 1 4 1 0 0.0 0.0 0 0 0 0 0 5 1 6 1 0 0.0 0.0 0 0 0 2 1 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 2 0 2 1 1 1.0 1.0 0 0 0 1 0 19 7 26 4 11 1.5 12.5 0 0 0 5 1 28 11 39 10 53 8.0 59.0 0 2 2 17 1 CAREER TOTALS 3 0 3 2 4 1.0 1.0 0 0 0 1 0 164 100 264 44 230 38.0 282.0 5 3 4 93 17 143 93 236 53 295 40.0 288.0 0 2 6 120 6
2020 GREEN BAY PACKERS 37 INDIVIDUAL GXG STATS: DEFENSIVE
CHANDON SULLIVAN TY SUMMERS BILLY WINN DATE OPP. S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD S A TK TFL TFLY SK SKY INT FR FF PR PD 09/13 at Minnesota 1 1 2 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 NOT ON ROSTER 09/20 Detroit 1 0 1 0 0 0.0 0.0 1 0 0 0 2 0 0 0 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 09/27 at New Orleans 2 0 2 0 0 0.0 0.0 0 0 0 0 0 6 3 9 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 1 10/05 Atlanta 0 1 1 0 0 0.0 0.0 0 0 0 0 0 6 1 7 0 0 0.0 0.0 0 0 0 0 0 0 1 1 0 0 0.0 0.0 0 0 0 0 0 10/18 at Tampa Bay 1 2 3 0 0 0.0 0.0 0 0 0 0 0 2 2 4 0 0 0.0 0.0 0 0 0 0 0 PRACTICE SQUAD 10/25 at Houston 3 0 3 0 0 0.0 0.0 0 0 0 0 1 2 0 2 0 0 0.0 0.0 0 0 0 0 0 1 1 2 0 0 0.0 0.0 0 0 0 0 0 11/01 Minnesota 1 0 1 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 INACTIVE 11/05 at San Francisco 0 1 1 0 0 0.0 0.0 0 0 0 0 0 3 1 4 0 0 0.0 0.0 0 0 0 0 0 INACTIVE 11/15 Jacksonville 6 0 6 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 ON INACTIVE LIST 11/22 at Indianapolis 4 1 5 0 0 0.0 0.0 0 0 0 0 1 0 1 1 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0.0 0.0 0 0 0 0 1 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 19 6 25 0 0 0.0 0.0 1 0 0 0 4 19 8 27 0 0 0.0 0.0 0 0 0 0 0 1 2 3 0 0 0.0 0.0 0 0 0 0 2 CAREER TOTALS 43 19 62 0 0 0.0 0.0 2 0 1 1 13 19 8 27 0 0 0.0 0.0 0 0 0 0 0 69 45 114 17 38 3.0 19.0 2 5 2 12 7
2020 GREEN BAY PACKERS 38 INDIVIDUAL GXG STATS: DEFENSIVE 2020 REGULAR SEASON INDIVIDUAL GAME-BY-GAME STATS FIELD GOALS: MASON CROSBY DATE OPP. 0-19 20-29 30-39 40-49 50+ TOTAL FGM FGA PCT LG 09/13 at Minnesota 0/0 0/0 1/1 1/1 0/0 2/2 2 2 100.0% 43 09/20 Detroit 0/0 0/0 1/1 1/1 0/0 2/2 2 2 100.0% 43 09/27 at New Orleans 0/0 0/0 1/1 1/1 1/1 3/3 3 3 100.0% 52 10/05 Atlanta 0/0 0/0 0/0 1/1 0/0 1/1 1 1 100.0% 48 10/18 at Tampa Bay 0/0 0/0 1/1 0/0 0/0 1/1 1 1 100.0% 39 10/25 at Houston 0/0 0/0 0/0 0/0 0/0 0/0 0 0 0.0% 0 11/01 Minnesota 0/0 0/0 0/0 0/0 0/0 0/0 0 0 0.0% 0 11/05 at San Francisco 1/1 0/0 0/0 0/0 1/1 2/2 2 2 100.0% 53 11/15 Jacksonville 0/0 0/0 1/1 0/0 0/0 1/1 1 1 100.0% 39 11/22 at Indianapolis 0/0 1/1 0/0 0/0 0/0 1/1 1 1 100.0% 26 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 1/1 1/1 5/5 4/4 2/2 13/13 13 13 100.0% 53
2020 GREEN BAY PACKERS 39 INDIVIDUAL GXG STATS: FIELD GOALS 2020 REGULAR SEASON INDIVIDUAL GAME-BY-GAME STATS PUNTING: JK SCOTT DATE OPP. NO. YDS AVG TB IN 20 LG NET BLK 09/13 at Minnesota 1 40 40.0 0 1 40 40.0 0 09/20 Detroit 3 128 42.7 0 3 54 42.7 0 09/27 at New Orleans 1 38 38.0 0 0 38 24.0 0 10/05 Atlanta 2 81 40.5 1 0 44 30.5 0 10/18 at Tampa Bay 7 325 46.4 0 2 55 42.1 0 10/25 at Houston 4 207 51.8 0 1 62 37.6 1 11/01 Minnesota 1 38 38.0 0 1 38 38.0 0 11/05 at San Francisco 3 154 51.3 1 0 57 40.3 0 11/15 Jacksonville 5 215 43.0 0 1 59 20.4 0 11/22 at Indianapolis 3 117 39.0 0 0 40 36.0 0 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 30 1,343 44.8 2 9 62 35.6 1
2020 GREEN BAY PACKERS 40 INDIVIDUAL GXG STATS: PUNTING 2020 REGULAR SEASON INDIVIDUAL GAME-BY-GAME STATS KICKOFF RETURNS: TYLER ERVIN JOHN LOVETT DARRIUS SHEPHERD DATE OPP. NO. YDS AVG LG FC TD NO. YDS AVG LG FC TD NO. YDS AVG LG FC TD 09/13 at Minnesota 1 18 18.0 18 0 0 0 0 0.0 -- 0 0 PRACTICE SQUAD 09/20 Detroit 2 34 17.0 19 0 0 0 0 0.0 -- 0 0 PRACTICE SQUAD 09/27 at New Orleans 2 30 15.0 17 0 0 0 0 0.0 -- 0 0 0 0 0.0 -- 0 0 10/05 Atlanta 2 54 27.0 34 0 0 0 0 0.0 -- 0 0 0 0 0.0 -- 0 0 10/18 at Tampa Bay GAME INACTIVE/INJURY 0 0 0.0 -- 0 0 0 0 0.0 -- 0 0 10/25 at Houston GAME INACTIVE/INJURY 0 0 0.0 -- 0 0 2 36 18.0 19 0 0 11/01 Minnesota 0 0 0.0 -- 0 0 0 0 0.0 -- 0 0 2 53 26.5 27 0 0 11/05 at San Francisco 0 0 0.0 -- 0 0 1 5 5.0 5 0 0 0 0 0.0 -- 0 0 11/15 Jacksonville 1 5 5.0 5 0 0 INJURED RESERVE GAME INACTIVE/INJURY 11/22 at Indianapolis GAME INACTIVE/INJURY INJURED RESERVE 7 138 19.7 30 0 0 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 8 141 17.6 34 0 0 1 5 5.0 5 0 0 11 227 20.6 30 0 0
KICKOFF RETURNS: MALIK TAYLOR DATE OPP. NO. YDS AVG LG FC TD 09/13 at Minnesota 0 0 0.0 -- 0 0 09/20 Detroit 0 0 0.0 -- 0 0 09/27 at New Orleans 0 0 0.0 -- 0 0 10/05 Atlanta 0 0 0.0 -- 0 0 10/18 at Tampa Bay 0 0 0.0 -- 0 0 10/25 at Houston 0 0 0.0 -- 0 0 11/01 Minnesota 0 0 0.0 -- 0 0 11/05 at San Francisco 0 0 0.0 -- 0 0 11/15 Jacksonville 1 8 8.0 8 0 0 11/22 at Indianapolis 0 0 0.0 -- 0 0 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 1 8 8.0 8 0 0
2020 GREEN BAY PACKERS 41 INDIVIDUAL GXG STATS: KICKOFF RETURNS 2020 REGULAR SEASON INDIVIDUAL GAME-BY-GAME STATS PUNT RETURNS: TYLER ERVIN JOSH JACKSON DARRIUS SHEPHERD DATE OPP. NO. YDS AVG LG FC TD NO. YDS AVG LG FC TD NO. YDS AVG LG FC TD 09/13 at Minnesota 1 0 0.0 -- 1 0 0 0 0.0 -- 0 0 PRACTICE SQUAD 09/20 Detroit 1 0 0.0 -- 2 0 1 6 6.0 6 0 0 PRACTICE SQUAD 09/27 at New Orleans 0 0 0.0 -- 3 0 0 0 0.0 -- 0 0 0 0 0.0 -- 0 0 10/05 Atlanta 1 11 11.0 11 1 0 0 0 0.0 -- 0 0 0 0 0.0 -- 0 0 10/18 at Tampa Bay GAME INACTIVE/INJURY 0 0 0.0 -- 0 0 0 0 0.0 -- 2 0 10/25 at Houston GAME INACTIVE/INJURY 0 0 0.0 -- 0 0 1 6 6.0 6 2 0 11/01 Minnesota 1 9 9.0 9 0 0 0 0 0.0 -- 0 0 0 0 0.0 -- 0 0 11/05 at San Francisco 0 0 0.0 -- 0 0 0 0 0.0 -- 0 0 0 0 0.0 -- 2 0 11/15 Jacksonville 0 0 0.0 -- 0 0 1 7 7.0 7 0 0 GAME INACTIVE/INJURY 11/22 at Indianapolis GAME INACTIVE/INJURY 0 0 0.0 -- 0 0 0 0 0.0 -- 0 0 11/29 Chicago 12/06 Philadelphia 12/13 at Detroit 12/20 Carolina 12/27 Tennessee 01/03 at Chicago TOTALS 4 20 5.0 11 7 0 2 13 6.5 7 0 0 1 6 6.0 6 6 0
2020 GREEN BAY PACKERS 42 INDIVIDUAL GXG STATS: PUNT RETURNS 2020 REGULAR SEASON PACKERS INDIVIDUAL SINGLE-GAME HIGHS Touchdowns 3 Davante Adams vs. Vikings 11/01 Robert Tonyan vs. Falcons 10/05 Aaron Jones vs. Lions 09/20 Passes Attempted 44 Aaron Rodgers at Vikings 09/13 Passes Completed 32 Aaron Rodgers at Vikings 09/13 Completion Percentage 81.8 Aaron Rodgers vs. Falcons 10/05 Passing Yards 364 Aaron Rodgers at Vikings 09/13 Yards Per Attempt 9.9 Aaron Rodgers vs. Falcons 10/05 Touchdown Passes 4 Aaron Rodgers at 49ers 11/05 Aaron Rodgers at Texans 10/25 Aaron Rodgers vs. Falcons 10/05 Aaron Rodgers at Vikings 09/13 Pass Receptions 14 Davante Adams at Vikings 09/13 Receiving Yards 196 Davante Adams at Texans 10/25 Touchdown Receptions 3 Davante Adams vs. Vikings 11/01 Robert Tonyan vs. Falcons 10/05 Rushing Yards 168 Aaron Jones vs. Lions 09/20 Rushing Attempts 19 Jamaal Williams at Texans 10/25 Rushing Average 9.3 Aaron Jones vs. Lions 09/20 Rushing Touchdowns 2 Aaron Jones vs. Lions 09/20 Yards From Scrimmage 236 Aaron Jones vs. Lions 09/20 Combined Net Yards 236 Aaron Jones vs. Lions 09/20 Interceptions Made 1 Christian Kirksey at Colts 11/22 Adrian Amos vs. Jaguars 11/15 Raven Greene at 49ers 11/05 Chandon Sullivan vs. Lions 09/20 Jaire Alexander at Vikings 09/13 Interceptions Thrown 2 Aaron Rodgers at Buccaneers 10/18 INT Return Yards 23 Adrian Amos vs. Jaguars 11/15 Tackles 12 Christian Kirksey vs. Lions 09/20 Christian Kirksey at Vikings 09/13 Sacks 3.0 Za'Darius Smith vs. Falcons 10/05 Punts 7 JK Scott at Buccaneers 10/18 Punts Inside the 20 3 JK Scott vs. Lions 09/20 Punting Average 51.8 JK Scott at Texans 10/25 Punt Returns 1 Josh Jackson vs. Jaguars 11/15 Tyler Ervin vs. Vikings 11/01 Darrius Shepherd at Texans 10/25 Tyler Ervin vs. Falcons 10/05 Tyler Ervin vs. Lions 09/20 Josh Jackson vs. Lions 09/20 Tyler Ervin at Vikings 09/13 Punt Return Yards 11 Tyler Ervin vs. Falcons 10/05 Kickoff Returns 7 Darrius Shepherd at Colts 11/22 Kickoff Return Yards 138 Darrius Shepherd at Colts 11/22 Field Goals Attempted 3 Mason Crosby at Saints 09/27 Field Goals Made 3 Mason Crosby at Saints 09/27
2020 REGULAR SEASON GREEN BAY PACKERS LONGEST PLAYS Run From Scrimmage 75 Aaron Jones vs. Lions 09/20 Touchdown Run 75 Aaron Jones vs. Lions 09/20 Passing Long 78 Aaron Rodgers vs. Jaguars 11/15 Touchdown Pass Long 78 Aaron Rodgers vs. Jaguars 11/15 Pass Reception 78 Marquez Valdes-Scantling vs. Jaguars 11/15 Touchdown Reception 78 Marquez Valdes-Scantling vs. Jaguars 11/15 Interception Return 23 Adrian Amos vs. Jaguars 11/15 Longest INT Return for TD 7 Chandon Sullivan vs. Lions 09/20 Punt Return 11 Tyler Ervin vs. Falcons 10/05 Kickoff Return 34 Tyler Ervin vs. Falcons 10/05 Punt 62 JK Scott at Texans 10/25 Field Goal 53 Mason Crosby at 49ers 11/05 Field Goal Attempt 53 Mason Crosby at 49ers 11/05
2020 GREEN BAY PACKERS 43 INDIVIDUAL SINGLE-GAME HIGHS PACKERS 2020 REGULAR SEASON SCORING DRIVES DRIVE FIRST DATE OPPONENT ACQUIRED START PLAYS YARDS Q|TIME DOWNS SCORING PLAY GB OPP 09/13 at Minnesota Kickoff GB 25 13 63 Q1|7:33 5 M. Crosby: 31-yard FG 3 0 Kickoff GB 44 8 31 Q2|3:31 3 M. Crosby: 43-yard FG 8 7 Punt GB 40 11 60 Q2|5:25 4 D. Adams: 24-yard pass from A. Rodgers 15 7 Interception MIN 45 2 45 Q2|0:11 1 M. Valdes-Scantling: 45-yard pass from A. Rodgers 22 7 Downs GB 39 8 61 Q3|4:11 3 D. Adams: 1-yard pass from A. Rodgers 29 10 Kickoff GB 25 7 75 Q4|3:51 3 A. Lazard: 4-yard pass from A. Rodgers 36 18 Kickoff GB 25 8 75 Q4|4:36 5 A. Jones: 5-yard run 43 26 09/20 Detroit Kickoff GB 25 12 50 Q1|4:51 3 M. Crosby: 43-yard FG 3 7 Kickoff GB 25 9 75 Q1|4:55 5 Q2: A. Jones: 7-yard pass from A. Rodgers 10 14 Punt GB 38 4 62 Q2|0:46 4 R. Tonyan: 11-yard pass from A. Rodgers 17 14 Kickoff GB 25 1 75 Q3|0:12 1 A. Jones: 75-yard run 24 14 Punt GB 14 12 69 Q3|6:01 4 M. Crosby: 35-yard FG 34 14 Kickoff GB 26 7 74 Q4|5:01 3 A. Jones: 14-yard run 42 21 09/27 at New Orleans Punt GB 31 10 35 Q1|5:38 3 M. Crosby: 52-yard FG 3 0 Kickoff GB 25 12 60 Q1|5:55 4 Q2: M. Crosby: 33-yard FG 6 7 Punt 50 yard line 3 50 Q2|1:27 2 A. Lazard: 5-yard pass from A. Rodgers 13 7 Kickoff GB 25 7 75 Q3|2:02 2 A. Jones: 1-yard run 20 17 Kickoff GB 25 6 75 Q3|3:38 4 M. Lewis: 18-yard pass from A. Rodgers 27 20 Fumble GB 43 7 26 Q4|3:32 2 M. Crosby: 49-yard FG 30 27 Punt GB 36 7 64 Q4|4:36 5 R. Tonyan: 1-yard pass from A. Rodgers 37 27 10/05 Atlanta Punt GB 27 7 73 Q1|3:32 4 A. Jones: 6-yard pass from A. Rodgers 7 0 Kickoff GB 25 11 75 Q2|5:10 5 R. Tonyan: 19-yard pass from A. Rodgers 13 3 Punt 50 yard line 7 50 Q2|0:51 3 R. Tonyan: 8-yard pass from A. Rodgers 20 3 Kickoff GB 49 4 51 Q3|2:02 2 R. Tonyan: 21-yard pass from A. Rodgers 27 9 Kickoff GB 25 10 45 Q4|6:57 4 M. Crosby: 48-yard FG 30 16 10/18 at Tampa Bay Kickoff GB 25 10 54 Q1|4:33 3 M. Crosby: 39-yard FG 3 0 Punt GB 20 11 80 Q1|7:32 6 A. Jones: 1-yard run 10 0 10/25 at Houston Kickoff GB 25 10 75 Q1|5:39 5 D. Adams: 3-yard pass from A. Rodgers 7 0 Punt GB 12 9 88 Q1|4:37 4 Q2: J. Sternberger: 3-yard pass from A. Rodgers 14 0 Missed FG GB 31 9 69 Q2|2:24 5 M. Taylor: 1-yard pass from A. Rodgers 21 0 Kickoff GB 25 8 75 Q3|4:11 3 D. Adams: 45-yard pass from A. Rodgers 28 7 Downs HOU 46 7 46 Q4|3:18 4 J. Williams: 1-yard run 35 13 11/01 Minnesota Kickoff GB 25 13 75 Q1|7:59 5 D. Adams: 5-yard pass from A. Rodgers 7 0 Kickoff GB 28 15 72 Q1|8:54 7 Q2: D. Adams: 1-yard pass from A. Rodgers 14 7 Punt GB 26 9 74 Q4|3:05 5 D. Adams: 7-yard pass from A. Rodgers 22 28 11/05 at San Francisco Kickoff GB 25 6 75 Q1|3:18 3 D. Adams: 36-yard pass from A. Rodgers 7 0 Interception SF 38 9 38 Q2|4:41 4 M. Lewis: 1-yard pass from A. Rodgers 14 3 Punt GB 13 8 87 Q2|3:33 4 M. Valdes-Scantling: 52-yard pass from A. Rodgers 21 3 Punt GB 20 9 80 Q3|6:00 3 M. Valdes-Scantling: 1-yard pass from A. Rodgers 28 3 Fumble SF 47 7 46 Q3|3:26 2 M. Crosby: 19-yard FG 31 3 Downs GB 5 12 60 Q4|8:14 3 M. Crosby: 53-yard FG 34 3 11/15 Jacksonville Punt GB 9 4 91 Q1|2:00 2 Q2: M. Valdes-Scantling: 78-yard pass from A. Rodgers 7 3 Kickoff GB 19 13 81 Q2|7:51 5 A. Rodgers: 5-yard run 14 10 Interception JAX 26 6 5 Q2|1:26 1 M. Crosby: 39-yard FG 17 10 Kickoff GB 25 7 75 Q4|3:37 4 D. Adams: 6-yard pass from A. Rodgers 24 20 11/22 at Indianapolis Fumble GB 49 7 51 Q1|4:06 3 R. Tonyan: 25-yard pass from A. Rodgers 7 0 Missed FG GB 40 6 60 Q2|4:14 4 A. Jones: 2-yard run 14 7 Interception IND 29 4 29 Q2|1:53 3 D. Adams: 5-yard pass from A. Rodgers 21 7 Kickoff GB 25 6 75 Q2|1:36 3 J. Williams: 4-yard pass from A. Rodgers 28 14 Punt GB 6 10 86 Q4|1:22 3 M. Crosby: 26-yard FG 31 31 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------AVG 8.2 62.8 4:07.6 3.6 TOTALS 408 3,141 205:53 178
2020 GREEN BAY PACKERS 44 SCORING DRIVES 2020 REGULAR SEASON PACKERS OPPONENT FIRST HALF SECOND HALF FIRST HALF SECOND HALF DATE OPPONENT PLAYS YDS TIME RESULT PLAYS YDS TIME RESULT PLAYS YDS TIME RESULT PLAYS YDS TIME RESULT 09/13 at Minnesota 13 63 7:33 FG 7 32 4:32 Punt 8 75 4:03 TD 6 26 3:03 Punt 09/20 Detroit 12 50 4:51 FG 1 75 0:12 TD 8 75 4:27 TD 3 4 1:39 Punt 09/27 at New Orleans 10 35 5:38 FG 7 75 2:02 TD 3 9 1:52 Punt 12 58 7:03 FG 10/05 Atlanta 7 73 3:32 TD 6 9 3:18 Punt 3 4 1:27 Punt 8 67 4:22 TD 10/18 at Tampa Bay 10 54 4:33 FG 3 5 1:37 Punt 3 9 2:07 Punt 6 43 2:46 FG 10/25 at Houston 10 75 5:39 TD 8 75 4:11 TD 3 8 2:06 Punt 11 75 6:05 TD 11/01 Minnesota 13 75 7:59 TD 6 38 2:02 Downs 10 73 6:14 TD 10 85 5:00 TD 11/05 at San Francisco 6 75 3:18 TD 9 80 6:00 TD 3 9 1:34 Punt 4 10 1:43 Punt 11/15 Jacksonville 3 7 1:38 Punt 1 22 0:14 FUM 7 29 2:46 FG 5 14 2:50 Punt 11/22 at Indianapolis 3 40 1:17 FUM 3 6 1:47 Punt 3 12 1:16 FUM 14 56 7:17 FG 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------
2020 GREEN BAY PACKERS 45 DRIVE CHARTS - OPENING DRIVES 2020 REGULAR SEASON GREEN BAY PACKERS DRIVES ENDED BY... (THROUGH WEEK 11) DATE TEAMS DRIVES 3/OUT TD FGA FGM PNT DWN TRN SAF CLK POINTS PTS/DRV EFF 9/13 Green Bay 10 1 5 2 2 1 1 0 1 1 41 4.10 0.700 at Minnesota 10 2 4 1 1 2 1 1 0 0 34 3.40 0.600 9/20 Green Bay 10 1 4 2 2 3 0 0 0 1 35 3.50 0.600 Detroit 11 5 3 1 0 5 1 1 0 0 21 1.91 0.273 9/27 Green Bay 11 1 4 3 3 1 1 0 0 1 37 3.36 0.636 at New Orleans 11 4 3 3 3 3 0 1 0 0 30 2.73 0.545 10/5 Green Bay 9 1 4 1 1 2 1 0 0 1 30 3.33 0.556 Atlanta 9 3 2 1 1 3 2 0 0 1 16 1.78 0.333 10/18 Green Bay 12 7 1 1 1 7 0 2 0 1 10 0.83 0.167 at Tampa Bay 11 3 4 1 1 5 0 0 0 1 31 2.82 0.455 10/25 Green Bay 11 5 5 0 0 5 0 0 0 1 35 3.18 0.455 at Houston 12 5 2 3 2 4 1 1 0 1 20 1.67 0.333 11/1 Green Bay 8 1 3 0 0 1 2 1 0 1 22 2.75 0.375 Minnesota 7 1 4 0 0 3 0 0 0 0 28 4.00 0.571 11/5 Green Bay 11 4 4 2 2 3 0 0 0 2 34 3.09 0.545 at San Francisco 10 3 2 1 1 4 1 2 0 0 17 1.70 0.300 11/15 Green Bay 13 6 3 1 1 5 1 2 0 1 24 1.85 0.308 Jacksonville 12 1 1 2 2 6 1 1 0 0 13 1.08 0.250 11/22 Green Bay 13 4 4 1 1 3 1 3 0 0 31 2.38 0.385 at Indianapolis 14 4 3 5 4 2 0 2 0 1 34 2.43 0.500 11/29 Green Bay ------Chicago ------12/6 Green Bay ------Philadelphia ------12/13 Green Bay ------at Detroit ------12/20 Green Bay ------Carolina ------12/27 Green Bay ------Tennessee ------1/3 Green Bay ------at Chicago ------TOTALS PACKERS 108 31 37 13 13 31 7 8 1 10 299 2.77 0.463 OPPONENTS 107 31 28 18 15 37 7 9 0 4 244 2.28 0.411
2020 GREEN BAY PACKERS 46 DRIVE EFFICIENCY - GAME-BY-GAME PACKERS 2020 REGULAR SEASON YARDS GAINED BY DOWN PACKERS OPPONENT 1ST DOWN 2ND DOWN 3RD DOWN 4TH DOWN 1ST DOWN 2ND DOWN 3RD DOWN 4TH DOWN Date Opponent Att Yds Avg Att Yds Avg Att Yds Avg Att Yds Avg Att Yds Avg Att Yds Avg Att Yds Avg Att Yds Avg 09/13 at Minnesota 35 215 6.1 28 189 6.8 11 116 10.5 2 2 1.0 28 314 11.2 14 44 3.1 6 24 4.0 1 0 0.0 09/20 Detroit 31 235 7.6 22 151 6.9 12 92 7.7 1 10 10.0 26 158 6.1 19 105 5.5 12 44 3.7 1 0 0.0 09/27 at New Orleans 29 211 7.3 17 31 1.8 11 126 11.5 2 1 0.5 26 211 8.1 20 101 5.1 11 66 6.0 1 19 19.0 10/05 Atlanta 27 145 5.4 20 109 5.5 11 129 11.7 2 20 10.0 31 189 6.1 21 74 3.5 12 39 3.3 4 25 6.3 10/18 at Tampa Bay 24 84 3.5 20 58 2.9 17 59 3.5 0 0 0.0 27 104 3.9 24 161 6.7 12 59 4.9 0 0 0.0 10/25 at Houston 27 138 5.1 22 119 5.4 12 122 10.2 0 0 0.0 29 187 6.4 20 113 5.7 14 66 4.7 1 -1 -1.0 11/01 Minnesota 28 149 5.3 22 148 6.7 11 77 7.0 5 26 5.2 22 118 5.4 18 106 5.9 8 97 12.1 1 3 3.0 11/05 at San Francisco 28 142 5.1 22 140 6.4 12 119 9.9 1 4 4.0 24 121 5.0 18 156 8.7 10 60 6.0 1 0 0.0 11/15 Jacksonville 26 194 7.5 20 119 6.0 13 82 6.3 1 0 0.0 26 117 4.5 21 116 5.5 13 27 2.1 1 0 0.0 11/22 at Indianapolis 29 210 7.2 18 106 5.9 9 51 5.7 1 0 0.0 32 199 6.2 24 106 4.4 16 98 6.1 2 17 8.5 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------TOTALS 284 1,723 6.1 211 1,170 5.5 119 973 8.2 15 63 4.2 271 1,718 6.3 199 1,082 5.4 114 580 5.1 13 63 4.8
2020 GREEN BAY PACKERS 47 YARDS GAINED BY DOWN PACKERS 2020 REGULAR SEASON THIRD DOWN EFFICIENCY PACKERS Date Opponent 3rd & 1 3rd & 2 3rd & 3 3rd & 4 3rd & 5 3rd & 6 3rd & 7 3rd & 8 3rd & 9 3rd & 10+ Total 09/13 at Minnesota 1 / 2 0 / 0 0 / 0 0 / 1 2 / 2 1 / 2 2 / 2 0 / 0 0 / 0 0 / 2 6 / 11 09/20 Detroit 0 / 0 1 / 1 1 / 2 1 / 2 0 / 0 1 / 2 0 / 1 1 / 1 0 / 0 1 / 3 6 / 12 09/27 at New Orleans 1 / 2 2 / 2 0 / 0 0 / 0 0 / 2 0 / 0 0 / 1 0 / 1 0 / 0 2 / 3 5 / 11 10/05 Atlanta 1 / 1 0 / 0 1 / 2 0 / 0 0 / 0 1 / 1 1 / 1 0 / 0 0 / 1 2 / 5 6 / 11 10/18 at Tampa Bay 2 / 2 0 / 0 1 / 3 1 / 1 0 / 1 0 / 2 1 / 1 0 / 2 0 / 0 2 / 5 7 / 17 10/25 at Houston 1 / 2 0 / 1 1 / 1 1 / 1 1 / 1 0 / 0 1 / 1 0 / 0 1 / 1 1 / 4 7 / 12 11/01 Minnesota 1 / 1 1 / 2 0 / 0 1 / 1 1 / 1 0 / 1 0 / 0 0 / 0 0 / 2 1 / 3 5 / 11 11/05 at San Francisco 1 / 2 0 / 0 2 / 2 1 / 2 1 / 2 0 / 0 1 / 1 0 / 2 0 / 0 0 / 1 6 / 12 11/15 Jacksonville 1 / 2 0 / 1 1 / 4 0 / 0 0 / 0 1 / 1 1 / 1 0 / 1 1 / 1 0 / 2 5 / 13 11/22 at Indianapolis 3 / 4 0 / 0 0 / 1 0 / 1 0 / 0 0 / 0 0 / 0 0 / 1 0 / 1 1 / 1 4 / 9 12/31 Chicago ------12/31 Philadelphia ------12/31 at Detroit ------12/31 Carolina ------12/31 Tennessee ------12/31 at Chicago ------TOTALS 12 / 18 4 / 7 7 / 15 5 / 9 5 / 9 4 / 9 7 / 9 1 / 8 2 / 6 10 / 29 57 / 119 66.7% 57.1% 46.7% 55.6% 55.6% 44.4% 77.8% 12.5% 33.3% 34.5% 47.9% 3RD & 1-3: 23 / 40 = 57.5% 3RD & 4-6: 14 / 27 = 51.9% 3RD & 7-10+: 20 / 52 = 38.5%
OPPONENT 2020 REGULAR SEASON THIRD DOWN EFFICIENCY OPPONENT Date Opponent 3rd & 1 3rd & 2 3rd & 3 3rd & 4 3rd & 5 3rd & 6 3rd & 7 3rd & 8 3rd & 9 3rd & 10+ Total 09/13 at Minnesota 2 / 2 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 1 / 3 0 / 0 0 / 1 3 / 6 09/20 Detroit 3 / 4 1 / 1 0 / 0 1 / 1 0 / 0 0 / 1 0 / 0 0 / 0 0 / 0 1 / 5 6 / 12 09/27 at New Orleans 1 / 1 1 / 1 0 / 1 0 / 1 1 / 2 1 / 1 0 / 0 0 / 0 0 / 1 1 / 3 5 / 11 10/05 Atlanta 0 / 0 0 / 0 0 / 0 0 / 2 3 / 4 0 / 3 0 / 0 0 / 0 0 / 0 0 / 3 3 / 12 10/18 at Tampa Bay 0 / 0 1 / 3 0 / 1 0 / 0 0 / 1 2 / 2 2 / 3 0 / 1 0 / 0 0 / 1 5 / 12 10/25 at Houston 1 / 2 1 / 1 1 / 2 0 / 1 1 / 1 2 / 2 0 / 1 0 / 1 0 / 0 0 / 3 6 / 14 11/01 Minnesota 1 / 2 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 0 / 1 2 / 2 1 / 2 0 / 1 4 / 8 11/05 at San Francisco 1 / 1 1 / 1 0 / 0 0 / 2 0 / 2 0 / 1 1 / 1 0 / 0 0 / 0 0 / 2 3 / 10 11/15 Jacksonville 0 / 0 2 / 2 0 / 1 0 / 2 1 / 1 1 / 1 0 / 0 0 / 1 0 / 2 0 / 3 4 / 13 11/22 at Indianapolis 1 / 1 1 / 2 1 / 1 1 / 1 0 / 1 0 / 1 0 / 2 0 / 0 1 / 1 1 / 6 6 / 16 12/31 Chicago ------12/31 Philadelphia ------12/31 at Detroit ------12/31 Carolina ------12/31 Tennessee ------12/31 at Chicago ------TOTALS 10 / 13 8 / 11 2 / 6 2 / 10 6 / 12 6 / 12 3 / 8 3 / 8 2 / 6 3 / 28 45 / 114 76.9% 72.7% 33.3% 20.0% 50.0% 50.0% 37.5% 37.5% 33.3% 10.7% 39.5% 3RD & 1-3: 20 / 30 = 66.7% 3RD & 4-6: 14 / 34 = 41.2% 3RD & 7-10+: 11 / 50 = 22.0%
2020 GREEN BAY PACKERS 48 THIRD-DOWN EFFICIENCY 2020 REGULAR SEASON FOURTH DOWN EFFICIENCY PACKERS OPPONENT Date Opponent 4th & 1 4th & 2 4th & 3 4th & 4 4th & 5+ Total 4th & 1 4th & 2 4th & 3 4th & 4 4th & 5+ Total 09/13 at Minnesota 1 / 2 0 / 0 0 / 0 0 / 0 0 / 0 1 / 2 0 / 0 0 / 0 0 / 1 0 / 0 0 / 0 0 / 1 09/20 Detroit 0 / 0 0 / 0 0 / 0 0 / 0 1 / 1 1 / 1 0 / 0 0 / 0 0 / 0 0 / 0 0 / 1 0 / 1 09/27 at New Orleans 1 / 2 0 / 0 0 / 0 0 / 0 0 / 0 1 / 2 1 / 1 0 / 0 0 / 0 0 / 0 0 / 0 1 / 1 10/05 Atlanta 0 / 1 1 / 1 0 / 0 0 / 0 0 / 0 1 / 2 0 / 0 1 / 1 1 / 1 0 / 0 0 / 2 2 / 4 10/18 at Tampa Bay 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 10/25 at Houston 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 0 / 0 0 / 1 0 / 0 0 / 0 0 / 0 0 / 0 0 / 1 11/01 Minnesota 2 / 2 0 / 0 1 / 1 0 / 0 0 / 2 3 / 5 1 / 1 0 / 0 0 / 0 0 / 0 0 / 0 1 / 1 11/05 at San Francisco 1 / 1 0 / 0 0 / 0 0 / 0 0 / 0 1 / 1 0 / 1 0 / 0 0 / 0 0 / 0 0 / 0 0 / 1 11/15 Jacksonville 0 / 0 0 / 0 0 / 1 0 / 0 0 / 0 0 / 1 0 / 0 0 / 0 0 / 0 0 / 0 0 / 1 0 / 1 11/22 at Indianapolis 0 / 1 0 / 0 0 / 0 0 / 0 0 / 0 0 / 1 1 / 1 0 / 0 0 / 0 1 / 1 0 / 0 2 / 2 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------TOTALS 5 / 9 1 / 1 1 / 2 0 / 0 1 / 3 8 / 15 3 / 5 1 / 1 1 / 2 1 / 1 0 / 4 6 / 13 55.6% 100.0% 50.0% 0.0% 33.3% 53.3% 60.0% 100.0% 50.0% 100.0% 0.0% 46.2%
2020 GREEN BAY PACKERS 49 FOURTH-DOWN EFFICIENCY DATE OPPONENT OFFENSE DEFENSE 09/13 at Minnesota FG - 31 yards TD - Run Downs FG - 35 yards FG - 43 yards TD - Run TD - Pass TD - Pass TD - Pass TD - Run 09/20 Detroit TD - Pass TD - Run TD - Pass TD - Pass Punt FG - 35 yards TD - Run 09/27 at New Orleans FG - 33 yards TD - Pass TD - Pass TD - Pass TD - Run FG - 35 yards TD - Pass FG - 34 yards TD - Pass 10/05 Atlanta TD - Pass FG - 23 yards Downs TD - Run TD - Pass TD - Run TD - Pass 10/18 at Tampa Bay TD - Run TD - Run TD - Pass TD - Pass TD - Run 10/25 at Houston TD - Pass TD - Pass TD - Pass FG - 38 yards TD - Pass FG - 29 yards TD - Run TD - Pass 11/01 Minnesota TD - Pass TD - Run TD - Pass TD - Run TD - Pass 11/05 at San Francisco TD - Pass FG - 22 yards TD - Pass Downs FG - 19 yards TD - Run 11/15 Jacksonville TD - Run TD - Pass FG - 39 yards FG - 31 yards TD - Pass 11/22 at Indianapolis TD - Run TD - Pass TD - Pass FG - 37 yards TD - Pass TD - Pass FG - 26 yards FG - 32 yards 11/29 Chicago -- -- 12/06 Philadelphia -- -- 12/13 at Detroit -- -- 12/20 Carolina -- -- 12/27 Tennessee -- -- 01/03 at Chicago -- --
OFFENSE DEFENSE Inside the 20 38 32 Scores 35 31 Touchdowns 28 21 Field Goals 7 10 Total Points in 20 218 179 Fumbles 0 0 Interceptions 0 0 Missed Field Goals 0 0 Lost on Downs 2 1 End of Half/Game 0 0 TDs Outside 9 7 Red Zone Percentage 75 50
2020 GREEN BAY PACKERS 50 INSIDE THE 20 DATE OPPONENT OFFENSE DEFENSE 09/13 at Minnesota Field Goal - 31 yards TD - Run Lost on Downs TD - Run TD - Pass TD - Pass TD - Run 09/20 Detroit NONE TD - Run TD - Pass 09/27 at New Orleans TD - Pass NONE TD - Run TD - Pass 10/05 Atlanta TD - Pass Field Goal - 23 yards Lost on Downs TD - Run TD - Pass TD - Run 10/18 at Tampa Bay TD - Run TD - Run TD - Pass TD - Run 10/25 at Houston TD - Pass TD - Pass TD - Pass Field Goal - 29 yards TD - Pass TD - Pass TD - Run 11/01 Minnesota TD - Pass TD - Run TD - Pass TD - Run 11/05 at San Francisco TD - Pass Field Goal - 22 yards TD - Pass TD - Run Field Goal - 19 yards 11/15 Jacksonville TD - Run NONE TD - Pass 11/22 at Indianapolis TD - Run Field Goal - 37 yards TD - Pass TD - Pass TD - Pass 11/29 Chicago -- -- 12/06 Philadelphia -- -- 12/13 at Detroit -- -- 12/20 Carolina -- -- 12/27 Tennessee -- -- 01/03 at Chicago -- --
OFFENSE DEFENSE Goal-To-Go Situations 26 19 Scores 24 19 Touchdowns 22 15 Field Goals 2 4 Total Points 161 118 Fumbles 0 0 Interceptions 0 0 Missed Field Goals 0 0 Lost on Downs 2 0 End of Half/Game 0 0 Goal to Go Percentage 100 50
2020 GREEN BAY PACKERS 51 GOAL-TO-GO SITUATIONS 2020 REGULAR SEASON - BIG PLAYS OF 20+ YARDS DATE OPPONENT QTR PACKERS PLAYER RUN PASS DOWN RESULT QTR OPP. PLAYER RUN PASS DOWN RESULT 09/13 at Minnesota 2 Aaron Rodgers -> Davante Adams 24T 2-9-MIN 24 TD 1 Kirk Cousins -> Adam Thielen 25 2-3-MIN 32 TD 2 Aaron Rodgers -> Marquez Valdes-Scantling 45T 2-10-MIN 45 TD 2 Alexander Mattison run 21 1-10-MIN 25 FG 3 Aaron Rodgers -> Marquez Valdes-Scantling 39 3-5-MIN 41 TD 2 Kirk Cousins -> Kyle Rudolph 22 1-10-MIN 46 FG 4 Tyler Ervin run 21 2-2-GB 33 TD 3 Kirk Cousins -> Bisi Johnson 29 1-10-MIN 23 TD 4 Aaron Rodgers -> Allen Lazard 38 3-7-MIN 43 TD 4 Kirk Cousins -> Adam Thielen 37T 1-10-GB 37 TD 4 Aaron Rodgers -> Davante Adams 40 1-20-GB 37 TD 4 Kirk Cousins -> Bisi Johnson 22 1-10-GB 25 TD 09/20 Detroit 2 Aaron Rodgers -> Aaron Jones 22 2-5-GB 39 TD 1 Matthew Stafford -> T.J. Hockenson 29 2-5-DET 30 TD 3 Aaron Jones run 75T 1-10-GB 25 TD 1 Adrian Peterson run 25 2-9-GB 34 TD 3 Aaron Rodgers -> Aaron Jones 30 2-15-GB 34 Punt 4 Matthew Stafford -> Marvin Hall 24T 1-10-GB 24 TD 3 Aaron Rodgers -> Allen Lazard 25 3-2-GB 33 FG 4 Matthew Stafford -> Quintez Cephus 36 1-10-DET 10 Downs 4 Aaron Rodgers -> Marquez Valdes-Scantling 41 3-4-GB 32 TD 09/27 at New Orleans 2 Aaron Rodgers -> Allen Lazard 48 1-10- 50 TD 1 Alvin Kamara run 49 1-10-NO 33 TD 3 Aaron Rodgers -> Allen Lazard 72 3-10-GB 25 TD 2 Drew Brees -> Alvin Kamara 21 3-15-NO 20 FG 4 Aaron Rodgers -> Jace Sternberger 23 1-10-GB 36 TD 3 Drew Brees -> Alvin Kamara 52T 1-10-NO 48 TD 10/05 Atlanta 1 Aaron Rodgers -> Robert Tonyan 27 2-10-GB 27 TD 4 Matt Ryan -> Christian Blake 21 1-10-ATL 34 Downs 1 Aaron Jones run 23 1-10-ATL 29 TD 1 Aaron Rodgers -> Jamaal Williams 29 2-1-GB 43 Downs 2 Aaron Rodgers -> Malik Taylor 20 4-2-ATL 28 TD 3 Aaron Rodgers -> Aaron Jones 23 1-10-GB 49 TD 3 Aaron Rodgers -> Robert Tonyan 21T 3-3-ATL 21 TD 4 Aaron Rodgers -> Robert Tonyan 20 3-1-GB 35 Punt 10/18 at Tampa Bay 1 Aaron Rodgers -> Aaron Jones 20 3-10-GB 25 FG 2 Tom Brady -> Chris Godwin 25 2-8-GB 41 TD 1 Jamaal Williams run 25 1-10-GB 34 TD 3 Tom Brady -> Rob Gronkowski 31 2-6-TB 29 FG 4 AJ Dillon run 20 3-1-GB 21 Punt 3 Ronald Jones II run 25 1-10-TB 35 TD 10/25 at Houston 1 Aaron Rodgers -> Davante Adams 28 3-9-GB 23 TD 2 Deshaun Watson -> Will Fuller V 24 2-2-HOU 22 Miss FG 2 Aaron Rodgers -> Davante Adams 36 2-2-HOU 41 TD 2 Deshaun Watson -> Randall Cobb 28 1-5-GB 49 Miss FG 2 Aaron Rodgers -> Robert Tonyan 31 1-10-GB 17 Punt 3 Deshaun Watson -> Duke Johnson 30 2-1-GB 45 FG 3 Aaron Rodgers -> Davante Adams 45T 3-4-HOU 45 TD 11/01 Minnesota 3 Aaron Rodgers -> Robert Tonyan 45 2-17-GB 18 Downs 1 Dalvin Cook run 21T 1-10-GB 21 TD 4 Aaron Rodgers -> Malik Taylor 26 3-10- 50 TD 3 Dalvin Cook run 37 1-10-MIN 15 TD 4 Aaron Rodgers -> Jace Sternberger 27 1-20-MIN 34 TD 3 Kirk Cousins -> Dalvin Cook 50T 3-9- 50 TD 11/05 at San 1 Aaron Rodgers -> Davante Adams 36T 2-8-SF 36 TD 1 Nick Mullens -> Richie James 43 2-7-SF 23 FG Francisco 2 Aaron Rodgers -> Marquez Valdes-Scantling 52T 1-10-GB 48 TD 3 Nick Mullens -> Richie James 47 2-10-SF 39 Downs 3 Aaron Rodgers -> Davante Adams 49 3-7-GB 23 TD 4 Nick Mullens -> Ross Dwelley 36 1-10-SF 20 TD 3 Aaron Rodgers -> Tyler Ervin 24 1-10-SF 47 FG 4 Nick Mullens -> Richie James 41T 3-7-GB 41 TD 4 Aaron Rodgers -> Davante Adams 34 3-4-GB 11 FG 11/15 Jacksonville 2 Aaron Rodgers -> Marquez Valdes-Scantling 78T 1-10-GB 22 TD 1 James Robinson run 20 2-4-JAX 11 Punt 2 Aaron Rodgers -> Marquez Valdes-Scantling 22 3-6-GB 23 TD 3 Jake Luton -> DJ Chark Jr. 21 1-10-JAX 44 FG 3 Aaron Rodgers -> Davante Adams 22 1-10-GB 2 FUM 3 Aaron Rodgers -> Marquez Valdes-Scantling 31 1-10-GB 20 INT 4 Aaron Rodgers -> Robert Tonyan 23 3-9-GB 26 TD 4 Aaron Jones run 20 2-3-JAX 44 TD 11/22 at Indianapolis 1 Aaron Rodgers -> Davante Adams 33 1-10-GB 21 FUM 1 Philip Rivers -> Michael Pittman Jr. 45T 1-10-GB 45 TD 1 Aaron Rodgers -> Robert Tonyan 25T 2-9-IND 25 TD 2 Philip Rivers -> Zach Pascal 20 3-9-IND 46 TD 2 Aaron Rodgers -> Davante Adams 20 1-10-GB 40 TD 3 Philip Rivers -> T.Y. Hilton 23 1-10-GB 29 TD 2 Aaron Rodgers -> Equanimeous St. Brown 23 1-5-IND 25 TD 4 Philip Rivers -> Zach Pascal 20 1-10- 50 FG 4 Aaron Rodgers -> Marquez Valdes-Scantling 47 3-10-GB 6 FG 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------TOTALS 47 - 1,548 (32.9), 9 TDS (6 RUNS, 1 TD, 41 PASSES, 8 TDS) 33 - 1,000 (30.3), 7 TDS (7 RUNS, 1 TD, 26 PASSES, 6 TDS)
2020 GREEN BAY PACKERS 52 BIG PLAYS OF 20+ YARDS RUSHES RECEPTIONS RETURNS DATE OPPONENT GAIN PLAYER QTR RESULT GAIN PLAYER QTR RESULT GAIN PLAYER QTR RESULT 09/13 at Minnesota 19 Allen Lazard 1 Downs 24t Davante Adams 2 TD 15 Aaron Jones 3 Punt 45t Marquez Valdes-Scantling 2 TD 21 Tyler Ervin 4 TD 39 Marquez Valdes-Scantling 3 TD 12 Tyler Ervin 4 TD 38 Allen Lazard 4 TD 40 Davante Adams 4 TD 09/20 Detroit 12 Aaron Jones 1 FG 22 Aaron Jones 2 TD 11 Jamaal Williams 2 Punt 30 Aaron Jones 3 Punt 13 Jamaal Williams 2 TD 25 Allen Lazard 3 FG 75t Aaron Jones 3 TD 41 Marquez Valdes-Scantling 4 TD 18 Jamaal Williams 3 Punt 11 Aaron Jones 3 FG 14t Aaron Jones 4 TD 12 AJ Dillon 4 Game 09/27 at New Orleans 13 Aaron Rodgers 1 FG 48 Allen Lazard 2 TD 13 Aaron Jones 2 Punt 72 Allen Lazard 3 TD 19 Aaron Jones 4 TD 23 Jace Sternberger 4 TD 10/05 Atlanta 23 Aaron Jones 1 TD 27 Robert Tonyan 1 TD 34 Tyler Ervin (KR) 3 TD 11 Aaron Jones 4' FG 29 Jamaal Williams 1 Downs 12 Aaron Jones 4 FG 20 Malik Taylor 2 TD 23 Aaron Jones 3' TD 21t Robert Tonyan 3' TD 20 Robert Tonyan 4 Punt 10/18 at Tampa Bay 25 Jamaal Williams 1 TD 20 Aaron Jones 1 FG 20 AJ Dillon 4 Punt 10/25 at Houston 13 Jamaal Williams 4 TD 28 Davante Adams 1' TD 36 Davante Adams 2' TD 31 Robert Tonyan 2 Punt 45t Davante Adams 3 TD 11/01 Minnesota 10 Jamaal Williams 1 TD 45 Robert Tonyan 3 Downs 26 Malik Taylor 4' TD 27 Jace Sternberger 4 TD 11/05 at San Francisco 11 Aaron Jones 1 TD 36t Davante Adams 1 TD 11 Aaron Jones 2 TD 52t Marquez Valdes-Scantling 2 TD 49 Davante Adams 3 TD 24 Tyler Ervin 3 FG 34 Davante Adams 4 FG 11/15 Jacksonville 20 Aaron Jones 4 TD 78t Marquez Valdes-Scantling 2 TD 22 Marquez Valdes-Scantling 2 TD 22 Davante Adams 3 Fumble 31 Marquez Valdes-Scantling 3 INT 23 Robert Tonyan 4 TD 11/22 at Indianapolis 15 Aaron Jones 1 INT 33 Davante Adams 1 Fumble 30 Darrius Shepherd (KR) 1 Punt 25t Robert Tonyan 1 TD 20 Davante Adams 2' TD 23 Equanimeous St. Brown 2' TD 47 Marquez Valdes-Scantling 4 FG 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------' - result within the same drive
2020 GREEN BAY PACKERS 53 BIG PLAYS: RUSH 10+, RECEPTIONS 20+, RETURNS 30+ 2020 REGULAR SEASON BIG YARDAGE GAMES 100-YARD PASS RECEIVERS DATE OPPONENT PLAYER REC. YDS. AVG. LG TD 9/13 at Minnesota Davante Adams 14 156 11.1 40 2 9/27 at New Orleans Allen Lazard 6 146 24.3 72 1 10/25 at Houston Davante Adams 13 196 15.1 45T 2 11/5 at San Francisco Davante Adams 10 173 17.3 49 1 11/15 vs. Jacksonville Marquez Valdes-Scantling 4 149 37.3 78T 1 11/22 at Indianapolis Davante Adams 7 106 15.1 33 1
100-YARD RUSHERS DATE OPPONENT PLAYER ATT. YDS. AVG. LG TD 9/20 vs. Detroit Aaron Jones 18 168 9.3 75T 2
300-YARD PASSERS DATE OPPONENT PLAYER ATT. YDS. COMP. LG TD 9/13 at Minnesota Aaron Rodgers 44 364 32 45T 4 10/5 vs. Atlanta Aaron Rodgers 33 327 27 29 4 11/5 at San Francisco Aaron Rodgers 31 305 25 52T 4 11/15 vs. Jacksonville Aaron Rodgers 34 325 24 78T 2 11/22 at Indianapolis Aaron Rodgers 38 311 27 47 3
2020 OPPONENTS BIG YARDAGE GAMES 100-YARD PASS RECEIVERS DATE OPPONENT PLAYER REC. YDS. AVG. LG TD 9/13 at Minnesota Adam Thielen 6 110 18.3 37T 2 9/27 at New Orleans Alvin Kamara 13 139 10.7 52T 2 11/5 at San Francisco Richie James 9 184 20.4 47 1
100-YARD RUSHERS DATE OPPONENT PLAYER ATT. YDS. AVG. LG TD 10/18 at Tampa Bay Ronald Jones II 23 113 4.9 25 2 11/1 vs. Minnesota Dalvin Cook 30 163 5.4 37 3 11/15 vs. Jacksonville James Robinson 23 109 4.7 20 0
300-YARD PASSERS DATE OPPONENT PLAYER ATT. YDS. COMP. LG TD 10/25 at Houston Deshaun Watson 39 309 29 30 2
2020 GREEN BAY PACKERS 54 BIG-YARDAGE GAMES 2020 REGULAR SEASON Date Opponent Quarterback Loss 0-9 10-19 20-29 30-39 40-49 50+ 09/13 at Minnesota Rodgers 2 18 (2) 7 1 (1) 2 2 (1) -- 09/20 Detroit Rodgers 1 5 (1) 7 (1) 3 1 1 -- 09/27 at New Orleans Rodgers -- 12 (2) 6 (1) 1 -- 1 1 10/05 Atlanta Rodgers 1 13 (2) 7 (1) 6 (1) ------10/18 at Tampa Bay Rodgers 1 7 7 1 ------10/25 at Houston Rodgers 1 13 (3) 4 1 3 1 (1) -- 11/01 Minnesota Rodgers -- 17 (3) 7 2 -- 1 -- 11/05 at San Francisco Rodgers 1 15 (2) 4 1 2 (1) 1 1 (1) 11/15 Jacksonville Rodgers 1 10 (1) 8 3 1 -- 1 (1) 11/22 at Indianapolis Rodgers 1 15 (2) 6 3 (1) 1 1 -- 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------PLAYER TOTALS Rodgers 9 125 (18) 63 (3) 22 (3) 10 (1) 8 (2) 3 (2) TEAM TOTALS 9 125 (18) 63 (3) 22 (3) 10 (1) 8 (2) 3 (2)
2020 GREEN BAY PACKERS 55 COMPLETIONS BY DISTANCE 2020 REGULAR SEASON GREEN BAY PACKERS WEEK-BY-WEEK LEADERS (THROUGH WEEK 11) RUSHING SCORING PASSING YARDS CARRIES YARDS RECEPTIONS RECEIVING YARDS TACKLES SOLO TACKLES SACKS DATE OPPONENT PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. 09/13 at Minnesota D. Adams 12 A. Rodgers 364 A. Jones 16 A. Jones 66 D. Adams 14 D. Adams 156 C. Kirksey 12 C. Kirksey 6 J. 1.0 Alexander Z. Smith 09/20 Detroit A. Jones 18 A. Rodgers 240 A. Jones 18 A. Jones 168 A. Jones 4 A. Jones 68 C. Kirksey 12 C. Kirksey 10 R. Gary 1.5 09/27 at New Orleans M. Crosby 13 A. Rodgers 283 A. Jones 16 A. Jones 69 A. Lazard 6 A. Lazard 146 T. 9 T. Summers 6 K. Keke 2.0 Summers 10/05 Atlanta R. Tonyan 18 A. Rodgers 327 A. Jones 15 A. Jones 71 J. 8 R. Tonyan 98 Z. Smith 8 Z. Smith 6 Z. Smith 3.0 Williams T. Summers 10/18 at Tampa Bay A. Jones 6 A. Rodgers 160 A. Jones 10 J. 34 D. Adams 6 D. Adams 61 K. Barnes 10 K. Barnes 7 -- Williams 10/25 at Houston D. Adams 12 A. Rodgers 283 J. 19 J. 77 D. Adams 13 D. Adams 196 K. Barnes 8 K. Martin 6 K. Barnes 1.0 Williams Williams A. Amos Z. Smith 11/01 Minnesota D. Adams 18 A. Rodgers 291 J. 16 J. 75 D. Adams 7 R. Tonyan 79 A. Amos 7 A. Amos 6 D. Lowry 1.0 Williams Williams 11/05 at San Francisco M. Valdes- 12 A. Rodgers 305 A. Jones 15 A. Jones 58 D. Adams 10 D. Adams 173 A. Amos 5 A. Amos 5 Z. Smith 1.0 Scantling O. Burks 11/15 Jacksonville A. Rodgers 6 A. Rodgers 325 A. Jones 13 A. Jones 46 D. Adams 8 M. Valdes- 149 C. Kirksey 7 C. Sullivan 6 P. Smith 1.0 D. Adams Scantling Z. Smith M. Valdes- R. Gary Scantling M. Crosby 11/22 at Indianapolis M. Crosby 7 A. Rodgers 311 A. Jones 10 A. Jones 41 D. Adams 7 D. Adams 106 C. Kirksey 11 R. Greene 7 K. Clark 1.0 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------MOST TIMES LED D. ADAMS 4 A. 10 A. JONES 8 A. JONES 7 D. 7 D. ADAMS 5 C. 4 C. KIRKSEY 2 Z. SMITH 5 (INCLUDING TIES) RODGERS ADAMS KIRKSEY T. SUMMERS A. AMOS
OPPONENTS PASSING SCORING YARDS CARRIES RUSHING YARDS RECEPTIONS RECEIVING YARDS TACKLES SOLO TACKLES SACKS DATE OPPONENT PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. PLAYER NO. 09/13 at Minnesota D. Cook 16 K. 259 D. Cook 12 D. Cook 50 A. Thielen 6 A. Thielen 110 E. Kendricks 11 E. 7 -- Cousins A. Mattison Kendricks H. Hill 09/20 Detroit K. Johnson 6 M. 244 K. Johnson 8 A. Peterson 41 D. Swift 5 T. Hockenson 62 J. Okudah 7 J. Okudah 7 J. Collins Sr. 1.0 M. Jones Jr. Stafford M. Hall 09/27 at New Orleans A. Kamara 12 D. Brees 288 L. Murray 12 L. Murray 58 A. Kamara 13 A. Kamara 139 M. Jenkins 9 M. Jenkins 7 D. Davis 1.0 W. Lutz A. Kamara 10/05 Atlanta T. Gurley II 12 M. Ryan 285 T. Gurley II 16 T. Gurley II 57 O. Zaccheaus 8 O. Zaccheaus 86 D. Jones 8 D. Jones 6 C. Harris 1.0 F. Oluokun K. Sheffield 10/18 at Tampa Bay R. Jones II 12 T. Brady 166 R. Jones II 23 R. Jones II 113 C. Godwin 5 R. 78 D. White 10 D. White 9 L. David 1.5 R. Gronkowski J. Pierre- Gronkowski Paul 10/25 at Houston K. Fairbairn 8 D. Watson 309 D. Johnson 14 D. Johnson 42 R. Cobb 8 R. Cobb 95 Z. 11 T. Adams 5 -- Cunningham 11/01 Minnesota D. Cook 24 K. 160 D. Cook 30 D. Cook 163 A. Thielen 3 D. Cook 63 E. Kendricks 12 E. 8 D. Wonnum 1.0 Cousins J. Jefferson Kendricks 11/05 at San Francisco J. McKinnon 6 N. 291 J. 12 J. 52 R. James 9 R. James 184 F. Warner 13 F. Warner 8 J. Willis 1.0 R. James Mullens McKinnon McKinnon 11/15 Jacksonville K. Cole 12 J. Luton 169 J. Robinson 23 J. Robinson 109 K. Cole 5 D. Chark Jr. 56 S. Jones 9 S. Jones 6 D. Hamilton 1.0 J. Schobert 11/22 at Indianapolis R. 14 P. Rivers 288 J. Taylor 22 J. Taylor 90 J. Taylor 4 M. Pittman Jr. 66 K. Moore II 10 K. Moore II 10 J. Houston 1.0 Blankenship 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------
2020 GREEN BAY PACKERS 56 WEEKLY INDIVIDUAL STATISTICAL LEADERS 2020 REGULAR SEASON - DEFENSIVE TAKEAWAYS DATE OPPONENT TAKEAWAY QTR. SCORE YD-LINE RESULT 09/13 at Minnesota J. Alexander INT (K. Cousins) 2 15-7 MIN-41 TD 09/20 Detroit C. Sullivan INT (M. Stafford) 3 42-21 DET-7 TD 09/27 at New Orleans Z. Smith FR (Z. Smith FF) 4 27-27 GB-43 FG 10/05 Atlanta None 10/18 at Tampa Bay None 10/25 at Houston A. Amos FR (H. Black FF) 4 35-20 GB-32 EOG 11/01 Minnesota None 11/05 at San Francisco R. Greene INT (N. Mullens) 2 7-3 GB-45 TD Z. Smith FR (Z. Smith FF) 3 28-3 SF-47 FG 11/15 Jacksonville A. Amos INT (J. Luton) 2 14-10 JAX-49 FG 11/22 at Indianapolis D. Savage FR (R. Greene FF) 1 0-0 GB-49 TD C. Kirksey INT (P. Rivers) 2 14-7 IND-37 TD 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------
2020 REGULAR SEASON - OFFENSIVE GIVEAWAYS DATE OPPONENT GIVEAWAY QTR. SCORE YD-LINE RESULT 9/13 at Minnesota None 9/20 Detroit None 9/27 at New Orleans None 10/5 Atlanta None 10/18 at Tampa Bay A. Rodgers INT (J. Dean) 2 10-7 GB-32 TD A. Rodgers INT (M. Edwards) 2 10-31 GB-39 TD 10/25 at Houston None 11/1 Minnesota A. Rodgers fumble (D. Wonnum FF; E. Wilson FR) 4 22-28 MIN-24 EOG 11/5 at San Francisco None 11/15 Jacksonville D. Adams fumble (C. Henderson FF; M. Jack FR) 3 17-10 GB-32 TD A. Rodgers INT (S. Jones) 3 17-17 JAX-43 FG 11/22 at Indianapolis A. Rodgers fumble (D. Leonard FR) 1 0-0 IND-39 Fumble A. Rodgers INT (R. Ya-Sin) 1 7-7 GB-35 Missed FG M. Valdes-Scantling fumble (J. Blackmon FF; D. Buckner FR) 5 31-31 GB-29 FG 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------
2020 REGULAR SEASON - SPECIAL TEAMS/MISC GIVEAWAYS DATE OPPONENT GIVEAWAY QTR. SCORE YD-LINE RESULT 11/22 at Indianapolis D. Shepherd fumble (C. Marsh FF; T. Wilson FR) 4 28-28 GB-28 FG
2020 REGULAR SEASON - TURNOVERS Offense: 8 Giveaways 27 Points (3 TD, 2 FG) Ratio Defense: 9 Takeaways 0 (9 takes, 9 gives) 44 Points (5 TD, 3 FG) Special 1 Giveaway Teams: 3 Points (0 TD, 1 FG) Points Off Turnovers Ratio 0 Takeaways +14 (44 scored, 30 allowed) 0 Points (0 TD, 0 FG)
2020 GREEN BAY PACKERS 57 TURNOVER CHART GB +/- GB POINTS OFF GB POINTS OFF POINTS OFF DATE OPPONENT RATIO TAKES TAKES GIVES GIVES TO RATIO 09/13 at Minnesota +1 1 (0 FUM, 1 INT) 7 0 (0 FUM, 0 INT) 0 +7 09/20 Detroit +1 1 (0 FUM, 1 INT) 7 0 (0 FUM, 0 INT) 0 +7 09/27 at New Orleans +1 1 (1 FUM, 0 INT) 3 0 (0 FUM, 0 INT) 0 +3 10/05 Atlanta 0 0 (0 FUM, 0 INT) 0 0 (0 FUM, 0 INT) 0 0 10/18 at Tampa Bay -2 0 (0 FUM, 0 INT) 0 2 (0 FUM, 2 INT) 14 -14 10/25 at Houston +1 1 (1 FUM, 0 INT) 0 0 (0 FUM, 0 INT) 0 0 11/01 Minnesota -1 0 (0 FUM, 0 INT) 0 1 (1 FUM, 0 INT) 0 0 11/05 at San Francisco +2 2 (1 FUM, 1 INT) 10 0 (0 FUM, 0 INT) 0 +10 11/15 Jacksonville -1 1 (0 FUM, 1 INT) 3 2 (1 FUM, 1 INT) 10 -7 11/22 at Indianapolis -2 2 (1 FUM, 1 INT) 14 4 (3 FUM, 1 INT) 6 +8 11/29 Chicago ------12/06 Philadelphia ------12/13 at Detroit ------12/20 Carolina ------12/27 Tennessee ------01/03 at Chicago ------TOTALS 0 9 (4 FUM, 5 INT) 44 9 (5 FUM, 4 INT) 30 +14
2020 GREEN BAY PACKERS 58 TAKEAWAY/GIVEAWAY CHART 2020 REGULAR SEASON GREEN BAY PACKERS OFFENSIVE HIGHS AND LOWS (THROUGH WEEK 11) HIGH DATE OPPONENT CATEGORY OPPONENT DATE LOW 43 9/13 at Minnesota Points at Tampa Bay 10/18 10 21 11/22 at Indianapolis Points in a Quarter at Tampa Bay 10/18 0 vs. Minnesota 11/1 vs. Jacksonville 11/15 at Indianapolis 11/22 28 11/22 at Indianapolis Points in a Half at Tampa Bay 10/18 0 5 9/13 at Minnesota Total Touchdowns at Tampa Bay 10/18 1 76 9/13 at Minnesota Total Plays at Indianapolis 11/22 57 522 9/13 at Minnesota Total Net Yards at Tampa Bay 10/18 201 31 9/13 at Minnesota Total First Downs at Tampa Bay 10/18 13 11 9/13 at Minnesota First Downs Rushing vs. Jacksonville 11/15 3 17 9/13 at Minnesota First Downs Passing at Tampa Bay 10/18 9 4 9/20 vs. Detroit First Down Penalties at Tampa Bay 10/18 0 58.3% 10/25 at Houston Third Down Efficiency vs. Jacksonville 11/15 38.5% 7.4 9/20 vs. Detroit Average Yards Per Play at Tampa Bay 10/18 3.3 259 9/20 vs. Detroit Total Net Yards Rushing at Indianapolis 11/22 66 35 9/20 vs. Detroit Rushing Attempts at Indianapolis 11/22 18 7.4 9/20 vs. Detroit Rushing Average Yards vs. Jacksonville 11/15 3.2 2 9/20 vs. Detroit Rushing Touchdowns vs. Atlanta 10/5 0 vs. Minnesota 11/1 at San Francisco 11/5 364 9/13 at Minnesota Total Net Yards Passing at Tampa Bay 10/18 107 44 9/13 at Minnesota Passing Attempts vs. Detroit 9/20 30 32 9/13 at Minnesota Passing Completions at Tampa Bay 10/18 16 4 9/13 at Minnesota Passing Touchdowns at Tampa Bay 10/18 0 9.3 10/5 vs. Atlanta Passing Yards Average at Tampa Bay 10/18 2.7 2 10/18 at Tampa Bay Passes Thrown for Interception at Minnesota 9/13 0 vs. Detroit 9/20 at New Orleans 9/27 vs. Atlanta 10/5 at Houston 10/25 vs. Minnesota 11/1 ...1 more at 0. 5 10/18 at Tampa Bay Times Sacked at Minnesota 9/13 0 at Houston 10/25 5 10/18 at Tampa Bay QB Sacks at Minnesota 9/13 0 at Houston 10/25 53 10/18 at Tampa Bay Sack Yards Lost at Minnesota 9/13 0 at Houston 10/25 vs. Minnesota 11/1 7 10/18 at Tampa Bay Total Punts at Minnesota 9/13 1 at New Orleans 9/27 vs. Minnesota 11/1 325 10/18 at Tampa Bay Total Punt Yards at New Orleans 9/27 38 vs. Minnesota 11/1 51.3 11/5 at San Francisco Punt Gross Average Yards at New Orleans 9/27 38 vs. Minnesota 11/1 42.7 9/20 vs. Detroit Punt Net Average Yards vs. Jacksonville 11/15 20.4 2 9/20 vs. Detroit Punt Returns at New Orleans 9/27 0 at Tampa Bay 10/18 at San Francisco 11/5 at Indianapolis 11/22 11 10/5 vs. Atlanta Punt Return Yards at Minnesota 9/13 0 at New Orleans 9/27 at Tampa Bay 10/18 at San Francisco 11/5 at Indianapolis 11/22 11.0 10/5 vs. Atlanta Punt Return Yards Average at Minnesota 9/13 0.0 at New Orleans 9/27 at Tampa Bay 10/18 at San Francisco 11/5 at Indianapolis 11/22 7 11/22 at Indianapolis Kickoff Returns at Tampa Bay 10/18 0 138 11/22 at Indianapolis Kickoff Return Yards at Tampa Bay 10/18 0 9 11/1 vs. Minnesota Total Penalties at New Orleans 9/27 2 85 11/1 vs. Minnesota Penalty Yards at New Orleans 9/27 10 3 11/22 at Indianapolis Total Fumbles vs. Detroit 9/20 0 at New Orleans 9/27 vs. Atlanta 10/5 at Houston 10/25 at San Francisco 11/5 3 11/22 at Indianapolis Fumbles Lost at Minnesota 9/13 0 vs. Detroit 9/20 at New Orleans 9/27 vs. Atlanta 10/5 at Tampa Bay 10/18 at Houston 10/25 ...1 more at 0. 41:16 9/13 at Minnesota Time of Possession at Indianapolis 11/22 27:49 4 11/22 at Indianapolis Turnovers at Minnesota 9/13 0 vs. Detroit 9/20 at New Orleans 9/27 vs. Atlanta 10/5 at Houston 10/25 at San Francisco 11/5
2020 REGULAR SEASON GREEN BAY PACKERS DEFENSIVE HIGHS AND LOWS (THROUGH WEEK 11) HIGH DATE OPPONENT CATEGORY OPPONENT DATE LOW 38 10/18 at Tampa Bay Points vs. Atlanta 10/5 16 28 10/18 at Tampa Bay Points in a Quarter at Minnesota 9/13 0 vs. Detroit 9/20 vs. Atlanta 10/5 at Tampa Bay 10/18 at Houston 10/25 vs. Minnesota 11/1 ...1 more at 0. 28 10/18 at Tampa Bay Points in a Half at Houston 10/25 0 5 10/18 at Tampa Bay Total Touchdowns vs. Atlanta 10/5 2 at Houston 10/25 at San Francisco 11/5 vs. Jacksonville 11/15 74 11/22 at Indianapolis Total Plays at Minnesota 9/13 49 vs. Minnesota 11/1 420 11/22 at Indianapolis Total Net Yards vs. Jacksonville 11/15 260 25 9/13 at Minnesota Total First Downs vs. Jacksonville 11/15 16
2020 GREEN BAY PACKERS 59 TEAM HIGHS AND LOWS 11 11/1 vs. Minnesota First Downs Rushing at Houston 10/25 4 15 10/5 vs. Atlanta First Downs Passing vs. Minnesota 11/1 6 3 9/13 at Minnesota First Down Penalties vs. Detroit 9/20 1 vs. Atlanta 10/5 at Houston 10/25 vs. Jacksonville 11/15 at Indianapolis 11/22 50.0% 9/13 at Minnesota Third Down Efficiency vs. Atlanta 10/5 25.0% 7.8 9/13 at Minnesota Average Yards Per Play vs. Jacksonville 11/15 4.3 173 11/1 vs. Minnesota Total Net Yards Rushing at San Francisco 11/5 55 37 11/22 at Indianapolis Rushing Attempts at San Francisco 11/5 17 6.1 9/13 at Minnesota Rushing Average Yards vs. Atlanta 10/5 3.1 3 11/1 vs. Minnesota Rushing Touchdowns at New Orleans 9/27 0 at Houston 10/25 vs. Jacksonville 11/15 at Indianapolis 11/22 286 10/25 at Houston Total Net Yards Passing vs. Minnesota 11/1 151 vs. Jacksonville 11/15 39 10/5 vs. Atlanta Passing Attempts vs. Minnesota 11/1 14 29 9/27 at New Orleans Passing Completions vs. Minnesota 11/1 11 3 9/27 at New Orleans Passing Touchdowns vs. Atlanta 10/5 0 10.1 11/1 vs. Minnesota Passing Yards Average vs. Jacksonville 11/15 4 1 9/13 at Minnesota Passes Thrown for Interception at New Orleans 9/27 0 vs. Atlanta 10/5 at Tampa Bay 10/18 at Houston 10/25 vs. Minnesota 11/1 4 9/20 vs. Detroit Times Sacked at Tampa Bay 10/18 0 4 9/20 vs. Detroit QB Sacks at Tampa Bay 10/18 0 36 10/5 vs. Atlanta Sack Yards Lost at Tampa Bay 10/18 0 6 11/15 vs. Jacksonville Total Punts at Minnesota 9/13 2 at Indianapolis 11/22 275 11/15 vs. Jacksonville Total Punt Yards at Indianapolis 11/22 71 54.8 11/5 at San Francisco Punt Gross Average Yards at Indianapolis 11/22 35.5 53 9/20 vs. Detroit Punt Net Average Yards vs. Minnesota 11/1 34.7 4 10/18 at Tampa Bay Punt Returns at Minnesota 9/13 0 vs. Detroit 9/20 vs. Atlanta 10/5 vs. Minnesota 11/1 113 11/15 vs. Jacksonville Punt Return Yards at Minnesota 9/13 0 vs. Detroit 9/20 vs. Atlanta 10/5 vs. Minnesota 11/1 37.7 11/15 vs. Jacksonville Punt Return Yards Average at Minnesota 9/13 0.0 vs. Detroit 9/20 vs. Atlanta 10/5 vs. Minnesota 11/1 6 11/5 at San Francisco Kickoff Returns at Houston 10/25 0 135 11/5 at San Francisco Kickoff Return Yards at Houston 10/25 0 8 9/27 at New Orleans Total Penalties at Tampa Bay 10/18 0 116 11/22 at Indianapolis Penalty Yards at Tampa Bay 10/18 0 3 9/27 at New Orleans Total Fumbles at Minnesota 9/13 0 vs. Detroit 9/20 vs. Atlanta 10/5 at Tampa Bay 10/18 vs. Minnesota 11/1 vs. Jacksonville 11/15 1 9/27 at New Orleans Fumbles Lost at Minnesota 9/13 0 vs. Detroit 9/20 vs. Atlanta 10/5 at Tampa Bay 10/18 vs. Minnesota 11/1 vs. Jacksonville 11/15 35:01 11/22 at Indianapolis Time of Possession at Minnesota 9/13 18:44 2 11/5 at San Francisco Turnovers vs. Atlanta 10/5 0 at Tampa Bay 10/18 vs. Minnesota 11/1
2020 GREEN BAY PACKERS 60 TEAM HIGHS AND LOWS 2020 REGULAR SEASON PACKERS INDIVIDUAL SINGLE-GAME HIGHS Touchdowns 3 Davante Adams vs. Vikings 11/01 4 Dalvin Cook vs. Vikings 11/01 Robert Tonyan vs. Falcons 10/05 Aaron Jones vs. Lions 09/20 Passes Attempted 44 Aaron Rodgers at Vikings 09/13 39 Deshaun Watson at Texans 10/25 Matt Ryan vs. Falcons 10/05 Passes Completed 32 Aaron Rodgers at Vikings 09/13 29 Deshaun Watson at Texans 10/25 Drew Brees at Saints 09/27 Completion Percentage 81.8 Aaron Rodgers vs. Falcons 10/05 80.5 Drew Brees at Saints 09/27 Passing Yards 364 Aaron Rodgers at Vikings 09/13 309 Deshaun Watson at Texans 10/25 Yards Per Attempt 9.9 Aaron Rodgers vs. Falcons 10/05 11.4 Kirk Cousins vs. Vikings 11/01 Touchdown Passes 4 Aaron Rodgers at 49ers 11/05 3 Philip Rivers at Colts 11/22 Aaron Rodgers at Texans 10/25 Drew Brees at Saints 09/27 Aaron Rodgers vs. Falcons 10/05 Aaron Rodgers at Vikings 09/13 Pass Receptions 14 Davante Adams at Vikings 09/13 13 Alvin Kamara at Saints 09/27 Receiving Yards 196 Davante Adams at Texans 10/25 184 Richie James at 49ers 11/05 Touchdown Receptions 3 Davante Adams vs. Vikings 11/01 2 Alvin Kamara at Saints 09/27 Robert Tonyan vs. Falcons 10/05 Adam Thielen at Vikings 09/13 Rushing Yards 168 Aaron Jones vs. Lions 09/20 163 Dalvin Cook vs. Vikings 11/01 Rushing Attempts 19 Jamaal Williams at Texans 10/25 30 Dalvin Cook vs. Vikings 11/01 Rushing Average 9.3 Aaron Jones vs. Lions 09/20 5.9 Adrian Peterson vs. Lions 09/20 Rushing Touchdowns 2 Aaron Jones vs. Lions 09/20 3 Dalvin Cook vs. Vikings 11/01 Yards From Scrimmage 236 Aaron Jones vs. Lions 09/20 226 Dalvin Cook vs. Vikings 11/01 Combined Net Yards 236 Aaron Jones vs. Lions 09/20 226 Dalvin Cook vs. Vikings 11/01 Interceptions Made 1 Christian Kirksey at Colts 11/22 1 Rock Ya-Sin at Colts 11/22 Adrian Amos vs. Jaguars 11/15 Sidney Jones vs. Jaguars 11/15 Raven Greene at 49ers 11/05 Jamel Dean at Buccaneers 10/18 Chandon Sullivan vs. Lions 09/20 Mike Edwards at Buccaneers 10/18 Jaire Alexander at Vikings 09/13 Interceptions Thrown 2 Aaron Rodgers at Buccaneers 10/18 1 Philip Rivers at Colts 11/22 Jake Luton vs. Jaguars 11/15 Nick Mullens at 49ers 11/05 Matthew Stafford vs. Lions 09/20 Kirk Cousins at Vikings 09/13 INT Return Yards 23 Adrian Amos vs. Jaguars 11/15 37 Mike Edwards at Buccaneers 10/18 Tackles 12 Christian Kirksey vs. Lions 09/20 13 Fred Warner at 49ers 11/05 Christian Kirksey at Vikings 09/13 Sacks 3.0 Za'Darius Smith vs. Falcons 10/05 1.5 Lavonte David at Buccaneers 10/18 Jason Pierre-Paul at Buccaneers 10/18 Punts 7 JK Scott at Buccaneers 10/18 6 Logan Cooke vs. Jaguars 11/15 Punts Inside the 20 3 JK Scott vs. Lions 09/20 4 Logan Cooke vs. Jaguars 11/15 Punting Average 51.8 JK Scott at Texans 10/25 54.8 Mitch Wishnowsky at 49ers 11/05 Punt Returns 1 Josh Jackson vs. Jaguars 11/15 4 Jaydon Mickens at Buccaneers 10/18 Tyler Ervin vs. Vikings 11/01 Darrius Shepherd at Texans 10/25 Tyler Ervin vs. Falcons 10/05 Tyler Ervin vs. Lions 09/20 Josh Jackson vs. Lions 09/20 Tyler Ervin at Vikings 09/13 Punt Return Yards 11 Tyler Ervin vs. Falcons 10/05 113 Keelan Cole vs. Jaguars 11/15 Kickoff Returns 7 Darrius Shepherd at Colts 11/22 3 Tremon Smith at Colts 11/22 Austin Walter at 49ers 11/05 Deonte Harris at Saints 09/27 Kickoff Return Yards 138 Darrius Shepherd at Colts 11/22 78 Deonte Harris at Saints 09/27 Field Goals Attempted 3 Mason Crosby at Saints 09/27 5 Rodrigo Blankenship at Colts 11/22 Field Goals Made 3 Mason Crosby at Saints 09/27 4 Rodrigo Blankenship at Colts 11/22
2020 REGULAR SEASON GREEN BAY PACKERS LONGEST PLAYS Run From Scrimmage 75 Aaron Jones vs. Lions 09/20 49 Alvin Kamara at Saints 09/27 Touchdown Run 75 Aaron Jones vs. Lions 09/20 21 Dalvin Cook vs. Vikings 11/01 Passing Long 78 Aaron Rodgers vs. Jaguars 11/15 52 Drew Brees at Saints 09/27 Touchdown Pass Long 78 Aaron Rodgers vs. Jaguars 11/15 52 Drew Brees at Saints 09/27 Pass Reception 78 Marquez Valdes-Scantling vs. Jaguars 11/15 52 Alvin Kamara at Saints 09/27 Touchdown Reception 78 Marquez Valdes-Scantling vs. Jaguars 11/15 52 Alvin Kamara at Saints 09/27 Interception Return 23 Adrian Amos vs. Jaguars 11/15 37 Mike Edwards at Buccaneers 10/18 Longest INT Return for TD 7 Chandon Sullivan vs. Lions 09/20 32 Jamel Dean at Buccaneers 10/18 Longest Opponent’s Fumble Return 16 Myles Jack vs. Jaguars 11/15 Punt Return 11 Tyler Ervin vs. Falcons 10/05 91 Keelan Cole vs. Jaguars 11/15 Kickoff Return 34 Tyler Ervin vs. Falcons 10/05 38 K.J. Osborn at Vikings 09/13 Punt 62 JK Scott at Texans 10/25 67 Bryan Anger at Texans 10/25 Jack Fox vs. Lions 09/20 Field Goal 53 Mason Crosby at 49ers 11/05 52 Chase McLaughlin vs. Jaguars 11/15 Field Goal Attempt 53 Mason Crosby at 49ers 11/05 57 Matt Prater vs. Lions 09/20
2020 GREEN BAY PACKERS 61 INDIVIDUAL SINGLE-GAME HIGHS PACKERS REGULAR SEASON RECORD WHEN... 2020 2020 SEASON FROM 1992 SEASON FROM 1992 CATEGORY W-L-T W-L-T CATEGORY W-L-T W-L-T PACKERS AT LAMBEAU FIELD 3-1 171-55-2 ON SUNDAY NIGHT 1-0 28-15 PACKERS ON THE ROAD 4-2 116-114 ON THURSDAY NIGHT 1-0 13-10 PACKERS ON GRASS 4-2 234-101-2 ON MONDAY NIGHT 1-0 28-22 PACKERS ON ARTIFICIAL TURF 3-1 53-68 ON SATURDAY 0-0 4-1 PACKERS IN DOMES 0-0 40-42 PACKERS OUTDOORS 0-0 240-124-2 KICKOFF AT 12:00 CST 4-1 156-84-2 KICKOFF AT 3:00/3:05/3:15/3:35 CST 0-2 57-37 PACKERS SCORE FIRST 5-3 190-65-2 OPPONENT SCORES FIRST 2-0 95-104 VS. NFC 5-2 218-123-2 VS. NFC NORTH OVERALL 2-1 126-63-2 PACKERS LEAD AFTER 1ST QUARTER 3-1 163-44-1 VS. NFC NORTH AT HOME 1-1 73-21-2 PACKERS TRAIL AFTER 1ST QUARTER 4-0 55-80 VS. NFC NORTH ON THE ROAD 1-0 53-42 PACKERS LEAD AT HALFTIME 6-1 221-42-2 VS. AFC 2-1 69-46 PACKERS TRAIL AT HALFTIME 1-1 53-108-1 SCORE TIED AT HALFTIME 0-1 13-18 OPPONENTS HAVE 100-YARD RUSHER 1-2 51-56-1 PACKERS LEAD AFTER 3RD QUARTER 5-1 240-29-2 WITH A 300-YARD PASSER 4-1 82-40 PACKERS TRAIL AFTER 3RD QUARTER 0-2 31-132-1 VERSUS A 100-YARD RECEIVER 3-0 90-64-2 GAME GOES TO OVERTIME 0-1 10-9-2 VERSUS A 300-YARD PASSER 1-0 47-32-2 WITH A 100-YARD RECEIVER 5-1 53-40 PACKERS HAVE 100-YARD RUSHER 1-0 79-20-1 OPPONENTS HAVE 1 100-YARD RECEIVER 3-0 35-45 PACKERS HAVE 300 NET PASSING YARDS 3-1 81-40 PACKERS HAVE 1 100-YARD RECEIVER 5-1 135-58
2020 GREEN BAY PACKERS 62 TEAM RECORD WHEN... BY PACKERS BY OPPONENT RUSHING * Never Has Happened * 300 YARDS RUSHING * Never Has Happened *
218 yards, Ahman Green vs. Denver, 12/28/03 200 YARDS RUSHING 210 yards, Adrian Peterson vs. Minnesota, 12/02/12
168 yards, Aaron Jones vs. Detroit, 09/20/20 109 yards, James Robinson vs. Jacksonville, 100 YARDS RUSHING 11/15/20
106 yards/106 yards, DeShawn Wynn/Ryan Grant * Never Has Happened * vs. Detroit, 12/28/08 TWO 100-YARD RUSHERS
* Never Has Happened * FIVE TOUCHDOWNS RUSHING * Never Has Happened *
4 tds, Aaron Jones: (3, 5, 1, 18) @ Dallas, 10/06/19 4 tds, DeAngelo Williams: (1, 1, 1, 1) vs. Carolina, FOUR TOUCHDOWNS RUSHING 11/30/08
3 tds, Aaron Jones: (5, 1, 13) vs. Carolina, 11/10/19 THREE TOUCHDOWNS RUSHING 3 tds, Dalvin Cook: (21, 1, 1) vs. Minnesota, 11/01/20
2 tds, Aaron Jones: (75, 14) vs. Detroit, 09/20/20 TWO TOUCHDOWNS RUSHING 2 tds, Ronald Jones II: (2, 1) @ Tampa Bay, 10/18/20
Brandon Jackson: (6, 4)/Ryan Grant: (3, 56) vs. Seattle, * Never Has Happened * 12/27/09 TWO PLAYERS WITH TWO TD RUSHING
* Never Has Happened * THREE PLAYERS WITH ONE TD RUSHING * Never Has Happened *
58 yards, Aaron Jones @ San Francisco, 11/05/20 52 yards, Jerick McKinnon @ San Francisco, 50-74 YARD RUSHING 11/05/20
75 yards, Jamaal Williams vs. Minnesota, 11/01/20 75+ YARD RUSHING 90 yards, Jonathan Taylor @ Indianapolis, 11/22/20
259 yards, Green Bay 42, Detroit 21 vs. Detroit, 235 yards, Green Bay 38, Chicago 17 @ Chicago, 09/20/20 200-299 YARDS RUSHING (TEAM) 09/28/14
259 yards, Green Bay 42, Detroit 21 vs. Detroit, 235 yards, Green Bay 38, Chicago 17 @ Chicago, 09/20/20 200+ YARDS RUSHING (TEAM) 09/28/14
* Never Has Happened * 300+ YARDS RUSHING (TEAM) * Never Has Happened * RECEIVING 132 yards/104/103 yards, Davante Adams/Jimmy 125 yards/118 yards, Allen Robinson II/Anthony Graham/Marquez Valdes-Scantling vs. San TWO 100-YARD RECEIVERS Miller vs. Chicago, 12/15/19 Francisco, 10/15/18
209 yards, Jordy Nelson vs. N.Y. Jets, 09/14/14 200 YARDS RECEIVING 226 yards, Amari Cooper @ Dallas, 10/06/19
106 yards, Davante Adams @ Indianapolis, 11/22/20 100 YARDS RECEIVING 184 yards, Richie James @ San Francisco, 11/05/20
* Never Has Happened * FIVE TOUCHDOWN RECEPTIONS * Never Has Happened *
* Never Has Happened * FOUR TOUCHDOWN RECEPTIONS * Never Has Happened *
3 tds, Davante Adams: (5, 1, 7) vs. Minnesota, 3 tds, Vincent Jackson: (23, 5, 29) @ San Diego, 11/01/20 THREE TOUCHDOWN RECEPTIONS 11/06/11
2 tds, Marquez Valdes-Scantling: (52, 1) @ San 2 tds, Alvin Kamara: (11, 52) @ New Orleans, Francisco, 11/05/20 TWO TOUCHDOWN RECEPTIONS 09/27/20
Jordy Nelson: (3, 11)/Randall Cobb: (22, 3) @ Chicago, * Never Has Happened * 09/28/14 TWO PLAYERS WITH TWO TD RECEPTIONS PASSING * Never Has Happened * 500 YARDS PASSING 503 yards, Philip Rivers vs. San Diego, 10/18/15
41 att., Aaron Rodgers vs. Minnesota, 11/01/20 40+ PASS ATTEMPTS 53 att., Mitchell Trubisky vs. Chicago, 12/15/19
55 att., Aaron Rodgers @ Detroit, 12/29/19 50+ PASS ATTEMPTS 53 att., Mitchell Trubisky vs. Chicago, 12/15/19
429 yards, Aaron Rodgers vs. Oakland, 10/20/19 400 YARDS PASSING 463 yards, Dak Prescott @ Dallas, 10/06/19
311 yards, Aaron Rodgers @ Indianapolis, 11/22/20 300 YARDS PASSING 309 yards, Deshaun Watson @ Houston, 10/25/20
* Never Has Happened * SEVEN TOUCHDOWN PASSES * Never Has Happened *
6 tds, Aaron Rodgers: (1, 4, 73, 40, 56, 18) vs. Chicago, * Never Has Happened * 11/09/14 SIX TOUCHDOWN PASSES
5 tds, Aaron Rodgers: (21, 2, 37, 3, 74) vs. Oakland, 5 tds, Matthew Stafford: (8, 13, 2, 5, 12) vs. Detroit, 10/20/19 FIVE TOUCHDOWN PASSES 01/01/12
4 tds, Aaron Rodgers: (36, 1, 52, 1) @ San Francisco, 4 tds, Kirk Cousins: (14, 3, 75, 22) vs. Minnesota, 11/05/20 FOUR TOUCHDOWN PASSES 09/16/18
* Never Has Happened * FOUR OR MORE INTERCEPTION GAME * Never Has Happened *
3 tds, Aaron Rodgers: (25, 5, 4) @ Indianapolis, 3 tds, Philip Rivers: (45, 17, 6) @ Indianapolis, 11/22/20 THREE TOUCHDOWN PASSES 11/22/20
* Never Has Happened * THREE INTERCEPTION GAME * Never Has Happened *
2 int, Ha Ha Clinton-Dix @ Chicago, 12/18/16 TWO INTERCEPTION GAME 2 int, Harrison Smith vs. Minnesota, 12/23/17
4 ints, Brett Favre vs. Chicago, 12/25/05 FOUR INTERCEPTIONS THROWN 4 ints, Nick Foles vs. St. Louis, 10/11/15
3 ints, Aaron Rodgers @ Carolina, 12/17/17 THREE INTERCEPTIONS THROWN 3 ints, Daniel Jones @ N.Y. Giants, 12/01/19
2 ints, Aaron Rodgers @ Tampa Bay, 10/18/20 TWO INTERCEPTIONS THROWN 2 ints, Mitchell Trubisky vs. Chicago, 12/15/19
2020 GREEN BAY PACKERS 63 THE LAST TIME COMBINED YARDS 100 yards/323 yards, Aaron Jones/Aaron Rodgers @ 108 yards/307 yards, Christian McCaffrey/Kyle Allen Detroit, 12/29/19 100-YARD RUSHER AND 300-YARD PASSER vs. Carolina, 11/10/19
106 yards/311 yards, Davante Adams/Aaron 125/118 yards/334 yards, Allen Robinson II/Anthony Rodgers @ Indianapolis, 11/22/20 100-YARD RECEIVER AND 300-YARD PASSER Miller/Mitchell Trubisky vs. Chicago, 12/15/19
154 yards/116 yards, Aaron Jones/Davante Adams 108 yards/120 yards, Christian McCaffrey/DJ Moore @ Minnesota, 12/23/19 100-YARD RUSHER AND 100-YARD RECEIVER vs. Carolina, 11/10/19
120 yards/315 yards/113 yards, Eddie Lacy/Aaron 108 yards/307 yards/120 yards, Christian Rodgers 100-YARD RUSHER, 300-YARD PASSER, 100-YARD McCaffrey/Kyle Allen Jordy Nelson @ Baltimore, 10/13/13 RECEIVER DJ Moore vs. Carolina, 11/10/19 DEFENSE
7 yards, Chandon Sullivan: (8:37) 9-M.Stafford pass short 32 yards, Jamel Dean: (12:50) (Shotgun) 12-A.Rodgers pass left intended for 80-D.Amendola INTERCEPTED by 39-C.Sullivan INTERCEPTED PASS RETURNED FOR A short left intended for 17-D.Adams INTERCEPTED by 35-J.Dean at at DET 7. 39-C.Sullivan for 7 yards, TOUCHDOWN. vs. Detroit, TOUCHDOWN GB 32. 35-J.Dean for 32 yards, TOUCHDOWN. @ Tampa Bay, 09/20/20 10/18/20
62 yards, Dean Lowry: (4:31) 66-L.Wester reported in as 15 yards, Desmond Trufant: (14:17) (Shotgun) 12- eligible. 3-J.Winston sacked at GB 38 for -8 yards (97-K.Clark). A.Rodgers sacked at GB 21 for -9 yards (44-V.Beasley). FUMBLES FUMBLES (97-K.Clark) [97-K.Clark], RECOVERED by GB-94- FUMBLE RETURNED FOR A TOUCHDOWN (44-V.Beasley) [44-V.Beasley], RECOVERED by ATL-21-D.Trufant D.Lowry at GB 38. 94-D.Lowry for 62 yards, TOUCHDOWN. vs. at GB 15. 21-D.Trufant for 15 yards, TOUCHDOWN. The Replay Tampa Bay, 12/03/17 Official reviewed the backward pass ruling, and the play was Upheld. The ruling on the field stands. @ Atlanta, 09/17/17
Jaire Alexander: (11:43) 8-K.Cousins sacked in End Zone for Mark Barron: (2:54) 33-A.Jones up the middle tackled in End -4 yards, SAFETY (23-J.Alexander). @ Minnesota, 09/13/20 SAFETY SCORED Zone for -1 yards, SAFETY (26-M.Barron). @ L.A. Rams, 10/28/18
Green Bay 22, Buffalo 0 vs. Buffalo, 09/30/18 SHUTOUT Detroit 31, Green Bay 0 vs. Detroit, 12/30/18
4.0 sk, Kabeer Gbaja-Biamila @ Chicago, 01/02/05 FOUR SACK GAME 4.0 sk, Chris Clemons @ Seattle, 09/24/12
3.0 sk, Za'Darius Smith vs. Atlanta, 10/05/20 THREE SACK GAME 3.0 sk, Ezekiel Ansah @ Detroit, 12/31/17
2.0 sk, Kingsley Keke @ New Orleans, 09/27/20 TWO SACK GAME 2.0 sk, Arik Armstead @ San Francisco, 11/24/19
66 yards, Indianapolis 34, Green Bay 31 @ 55 yards, Green Bay 34, San Francisco 17 @ San Indianapolis, 11/22/20 LESS THAN 100 RUSHING YARDS Francisco, 11/05/20
134 yards, Green Bay 23, Detroit 20 @ Detroit, 107 yards, Tampa Bay 38, Green Bay 10 @ Tampa 12/29/19 LESS THAN 150 NET PASSING YARDS Bay, 10/18/20
139 yards, Green Bay 23, Minnesota 10 @ 198 yards, San Francisco 37, Green Bay 8 @ San Minnesota, 12/23/19 LESS THAN 200 YARDS NET OFFENSE Francisco, 11/24/19
260 yards, Green Bay 24, Jacksonville 20 vs. 201 yards, Tampa Bay 38, Green Bay 10 @ Tampa Jacksonville, 11/15/20 LESS THAN 300 YARDS NET OFFENSE Bay, 10/18/20
4 to, Indianapolis 34, Green Bay 31 @ Indianapolis, 2 to, Indianapolis 34, Green Bay 31 @ Indianapolis, 11/22/20 AT LEAST ONE TURNOVER 11/22/20
3 to, Green Bay 21, Chicago 13 vs. Chicago, 4 to, Indianapolis 34, Green Bay 31 @ Indianapolis, 12/15/19 FORCED THREE+ TURNOVERS 11/22/20 SPECIAL TEAMS
108 yards, Randall Cobb: 6-T.Morstead kicks 73 yards from 99 yards, Andre Roberts: 2-M.Crosby kicks 64 yards from NO 35 to GB -8. 18-R.Cobb for 108 yards, TOUCHDOWN. vs. KICKOFF RETURNED FOR A TOUCHDOWN GB 35 to NYJ 1. 19-A.Roberts for 99 yards, TOUCHDOWN. @ New Orleans, 09/08/11 N.Y. Jets, 12/23/18
55 yards, Micah Hyde: (5:04) 6-S.Martin punts 45 yards to 91 yards, Keelan Cole: (10:25) 6-J.Scott punts 59 yards to GB 45, Center-48-D.Muhlbach. 33-M.Hyde for 55 yards, PUNT RETURNED FOR A TOUCHDOWN JAX 9, Center-43-H.Bradley. 84-K.Cole Sr. for 91 yards, TOUCHDOWN. vs. Detroit, 12/28/14 TOUCHDOWN. vs. Jacksonville, 11/15/20
* Never Has Happened * Lamar King: (8:10) 8-R.Longwell 50 yard field goal is BLOCKED (92-L.King), Center-60-R.Davis, Holder-11-M.Hasselbeck, BLOCKED FIELD GOAL RETURNED FOR A RECOVERED by SEA-24-S.Springs at SEA 39. 24-S.Springs for 61 TOUCHDOWN yards, TOUCHDOWN. PENALTY on GB-11-M.Hasselbeck, Unsportsmanlike Conduct, 15 yards, enforced between downs. vs. Seattle, 11/01/99
Geronimo Allison: (7:33) 6-M.Wile punt is BLOCKED by 81- Bryan Braman: (5:35) 8-T.Masthay punt is BLOCKED by 50- G.Allison, Center-47-K.McDermott, RECOVERED by GB-37- BLOCKED PUNT RETURNED FOR A TOUCHDOWN B.Braman, Center-61-B.Goode, RECOVERED by HST-11-D.Posey J.Jackson at MIN -1. TOUCHDOWN. vs. Minnesota, at GB 0. TOUCHDOWN. @ Houston, 10/14/12 09/16/18
53 yards, Mason Crosby: (6:20) 2-M.Crosby 53 yard field 52 yards, Chase McLaughlin: (10:41) 3-C.McLaughlin 52 goal is GOOD, Center-43-H.Bradley, Holder-6-J.Scott. @ San MADE FIELD GOAL OF 50 YARDS OR LONGER yard field goal is GOOD, Center-46-R.Matiscik, Holder-9-L.Cooke. Francisco, 11/05/20 vs. Jacksonville, 11/15/20
38 yards, Mason Crosby: (6:50) 2-M.Crosby 38 yard field 50 yards, Greg Zuerlein: (4:19) 4-G.Zuerlein 50 yard field goal is BLOCKED (91-A.Robinson), Center-54-D.Hart, Holder-8- BLOCKED FIELD GOAL goal is BLOCKED (95-D.Jones), Center-44-J.McQuaide, Holder-6- J.Vogel. vs. Detroit, 11/06/17 J.Hekker. vs. St. Louis, 10/11/15
JK Scott: (12:17) 6-J.Scott punt is BLOCKED by 38-B.Howell, Matt Wile: (7:33) 6-M.Wile punt is BLOCKED by 81-G.Allison, Center-43-H.Bradley, RECOVERED by HST-51-D.Cole at GB 32. BLOCKED PUNT Center-47-K.McDermott, RECOVERED by GB-37-J.Jackson at MIN PENALTY on GB-29-K.Hollman, Illegal Use of Hands, 10 yards, -1. TOUCHDOWN. vs. Minnesota, 09/16/18 enforced at GB 32. @ Houston, 10/25/20
Mason Crosby: 2-M.Crosby extra point is No Good, Wide Left, Elliott Fry: 1-E.Fry extra point is No Good, Wide Right, Center-43-H.Bradley, Holder-6-J.Scott. vs. Atlanta, 10/05/20 MISSED POINT AFTER TOUCHDOWN ATTEMPT Center-47-J.Harris, Holder-4-S.Hofrichter. vs. Atlanta, 10/05/20
Dan Bailey: 5-D.Bailey extra point is Blocked (28-T.Brown), Mason Crosby: 2-M.Crosby extra point is Blocked (77- Center-58-A.Cutting, Holder-2-B.Colquitt. vs. Minnesota, POINT AFTER TOUCHDOWN ATTEMPT BLOCKED R.Hageman), Center-61-B.Goode, Holder-8-T.Masthay. vs. 09/15/19 Atlanta, 12/08/14
2020 GREEN BAY PACKERS 64 THE LAST TIME Jermaine Whitehead: 2-M.Crosby kicks onside 14 yards from Michael Thomas: 7-K.Fairbairn kicks onside 18 yards from GB 35 to GB 49. RECOVERED by GB-35-J.Whitehead. @ SUCCESSFUL ONSIDE KICK HST 35 to GB 47. RECOVERED by HST-28-M.Thomas. @ Detroit, 12/31/17 Houston, 10/25/20
5 fg, Mason Crosby: (37, 40, 31, 48, 36) vs. Minnesota, 5 fg, Matt Prater: (26, 22, 41, 51, 54) vs. Detroit, 09/16/18 FIVE FIELD GOALS 10/14/19
4 fg, Mason Crosby: (29, 39, 51, 27) vs. San Francisco, 4 fg, Rodrigo Blankenship: (37, 32, 43, 39) @ 10/15/18 FOUR FIELD GOALS Indianapolis, 11/22/20
3 fg, Mason Crosby: (52, 33, 49) @ New Orleans, 3 fg, Wil Lutz: (45, 35, 34) @ New Orleans, 09/27/20 09/27/20 THREE FIELD GOALS TEAM/MISCELLANEOUS 522 yards, Green Bay 522, Minnesota 382 @ 563 yards, Dallas 563, Green Bay 335 @ Dallas, Minnesota, 09/13/20 500 TOTAL YARDS OF OFFENSE 10/06/19
405 yards, Green Bay 405, San Francisco 337 @ San 420 yards, Indianapolis 420, Green Bay 367 @ Francisco, 11/05/20 400 TOTAL YARDS OF OFFENSE Indianapolis, 11/22/20
ST: (2:04) L.Taylor and J.Tretter reported in as eligible. E.Lacy ST: (8:52) (Shotgun) J.Freeman pass short right to D.Ward for 6 right tackle for 1 yard, TOUCHDOWN.ST: (3:38) (Shotgun) yards, TOUCHDOWN.ST: (11:44) (Shotgun) J.Freeman pass short A.Rodgers pass short right to D.Adams for 6 yards, left to K.Winslow for 7 yards, TOUCHDOWN.ST: (4:20) (Shotgun) TOUCHDOWN.ST: (10:45) (No Huddle, Shotgun) A.Rodgers pass J.Freeman pass short right to S.Stroughter for 7 yards, deep right to J.Nelson for 27 yards, TOUCHDOWN.ST: (14:52) TOUCHDOWN.DEF: (:52) (Shotgun) A.Rodgers pass deep left (Shotgun) A.Rodgers pass short left to E.Lacy for 32 yards, intended for D.Driver INTERCEPTED by T.Jackson at GB 35. TOUCHDOWN.DEF: (6:07) (No Huddle, Shotgun) M.Sanchez pass T.Jackson for 35 yards, TOUCHDOWN.OFF: (12:09) (Punt short right intended for B.Celek INTERCEPTED by J.Peppers at GB TOUCHDOWN ON OFFENSE, DEFENSE AND formation) J.Kapinos punt is BLOCKED by G.Hayes, Center- 48. J.Peppers for 52 yards, TOUCHDOWN. PENALTY on PHI- SPECIAL TEAMS B.Goode, RECOVERED by TB-R.Barber at GB 31. R.Barber for 31 M.Sanchez, Low Block, 15 yards, enforced between downs.DEF: yards, TOUCHDOWN. @ Tampa Bay, 11/08/09 (10:49) (No Huddle, Shotgun) M.Sanchez FUMBLES (Aborted) at GB 39, RECOVERED by GB-C.Hayward at PHI 49. C.Hayward for 49 yards, TOUCHDOWN.OFF: (2:18) D.Jones punts 50 yards to GB 25, Center-J.Dorenbos. M.Hyde for 75 yards, TOUCHDOWN. PENALTY on GB, Unsportsmanlike Conduct, 15 yards, enforced between downs. vs. Philadelphia, 11/16/14
Jamaal Williams: TWO-POINT CONVERSION ATTEMPT. 30- Nyheim Hines: TWO-POINT CONVERSION ATTEMPT. 21- J.Williams rushes up the middle. ATTEMPT FAILS. The Replay N.Hines rushes left end. ATTEMPT SUCCEEDS. PENALTY on Official reviewed the short of the goal line ruling, and the play was MADE TWO-POINT CONVERSION GB-55-Z.Smith, Defensive Offside, 5 yards, enforced between REVERSED. TWO-POINT CONVERSION ATTEMPT. 30-J.Williams downs. @ Indianapolis, 11/22/20 rushes up the middle. ATTEMPT SUCCEEDS. vs. Minnesota, 11/01/20
Aaron Rodgers: TWO-POINT CONVERSION ATTEMPT. 12- Dwayne Haskins Jr.: TWO-POINT CONVERSION ATTEMPT. A.Rodgers pass to 83-M.Valdes-Scantling is incomplete. FAILED TWO-POINT CONVERSION 7-D.Haskins rushes left tackle. ATTEMPT FAILS. vs. ATTEMPT FAILS. @ Detroit, 10/07/18 Washington, 12/08/19
Green Bay 53, Philadelphia 20 vs. Philadelphia, 11/16/14 50 POINTS New Orleans 51, Green Bay 29 @ New Orleans, 11/24/08
Green Bay 42, Detroit 21 vs. Detroit, 09/20/20 40 POINTS Washington 42, Green Bay 24 @ Washington, 11/20/16
Green Bay 44, N.Y. Jets 38 @ N.Y. Jets, 12/23/18 OVERTIME WIN Indianapolis 34, Green Bay 31 @ Indianapolis, 11/22/20
Indianapolis 34, Green Bay 31 @ Indianapolis, 11/22/20 OVERTIME LOSS Green Bay 44, N.Y. Jets 38 @ N.Y. Jets, 12/23/18
Minnesota 26, Green Bay 26 vs. Minnesota, 11/24/13 OVERTIME TIE Minnesota 26, Green Bay 26 vs. Minnesota, 11/24/13
0 to, Green Bay 34, San Francisco 17 @ San 0 to, Minnesota 28, Green Bay 22 vs. Minnesota, Francisco, 11/05/20 NO TURNOVERS 11/01/20
2020 GREEN BAY PACKERS 65 THE LAST TIME DATE POS. PLAYER TRANSACTION 9/5 LB Delontae Scott Released 1/6 WR Reggie Begelton Signed to a reserve/future contract 9/5 WR Darrius Shepherd Released 1/6 FB Elijah Wellman Signed to a reserve/future contract 9/5 G Simon Stepaniak Placed on reserve/non-football injury 1/15 CB DaShaun Amos Signed to a reserve/future contract 9/5 CB Will Sunderland Waived/injured 1/18 S Raven Greene Activated from injured reserve; 9/5 RB Patrick Taylor Placed on reserve/non-football injury designated for return 9/5 WR Malik Turner Released 1/21 TE Evan Baylis Signed 9/5 RB Dexter Williams Released 1/21 T Cody Conway Signed 9/5 LB Tim Williams Released 1/21 RB Damarea Crockett Signed 9/6 DL Treyvon Hester Reverted to injured reserve 1/21 CB Kabion Ento Signed 9/6 CB Will Sunderland Reverted to injured reserve 1/21 TE James Looney Signed 9/6 LB Krys Barnes Signed to practice squad 1/21 LB Randy Ramsey Signed 9/6 WR Reggie Begelton Signed to practice squad 1/21 WR Darrius Shepherd Signed 9/6 S Henry Black Signed to practice squad 1/21 WR Malik Taylor Signed 9/6 RB Damarea Crockett Signed to practice squad 1/21 QB Manny Wilkins Signed 9/6 LB Tipa Galeai Signed to practice squad 1/21 LB Tim Williams Signed 9/6 C Jake Hanson Signed to practice squad 2/24 K Mason Crosby Signed contract extension 9/6 G Zack Johnson Signed to practice squad 3/12 TE Jimmy Graham Released 9/6 T/G Alex Light Signed to practice squad 3/17 LB Christian Kirksey Signed 9/6 TE John Lovett Signed to practice squad 3/17 T Rick Wagner Signed 9/6 DL Willington Previlon Signed to practice squad 3/27 S Will Redmond Signed 9/6 LB Greg Roberts Signed to practice squad 3/30 RB Tyler Ervin Re-signed 9/6 CB Stanford Samuels Signed to practice squad 4/2 WR Devin Funchess Signed 9/6 DL Delontae Scott Signed to practice squad 4/21 LB Jamal Davis Claimed off waivers from MIA 9/6 WR Darrius Shepherd Signed to practice squad 4/21 DL Gerald Willis Claimed off waivers from MIA 9/7 CB Kabion Ento Placed on injured reserve 4/27 QB Manny Wilkins Released 9/7 LB Kamal Martin Placed on injured reserve 4/29 LB Krys Barnes Signed 9/7 CB Parry Nickerson Signed 4/29 S Henry Black Signed 9/9 WR Robert Foster Signed to practice squad 4/29 T Travis Bruffy Signed 9/9 LB De'Jon Harris Signed to practice squad 4/29 CB Marc-Antoine Dequoy Signed 9/9 CB Will Sunderland Released from injured reserve; injury 4/29 LB Tipa Galeai Signed settlement 4/29 S Frankie Griffin Signed 9/10 DL Treyvon Hester Released from injured reserve; injury 4/29 FB Jordan Jones Signed settlement 4/29 QB Jalen Morton Signed 9/10 RB Damarea Crockett Released from practice squad 4/29 DL Willington Previlon Signed 9/10 T/G Alex Light Released from practice squad 4/29 CB Stanford Samuels Signed 9/10 DL Daylon Mack Signed to practice squad 4/29 LB Delontae Scott Signed 9/10 RB Dexter Williams Signed to practice squad 4/29 CB Will Sunderland Signed 9/12 LB Krys Barnes Signed to active roster 4/29 RB Patrick Taylor Agreed to terms 9/12 LB Tipa Galeai Elevated from practice squad to active 5/1 G Zack Johnson Signed roster for gameday 5/1 WR Darrell Stewart Signed 9/12 TE John Lovett Elevated from practice squad to active roster for gameday 5/1 DL Treyvon Hester Signed 9/14 LB Tipa Galeai Reverted to practice squad 5/26 LB Jonathan Garvin Signed 9/14 TE John Lovett Reverted to practice squad 6/1 G Simon Stepaniak Signed 9/16 DL Daylon Mack Released from practice squad 6/1 S Vernon Scott Signed 9/16 T Ryan Pope Signed to practice squad 6/5 G Jon Runyan Signed 9/16 DL Billy Winn Signed to practice squad 7/1 QB Jordan Love Signed 9/19 TE John Lovett Elevated from practice squad to active 7/1 RB AJ Dillon Signed roster for gameday 7/9 LB Kamal Martin Signed 9/19 DL Willington Previlon Elevated from practice squad to active 7/10 C Jake Hanson Signed roster for gameday 7/24 TE Josiah Deguara Signed 9/19 WR Equanimeous St. Brown Placed on injured reserve 7/27 DL Gerald Willis Released 9/21 TE John Lovett Reverted to practice squad 7/28 WR Devin Funchess Reserve/Opt-Out 9/21 DL Willington Previlon Reverted to practice squad 7/31 FB Jordan Jones Released 9/22 LB Greg Roberts Released from practice squad 7/31 G Cole Madison Released 9/22 G Lane Taylor Placed on injured reserve 8/3 QB Jalen Morton Released 9/23 TE Nakia Griffin-Stewart Signed to practice squad 8/3 FB Elijah Wellman Released 9/26 TE John Lovett Signed to active roster 8/5 FB John Lovett Claimed off waivers from KC 9/26 WR Darrius Shepherd Signed to active roster 8/10 LB Jamal Davis Released 9/26 DL Billy Winn Elevated from practice squad to active 8/12 S Frankie Griffin Released roster for gameday 8/12 WR Malik Turner Signed 9/28 DL Billy Winn Reverted to practice squad 8/15 WR Travis Fulgham Claimed off waivers from DET 9/30 WR Caleb Scott Signed to practice squad 8/15 DL Kenny Clark Signed contract extension 10/1 WR Juwann Winfree Signed to practice squad 8/15 CB Marc-Antoine Dequoy Released 10/3 LB Christian Kirksey Placed on injured reserve 8/15 TE James Looney Released 10/3 WR Allen Lazard Placed on injured reserve 8/15 WR Darrell Stewart Released 10/5 WR Reggie Begelton Signed to active roster 8/19 T Travis Bruffy Released 10/5 LB De'Jon Harris Elevated from practice squad to active 8/19 WR Travis Fulgham Released roster for gameday 9/5 CB DaShaun Amos Released 10/5 DL Billy Winn Elevated from practice squad to active roster for gameday 9/5 LB Krys Barnes Released 10/6 LB De'Jon Harris Reverted to practice squad 9/5 TE Evan Baylis Released 10/6 DL Billy Winn Reverted to practice squad 9/5 WR Reggie Begelton Released 10/6 WR Reggie Begelton Released 9/5 S Henry Black Released 10/6 LB Curtis Bolton Released from reserve/physically unable 9/5 LB Curtis Bolton Placed on reserve/physically unable to to perform perform 10/6 WR Caleb Scott Released from practice squad 9/5 T Cody Conway Released 10/8 WR Reggie Begelton Signed to practice squad 9/5 RB Damarea Crockett Released 10/12 TE Dominique Dafney Signed to practice squad 9/5 LB Tipa Galeai Released 10/13 TE Josiah Deguara Placed on injured reserve 9/5 C Jake Hanson Released 10/13 C Jake Hanson Placed on injured reserve - practice 9/5 DL Treyvon Hester Waived/injured squad 9/5 G Zack Johnson Released 10/13 WR Kalija Lipscomb Signed to practice squad 9/5 WR Jake Kumerow Released 10/17 WR Equanimeous St. Brown Activated from reserve/injured; 9/5 T John Leglue Released designated for return 9/5 T/G Alex Light Released 10/20 WR Kalija Lipscomb Released from practice squad 9/5 FB John Lovett Released 10/20 CB Parry Nickerson Placed on injured reserve 9/5 DL Willington Previlon Released 10/21 G Ben Braden Signed to practice squad 9/5 LB Greg Roberts Released 10/24 S Henry Black Elevated from practice squad to active 9/5 CB Stanford Samuels Released roster for gameday
2020 GREEN BAY PACKERS 66 TRANSACTIONS BY DATE 10/24 G Ben Braden Signed to active roster 11/6 G Ben Braden Reverted to practice squad 10/24 LB James Burgess Signed to active roster; placed on 11/6 CB Stanford Samuels Reverted to practice squad exempt/commissioner permission list 11/6 RB Dexter Williams Reverted to practice squad 10/24 LB Kamal Martin Activated from reserve/injured; 11/6 LB Krys Barnes Placed on reserve/COVID-19 list designated for return 11/6 QB Jordan Love Placed on reserve/COVID-19 list 10/24 RB Dexter Williams Elevated from practice squad to active 11/9 LB Kamal Martin Activated from reserve/COVID list roster for gameday 11/9 RB Jamaal Williams Activated from reserve/COVID list 10/24 DL Billy Winn Signed to active roster 11/10 QB Jordan Love Activated from reserve/COVID list 10/26 S Henry Black Reverted to practice squad 11/11 RB Mike Weber Signed to practice squad 10/26 RB Dexter Williams Reverted to practice squad 11/11 RB Dexter Williams Placed on injured reserve - practice 10/26 G Ben Braden Released squad 10/26 LB James Burgess Moved to active roster from 11/14 S Henry Black Elevated from practice squad to active exempt/commissioner permission list roster for gameday as COVID-19 10/28 G Ben Braden Signed to practice squad replacement 10/28 WR KeiVarae Russell Signed to practice squad 11/14 LB Christian Kirksey Activated from reserve/injured; 10/31 S Henry Black Elevated from practice squad to active designated for return roster for gameday 11/14 TE John Lovett Placed on injured reserve 10/31 WR Seth Roberts Signed to practice squad 11/14 CB KeiVarae Russell Elevated from practice squad to active 11/2 S Henry Black Reverted to practice squad roster for gameday 11/2 RB AJ Dillon Placed on reserve/COVID-19 list 11/14 CB Stanford Samuels Elevated from practice squad to active 11/3 LB Kamal Martin Placed on reserve/COVID-19 list roster for gameday 11/3 RB Jamaal Williams Placed on reserve/COVID-19 list 11/14 WR Juwann Winfree Elevated from practice squad to active roster for gameday as COVID-19 11/3 TE Nakia Griffin-Stewart Released from practice squad replacement 11/3 TE Dax Raymond Signed to practice squad 11/16 S Henry Black Reverted to practice squad 11/5 S Henry Black Elevated from practice squad to active 11/16 CB KeiVarae Russell Reverted to practice squad roster for gameday as COVID-19 replacement 11/16 CB Stanford Samuels Reverted to practice squad 11/5 G Ben Braden Elevated from practice squad to active 11/16 WR Juwann Winfree Reverted to practice squad roster for gameday 11/17 WR Allen Lazard Activated from reserve/injured; 11/5 CB Stanford Samuels Elevated from practice squad to active designated for return roster for gameday as COVID-19 11/21 P Drew Kaser Signed replacement 11/21 RB Mike Weber Elevated from practice squad to active 11/5 RB Dexter Williams Elevated from practice squad to active roster for gameday roster for gameday as COVID-19 11/23 RB Mike Weber Reverted to practice squad replacement 11/23 P Drew Kaser Released 11/6 S Henry Black Reverted to practice squad
2020 GREEN BAY PACKERS 67 TRANSACTIONS BY DATE TRANSACTIONS BY PLAYER Amos, DaShaun - CB Davis II, Jamal - LB Kirksey, Christian - LB 1/15/20 Signed to reserve/future 4/21/20 Claimed off waivers from MIA 3/17/20 Signed contract 8/10/20 Released 10/3/20 Placed on injured reserve 9/5/20 Released Deguara, Josiah - TE 11/14/20 Activated from reserve/ Barnes, Krys - LB 7/21/20 Signed injured; designated for return 4/29/20 Signed 10/13/20 Placed on injured reserve Kumerow, Jake - WR 9/5/20 Released Dequoy, Marc-Antoine - CB 9/5/20 Released 9/6/20 Signed to practice squad 4/29/20 Signed Lazard, Allen - WR 9/12/20 Signed to active roster 8/15/20 Released 10/3/20 Placed on injured reserve 11/6/20 Placed on reserve/COVID list Dillon, AJ - RB 11/17/20 Activated from reserve/ Baylis, Evan - TE 7/1/20 Signed injured; designated for return 1/21/20 Signed 11/2/20 Placed on reserve/COVID list Leglue, John - T 9/5/20 Released Ento. Kabion - CB 9/5/20 Released Begelton, Reggie - WR 1/21/20 Signed Light, Alex - T/G 1/6/20 Signed to reserve/future 9/7/20 Placed on injured reserve 9/5/20 Released contract Ervin, Tyler - RB 9/6/20 Signed to practice squad 9/5/20 Released 3/30/20 Re-signed 9/10/20 Released from practice squad 9/6/20 Signed to practice squad Foster, Robert - WR Lipscomb, Kalija - WR 10/5/20 Signed to active roster 9/9/20 Signed to practice squad 10/13/20 Signed to practice squad 10/6/20 Released Fulgham, Travis - WR 10/20/20 Released from practice squad 10/8/20 Signed to practice squad 8/15/20 Claimed off waivers from DET Looney, James - TE Black, Henry - S 8/19/20 Released 1/21/20 Signed 4/29/20 Signed Funchess, Devin - WR 8/15/20 Released 9/5/20 Released 4/2/20 Signed Love, Jordan - QB 9/6/20 Signed to practice squad 7/28/20 Placed on reserve/opt-out 7/1/20 Signed 10/24/20 Elevated from practice squad Galeai, Tipa - LB 11/6/20 Placed on reserve/COVID list to active roster for gameday 4/29/20 Signed 11/10/20 Activated from reserve/ 10/26/20 Reverted to practice squad 9/5/20 Released COVID list 10/31/20 Elevated from practice squad 9/6/20 Signed to practice squad Lovett, John - TE to active roster for gameday 9/12/20 Elevated from practice squad 8/5/20 Claimed off waivers from KC 11/2/20 Reverted to practice squad to active roster for gameday 9/5/20 Released 11/5/20 Elevated from practice squad 9/14/20 Reverted to practice squad 9/6/20 Signed to practice squad to active roster for gameday Garvin, Jonathan - LB 9/12/20 Elevated from practice squad as COVID-19 replacement 5/26/20 Signed to active roster for gameday 11/6/20 Reverted to practice squad Graham, Jimmy - TE 9/14/20 Reverted to practice squad 11/14/20 Elevated from practice squad 3/12/20 Released 9/19/20 Elevated from practice squad to active roster for gameday Greene, Raven - S to active roster for gameday as COVID-19 replacement 1/18/20 Activated from injured 9/21/20 Reverted to practice squad 11/16/20 Reverted to practice squad reserve; designated for return 9/26/20 Signed to active roster Bolton, Curtis - LB Griffin, Frankie - S 11/14/20 Placed on injured reserve 9/5/20 Placed on reserve/physically 4/29/20 Signed Mack, Daylon - DL unable to perform 8/12/20 Released 9/10/20 Signed to practice squad 10/6/20 Released from reserve/ Griffin-Stewart, Nakia - TE 9/16/20 Released from practice squad physically unable to perform 9/23/20 Signed to practice squad Madison, Cole - G Braden, Ben - G 11/3/20 Released from practice squad 7/31/20 Released 10/21/20 Signed to practice squad Hanson, Jake - C Martin, Kamal - LB 10/24/20 Signed to active roster 7/10/20 Signed 7/9/20 Signed 10/26/20 Released 9/5/20 Released 9/7/20 Placed on injured reserve 10/28/20 Signed to practice squad 9/6/20 Signed to practice squad 10/24/20 Activated from reserve/ 11/5/20 Elevated from practice squad 10/13/20 Placed on injured reserve - injured; designated for return to active roster for gameday practice squad 11/3/20 Placed on reserve/COVID list 11/6/20 Reverted to practice squad Harris, De’Jon - LB 11/9/20 Activated from reserve/ Bruffy, Travis - T 9/9/20 Signed to practice squad COVID list 4/29/20 Signed 10/5/20 Elevated from practice squad Morton, Jalen - QB 8/19/20 Released to active roster for gameday 4/29/20 Signed Burgess, James - LB 10/6/20 Reverted to practice squad 8/3/20 Released 10/24/20 Signed to active roster; Hester, Treyvon - DL Nickerson, Parry - CB placed on exempt/ 5/1/20 Signed 9/7/20 Signed commissioner permission list 9/5/20 Waived/injured 10/20/20 Placed on injured reserve 10/26/20 Moved to active roster 9/6/20 Reverted to injured reserve Pope, Ryan - T from exempt/commissioner 9/10/20 Released from injured 9/16/20 Signed to practice squad permission list reserve; injury settlement Previlon, Willington - DL Clark, Kenny - DL Johnson, Zack - G 4/29/20 Signed 8/15/20 Signed contract extension 5/1/20 Signed 9/5/20 Released Conway, Cody - T 9/5/20 Released 9/6/20 Signed to practice squad 1/21/20 Signed 9/6/20 Signed to practice squad 9/19/20 Elevated from practice squad 9/5/20 Released Jones, Jordan - FB to active roster for gameday Crockett, Damarea - RB 4/29/20 Signed 9/21/20 Reverted to practice squad 1/21/20 Signed 7/31/20 Released Ramsey, Randy - LB 9/5/20 Released Kaser, Drew - P 1/21/20 Signed 9/6/20 Signed to practice squad 11/21/20 Signed Raymond, Dax - TE 9/10/20 Released from practice squad 11/23/20 Released 11/3/20 Signed to practice squad Crosby, Mason - K Redmond, Will - S 2/24/20 Signed contract extension 3/27/20 Signed Dafney, Dominique - TE 10/12/20 Signed to practice squad
2020 GREEN BAY PACKERS 68 TRANSACTIONS BY PLAYER TRANSACTIONS BY PLAYER - CONTINUED Roberts, Greg - LB St. Brown, Equanimeous - WR Wilkins, Manny - QB 9/5/20 Released 9/19/20 Placed on injured reserve 1/21/20 Signed 9/6/20 Signed to practice squad 10/17/20 Activated from reserve/ 4/27/20 Released 9/22/20 Released from practice squad injured; designated for return Williams, Dexter - RB Roberts, Seth - WR Stepaniak, Simon - G 9/5/20 Released 10/31/20 Signed to practice squad 6/1/20 Signed 9/10/20 Signed to practice squad Runyan, Jon - G 9/5/20 Placed on reserve/non- 10/24/20 Elevated from practice squad 6/5/20 Signed football injury to active roster for gameday Russell, KeiVarae - WR Stewart, Darrell - WR 10/26/20 Reverted to practice squad 10/28/20 Signed to practice squad 5/1/20 Signed 11/5/20 Elevated from practice squad 11/14/20 Elevated from practice squad 8/15/20 Released to active roster for gameday to active roster for gameday Sunderland, Will - CB as COVID-19 replacement 11/16/20 Reverted to practice squad 4/29/20 Signed 11/6/20 Reverted to practice squad Samuels, Stanford - CB 9/5/20 Waived/injured 11/11/20 Placed on injured reserve - 4/29/20 Signed 9/6/20 Reverted to injured reserve practice squad 9/5/20 Released 9/9/20 Released from injured Williams, Jamaal - RB 9/6/20 Signed to practice squad reserve; injury settlement 11/3/20 Placed on reserve/COVID list 11/5/20 Elevated from practice squad Taylor, Lane - G 11/9/20 Activated from reserve/ to active roster for gameday 9/22/20 Placed on injured reserve COVID list as COVID-19 replacement Taylor, Malik - WR Williams, Tim - LB 11/6/20 Reverted to practice squad 1/21/20 Signed 1/21/20 Signed 11/14/20 Elevated from practice squad Taylor, Patrick - RB 9/5/20 Released to active roster for gameday 4/29/20 Agreed to terms Willis, Gerald - DL 11/16/20 Reverted to practice squad 9/5/20 Placed on reserve/non- 4/21/20 Claimed off waivers from MIA Scott, Caleb - WR football injury 7/27/20 Released 9/30/20 Signed to practice squad Turner, Malik - WR Winfree, Juwann - WR 10/6/20 Released from practice squad 8/12/20 Signed 10/1/20 Signed to practice squad Scott, Delontae - DL 9/5/20 Released 11/14/20 Elevated from practice squad 4/29/20 Signed Wagner, Rick - T to active roster for gameday 9/5/20 Released 3/17/20 Signed as COVID-19 replacement 9/6/20 Signed to practice squad Weber, Mike - RB 11/16/20 Reverted to practice squad Scott, Vernon - S 11/11/20 Signed to practice squad Winn, Billy - DL 6/1/20 Signed 11/21/20 Elevated from practice squad 9/16/20 Signed to practice squad Shepherd, Darrius - WR to active roster for gameday 9/26/20 Elevated from practice squad 1/21/20 Signed 11/23/20 Reverted to practice squad to active roster for gameday 9/5/20 Released Wellman, Elijah - FB 9/28/20 Reverted to practice squad 9/6/20 Signed to practice squad 1/6/20 Signed to reserve/future 10/5/20 Elevated from practice squad 9/26/20 Signed to active roster contract to active roster for gameday 8/3/2020 Released 10/6/20 Reverted to practice squad 10/24/20 Signed to active roster
2020 GREEN BAY PACKERS 69 TRANSACTIONS BY PLAYER GAME SUMMARIES Green Bay Packers ...... 3 19 7 14 — 43 Minnesota Vikings ...... 7 3 0 24 — 34 Minnesota Vikings Starters Green Bay Packers Starters OFFENSE DEFENSE OFFENSE DEFENSE WR 81 B. Johnson LE 95 I. Odenigbo WR 17 D. Adams DE 94 D. Lowry LT 71 R. Reiff NT 93 S. Stephen TE 89 M. Lewis NT 97 K. Clark LG 78 D. Dozier DT 94 J. Johnson LT 69 D. Bakhtiari DE 96 K. Keke C 56 G. Bradbury DE 90 J. Holmes LG 62 L. Patrick OLB 91 P. Smith RG 65 P. Elflein SLB 55 A. Barr C 63 C. Linsley ILB 58 C. Kirksey RT 75 B. O'Neill MLB 54 E. Kendricks RG 65 L. Taylor ILB 51 K. Barnes TE 82 K. Rudolph WLB 50 E. Wilson RT 74 E. Jenkins OLB 55 Z. Smith WR 19 A. Thielen CB 27 C. Dantzler TE 81 J. Deguara CB 23 J. Alexander QB 8 K. Cousins CB 21 M. Hughes WR 13 A. Lazard CB 20 K. King RB 33 D. Cook S 22 H. Smith QB 12 A. Rodgers S 31 A. Amos FB 30 C. Ham FS 41 A. Harris RB 33 A. Jones S 26 D. Savage
OFFICIALS: Referee: Bill Vinovich (52), Umpire: Tony Michalek (115), Down Judge: Mike Carr (63), Line Judge: Jeff Seeman (45), Field Judge: David Meslow (118), Side Judge: Don Willard (58), Back Judge: Perry Paganelli (46), Replay Official: Mark Butterworth, Replay Assistant: Joe Wollan
Scoring Drives TEAM QTR TIME SCORING PLAY GB MIN Packers 1 07:27 M.Crosby 31 yd. Field Goal (13-63, 7:33) 3 0 Vikings 1 03:24 D.Cook 1 yd. run (D.Bailey kick) (8-75, 4:03) 3 7 Packers 2 11:39 K.Cousins sacked in end zone by J.Alexander for a Safety 5 7 Packers 2 08:08 M.Crosby 43 yd. Field Goal (8-31, 3:31) 8 7 Packers 2 00:39 D.Adams 24 yd. pass from A.Rodgers (M.Crosby kick) (11-60, 5:25) 15 7 Packers 2 00:14 M.Valdes-Scantling 45 yd. pass from A.Rodgers (M.Crosby kick) (2-45, 0:11) 22 7 Vikings 2 00:00 D.Bailey 35 yd. Field Goal (3-58, 0:14) 22 10 Packers 3 00:09 D.Adams 1 yd. pass from A.Rodgers (M.Crosby kick) (8-61, 4:11) 29 10 Vikings 4 13:53 A.Thielen 37 yd. pass from K.Cousins (D.Cook run) (4-77, 1:16) 29 18 Packers 4 10:02 A.Lazard 4 yd. pass from A.Rodgers (M.Crosby kick) (7-75, 3:51) 36 18 Vikings 4 07:55 D.Cook 3 yd. run (D.Cook run) (7-65, 2:07) 36 26 Packers 4 03:19 A.Jones 5 yd. run (M.Crosby kick) (8-75, 4:36) 43 26 Vikings 4 01:21 A.Thielen 19 yd. pass from K.Cousins (K.Cousins-A.Thielen pass) (9-75, 1:58) 43 34 Green Bay Packers Minnesota Vikings PASSING ATT CP YDS SK/YD TD LG INT RTG PASSING ATT CP YDS SK/YD TD LG INT RTG Aaron Rodgers 44 32 364 0/0 4 45 0 127.5 Kirk Cousins 25 19 259 2/11 2 37 1 118.6 TOTAL 44 32 364 0/0 4 45 0 127.5 TOTAL 25 19 259 2/11 2 37 1 118.6
RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD Aaron Jones 16 66 4.1 15 1 Dalvin Cook 12 50 4.2 12 2 Tyler Ervin 3 38 12.7 21 0 Alexander Mattison 6 50 8.3 21 0 Jamaal Williams 7 21 3.0 5 0 Kirk Cousins 4 34 8.5 16 0 Allen Lazard 1 19 19.0 19 0 TOTAL 22 134 6.1 21 2 AJ Dillon 2 14 7.0 8 0 Aaron Rodgers 1 2 2.0 2 0 Tim Boyle 2 -2 -1.0 -1 0 TOTAL 32 158 4.9 21 1
RECEIVING NO YDS AVG LG TD RECEIVING NO YDS AVG LG TD Davante Adams 14 156 11.1 40 2 Adam Thielen 6 110 18.3 37t 2 Marquez Valdes-Scantling 4 96 24.0 45t 1 Alexander Mattison 4 30 7.5 9 0 Allen Lazard 4 63 15.8 38 1 Bisi Johnson 3 56 18.7 29 0 Jamaal Williams 4 21 5.3 15 0 Kyle Rudolph 2 28 14.0 22 0 Aaron Jones 4 10 2.5 6 0 Justin Jefferson 2 26 13.0 17 0 Josiah Deguara 1 12 12.0 12 0 Irv Smith Jr. 1 11 11.0 11 0 Tyler Ervin 1 6 6.0 6 0 Dalvin Cook 1 -2 -2.0 -2 0 TOTAL 32 364 11.4 45T 4 TOTAL 19 259 13.6 37T 2
TOP DEFENSE TOT SOLO AST SCK YDS INT TOP DEFENSE TOT SOLO AST SCK YDS INT Christian Kirksey 12 6 6 0.0 0.0 0 Eric Kendricks 11 7 4 0.0 0.0 0 Krys Barnes 6 4 2 0.0 0.0 0 Anthony Harris 8 5 3 0.0 0.0 0 Darnell Savage 5 3 2 0.0 0.0 0 Holton Hill 7 7 0 0.0 0.0 0
FIELD GOALS FGM/FGA PERCENT RESULTS FIELD GOALS FGM/FGA PERCENT RESULTS Mason Crosby 2-2 100.0 (31, 43) Dan Bailey 1-1 100.0 (35) TOTAL 2-2 100.0 TOTAL 1-1 100.0
Team Statistics Packers Vikings MINNEAPOLIS (AP) — Aaron Rodgers took full advantage of the young First Downs 31 25 cornerbacks and the empty building in Minnesota, passing for 364 yards and 3rd Down Eff. (Made/Att/Pct) 6/11/55% 3/6/50% four touchdowns to lead the Packers past the Vikings, 43-34. Davante 4th Down Eff. (Made/Att/Pct) 1/2/50% 0/1/0% Adams thrived all over the field with a franchise-record-tying 14 catches for Total Net Yards 522 382 156 yards and two touchdowns. Marquez Valdes-Scantling and Allen Lazard Total Plays 76 49 each reached the end zone, too, as Green Bay had its way with a new-look Yards Per Play 6.9 7.8 Minnesota defense. Aaron Jones rushed for 66 yards and a touchdown for Rushes/Net Yards 32/158 22/134 the Packers, who posted their highest score against the Vikings since a Net Passing 364 248 44-31 victory at the Metrodome on Oct. 27, 2013. This was the most points Pass Attempts/Completions 44/32 25/19 Minnesota has allowed since coach Mike Zimmer was hired in 2014. Dalvin Had Intercepted 0 1 Cook rushed 12 times for 50 yards, two touchdowns and two two-point Sacked/Yards Lost 0/0 2/11 conversions. Adam Thielen caught six passes for 110 yards, two scores and Punts/Average 1/40.0 2/40.0 another two-pointer, but Cousins underthrew him in the final minute of the Penalties/Yards 6/63 5/20 first half, when Jaire Alexander, who also recorded a safety on an untouched Fumbles/Lost 1/0 0/0 cornerback blitz in the second quarter, made a bobbling interception. Possession Time 41:16 18:44
2020 GREEN BAY PACKERS 71 GAME SUMMARIES Detroit Lions ...... 14 0 0 7 — 21 Green Bay Packers ...... 3 14 17 8 — 42 Detroit Lions Starters Green Bay Packers Starters OFFENSE DEFENSE OFFENSE DEFENSE WR 11 M. Jones Jr. DE 90 T. Flowers WR 17 D. Adams DE 94 D. Lowry WR 17 M. Hall DT 71 D. Shelton TE 89 M. Lewis NT 95 T. Lancaster LT 68 T. Decker DT 93 D. Hand LT 69 D. Bakhtiari DE 96 K. Keke LG 76 O. Aboushi LB 58 J. Collins Sr. LG 74 E. Jenkins OLB 91 P. Smith C 77 F. Ragnow LB 40 J. Davis C 63 C. Linsley ILB 58 C. Kirksey RG 73 J. Jackson LB 52 C. Jones RG 62 L. Patrick OLB 55 Z. Smith RT 65 T. Crosby LB 51 J. Tavai RT 71 R. Wagner CB 23 J. Alexander TE 88 T. Hockenson CB 24 A. Oruwariye TE 85 R. Tonyan CB 20 K. King TE 83 J. James CB 30 J. Okudah WR 13 A. Lazard CB 39 C. Sullivan QB 9 M. Stafford S 26 D. Harmon QB 12 A. Rodgers S 31 A. Amos RB 33 K. Johnson S 25 W. Harris RB 33 A. Jones S 26 D. Savage
OFFICIALS: Referee: Clete Blakeman (34), Umpire: Fred Bryan (11), Down Judge: Mark Hittner (28), Line Judge: Tom Stephan (68), Field Judge: Joe Blubaugh (57), Side Judge: Michael Banks (72), Back Judge: Scott Helverson (93), Replay Official: Michael Chase, Replay Assistant: Ben Crowell
Scoring Drives TEAM QTR TIME SCORING PLAY DET GB Lions 1 10:33 K.Johnson 1 yd. run (M.Prater kick) (8-75, 4:27) 7 0 Packers 1 05:42 M.Crosby 43 yd. Field Goal (12-50, 4:51) 7 3 Lions 1 00:04 M.Jones 4 yd. pass from M.Stafford (M.Prater kick) (13-75, 5:38) 14 3 Packers 2 10:09 A.Jones 7 yd. pass from A.Rodgers (M.Crosby kick) (9-75, 4:55) 14 10 Packers 2 00:14 R.Tonyan 11 yd. pass from A.Rodgers (M.Crosby kick) (4-62, 0:46) 14 17 Packers 3 14:48 A.Jones 75 yd. run (M.Crosby kick) (1-75, 0:12) 14 24 Packers 3 08:32 C.Sullivan 7 yd. interception return (M.Crosby kick) 14 31 Packers 3 01:32 M.Crosby 35 yd. Field Goal (12-69, 6:01) 14 34 Lions 4 13:00 M.Hall 24 yd. pass from M.Stafford (M.Prater kick) (8-75, 3:32) 21 34 Packers 4 07:59 A.Jones 14 yd. run (J.Williams run) (7-74, 5:01) 21 42 Detroit Lions Green Bay Packers PASSING ATT CP YDS SK/YD TD LG INT RTG PASSING ATT CP YDS SK/YD TD LG INT RTG Matthew Stafford 33 20 244 4/26 2 36 1 91.0 Aaron Rodgers 30 18 240 1/11 2 41 0 107.6 TOTAL 33 20 244 4/26 2 36 1 91.0 TOTAL 30 18 240 1/11 2 41 0 107.6
RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD Adrian Peterson 7 41 5.9 25 0 Aaron Jones 18 168 9.3 75t 2 Kerryon Johnson 8 32 4.0 8 1 Jamaal Williams 8 63 7.9 18 0 D'Andre Swift 5 12 2.4 5 0 AJ Dillon 5 17 3.4 12 0 Matthew Stafford 1 4 4.0 4 0 Aaron Rodgers 2 12 6.0 8 0 TOTAL 21 89 4.2 25 1 Tim Boyle 2 -1 -0.5 0 0 TOTAL 35 259 7.4 75T 2
RECEIVING NO YDS AVG LG TD RECEIVING NO YDS AVG LG TD D'Andre Swift 5 60 12.0 17 0 Aaron Jones 4 68 17.0 30 1 T.J. Hockenson 4 62 15.5 29 0 Marquez Valdes-Scantling 3 64 21.3 41 0 Marvin Jones Jr. 4 23 5.8 8 1 Allen Lazard 3 45 15.0 25 0 Quintez Cephus 3 54 18.0 36 0 Davante Adams 3 36 12.0 17 0 Danny Amendola 2 21 10.5 13 0 Robert Tonyan 2 25 12.5 14 1 Marvin Hall 1 24 24.0 24t 1 Marcedes Lewis 1 4 4.0 4 0 Jamal Agnew 1 0 0.0 0 0 Tyler Ervin 1 4 4.0 4 0 TOTAL 20 244 12.2 36 2 Aaron Rodgers 1 -6 -6.0 -6 0 TOTAL 18 240 13.3 41 2
TOP DEFENSE TOT SOLO AST SCK YDS INT TOP DEFENSE TOT SOLO AST SCK YDS INT Jeff Okudah 7 7 0 0.0 0.0 0 Christian Kirksey 12 10 2 0.0 0.0 0 Jahlani Tavai 6 3 3 0.0 0.0 0 Darnell Savage 4 2 2 0.0 0.0 0 Danny Shelton 5 2 3 0.0 0.0 0 Jaire Alexander 4 3 1 0.0 0.0 0
FIELD GOALS FGM/FGA PERCENT RESULTS FIELD GOALS FGM/FGA PERCENT RESULTS No Field Goals Mason Crosby 2-2 100.0 (43, 35) TOTAL 2-2 100.0
Team Statistics Lions Packers GREEN BAY, Wis. (AP) -- Aaron Jones rushed for a career-high 168 yards First Downs 19 26 and scored three touchdowns, including a 75-yard breakaway, as the Green 3rd Down Eff. (Made/Att/Pct) 6/12/50% 6/12/50% Bay Packers rallied from an early 11-point deficit to beat the Detroit Lions, 4th Down Eff. (Made/Att/Pct) 0/1/0% 1/1/100% 42-21, on Sunday. Jones also had a team-high 68 yards receiving on four Total Net Yards 307 488 catches as the Packers (2-0) won their home opener for an eighth Total Plays 58 66 consecutive year and improved to 8-0 against NFC North foes during coach Yards Per Play 5.3 7.4 Matt LaFleur's tenure. Jones had a 14-yard touchdown run to go along with Rushes/Net Yards 21/89 35/259 his 75-yarder. Rodgers was 18 of 30 for 240 yards with touchdown passes Net Passing 218 229 to Jones and Robert Tonyan. After winning, 43-34, at Minnesota last week, Pass Attempts/Completions 33/20 30/18 the Packers are the eighth team in the Super Bowl era to score at least 40 Had Intercepted 1 0 points in each of their first two games. The last two teams to accomplish that Sacked/Yards Lost 4/26 1/11 feat -- New Orleans in 2009 and Denver on 2013 -- went on to reach the Punts/Average 5/54.2 3/42.7 Super Bowl. Green Bay took the lead for good, 17-14, on Rodgers' 11-yard Penalties/Yards 7/70 8/60 pass to Tonyan with 14 seconds left in the second quarter. Jones then raced Fumbles/Lost 0/0 0/0 through a hole on the right side and scored on the Packers' first play from Possession Time 25:14 34:46 scrimmage in the second half. Jones' 75-yard burst was the longest touchdown run by a Packer since Ahman Green had a 90-yarder against Dallas in 2004. The Packers extended the lead to 31-14 later in the third quarter when Rashan Gary pressured Matthew Stafford into throwing an interception that Chandon Sullivan returned for a 7-yard touchdown.
2020 GREEN BAY PACKERS 72 GAME SUMMARIES Green Bay Packers ...... 3 10 14 10 — 37 New Orleans Saints ...... 7 10 10 3 — 30 New Orleans Saints Starters Green Bay Packers Starters OFFENSE DEFENSE OFFENSE DEFENSE WR 10 T. Smith DE 91 T. Hendrickson WR 83 M. Valdes-Scantling DE 94 D. Lowry G 75 A. Peat DE 94 C. Jordan TE 89 M. Lewis NT 95 T. Lancaster C 62 N. Easton DT 90 M. Brown LT 69 D. Bakhtiari OLB 52 R. Gary C 78 E. McCoy DT 98 S. Rankins LG 74 E. Jenkins OLB 91 P. Smith TE 89 J. Hill LB 47 A. Anzalone C 63 C. Linsley ILB 58 C. Kirksey T 71 R. Ramczyk LB 56 D. Davis RG 62 L. Patrick ILB 51 K. Barnes T 72 T. Armstead CB 20 J. Jenkins RT 77 B. Turner OLB 55 Z. Smith QB 7 T. Hill CB 23 M. Lattimore TE 85 R. Tonyan CB 23 J. Alexander QB 9 D. Brees S 27 M. Jenkins WR 13 A. Lazard CB 20 K. King RB 28 L. Murray S 43 M. Williams QB 12 A. Rodgers S 31 A. Amos RB 33 A. Jones S 26 D. Savage
Scoring Drives TEAM QTR TIME SCORING PLAY GB NO Packers 1 07:30 M.Crosby 52 yd. Field Goal (10-35, 5:38) 3 0 Saints 1 05:07 A.Kamara 11 yd. pass from D.Brees (W.Lutz kick) (4-77, 2:23) 3 7 Packers 2 14:12 M.Crosby 33 yd. Field Goal (12-60, 5:55) 6 7 Packers 2 10:32 A.Lazard 5 yd. pass from A.Rodgers (M.Crosby kick) (3-50, 1:27) 13 7 Saints 2 04:28 W.Lutz 45 yd. Field Goal (11-49, 6:04) 13 10 Saints 2 00:06 E.Sanders 10 yd. pass from D.Brees (W.Lutz kick) (11-61, 2:34) 13 17 Packers 3 12:58 A.Jones 1 yd. run (M.Crosby kick) (7-75, 2:02) 20 17 Saints 3 05:55 W.Lutz 35 yd. Field Goal (12-58, 7:03) 20 20 Packers 3 02:17 M.Lewis 18 yd. pass from A.Rodgers (M.Crosby kick) (6-75, 3:38) 27 20 Saints 3 00:33 A.Kamara 52 yd. pass from D.Brees (W.Lutz kick) (3-75, 1:44) 27 27 Packers 4 08:47 M.Crosby 49 yd. Field Goal (7-26, 3:32) 30 27 Packers 4 02:00 R.Tonyan 1 yd. pass from A.Rodgers (M.Crosby kick) (7-64, 4:36) 37 27 Saints 4 00:32 W.Lutz 34 yd. Field Goal (9-59, 1:28) 37 30 Green Bay Packers New Orleans Saints PASSING ATT CP YDS SK/YD TD LG INT RTG PASSING ATT CP YDS SK/YD TD LG INT RTG Aaron Rodgers 32 21 283 1/12 3 72 0 124.9 Drew Brees 36 29 288 2/13 3 52 0 127.8 TOTAL 32 21 283 1/12 3 72 0 124.9 TOTAL 36 29 288 2/13 3 52 0 127.8
RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD Aaron Jones 16 69 4.3 19 1 Latavius Murray 12 58 4.8 10 0 Jamaal Williams 6 14 2.3 6 0 Alvin Kamara 6 58 9.7 49 0 Aaron Rodgers 2 12 6.0 13 0 Taysom Hill 2 6 3.0 8 0 Tyler Ervin 1 5 5.0 5 0 TOTAL 20 122 6.1 49 0 Allen Lazard 1 -2 -2.0 -2 0 TOTAL 26 98 3.8 19 1
RECEIVING NO YDS AVG LG TD RECEIVING NO YDS AVG LG TD Allen Lazard 6 146 24.3 72 1 Alvin Kamara 13 139 10.7 52t 2 Robert Tonyan 5 50 10.0 16 1 Emmanuel Sanders 4 56 14.0 18 1 Jace Sternberger 3 36 12.0 23 0 Tre'Quan Smith 4 42 10.5 19 0 Aaron Jones 2 17 8.5 12 0 Jared Cook 2 21 10.5 13 0 Tyler Ervin 2 8 4.0 5 0 Adam Trautman 2 17 8.5 10 0 Marcedes Lewis 1 18 18.0 18t 1 Deonte Harris 2 5 2.5 3 0 Marquez Valdes-Scantling 1 5 5.0 5 0 Latavius Murray 1 7 7.0 7 0 Jamaal Williams 1 3 3.0 3 0 Taysom Hill 1 1 1.0 1 0 TOTAL 21 283 13.5 72 3 TOTAL 29 288 9.9 52T 3
TOP DEFENSE TOT SOLO AST SCK YDS INT TOP DEFENSE TOT SOLO AST SCK YDS INT Ty Summers 9 6 3 0.0 0.0 0 Malcolm Jenkins 9 7 2 0.0 0.0 0 Krys Barnes 8 3 5 0.0 0.0 0 C.J. Gardner-Johnson 7 6 1 0.0 0.0 0 Darnell Savage 7 5 2 0.0 0.0 0 Demario Davis 7 6 1 1.0 12.0 0
FIELD GOALS FGM/FGA PERCENT RESULTS FIELD GOALS FGM/FGA PERCENT RESULTS Mason Crosby 3-3 100.0 (52, 33, 49) Wil Lutz 3-3 100.0 (45, 35, 34) TOTAL 3-3 100.0 TOTAL 3-3 100.0
NEW ORLEANS (AP) — Aaron Rodgers passed for 283 yards and three Team Statistics Packers Saints touchdowns, and the Packers scored 10 points in the final nine minutes to First Downs 24 21 pull out a 37-30 victory over the New Orleans Saints on Sunday night. With 3rd Down Eff. (Made/Att/Pct) 5/11/45% 5/11/45% receiver Davante Adams unable to play because of a hamstring injury, 4th Down Eff. (Made/Att/Pct) 1/2/50% 1/1/100% Rodgers nonetheless found ways to attack New Orleans (1-2) with a variety Total Net Yards 369 397 of passes, short and long. Allen Lazard caught six passes for 146 yards for Total Plays 59 58 Green Bay (3-0), including gains of 48 and 72 yards on throws deep Yards Per Play 6.3 6.8 downfield that each set up touchdowns. Saints running back Alvin Kamara Rushes/Net Yards 26/98 20/122 built on a sensational start to the season, gaining 197 yards from scrimmage Net Passing 271 275 and scoring twice on short passes from Drew Brees, with shifty, tackle- Pass Attempts/Completions 32/21 36/29 slipping runs after the catch. The game featured a quick sequence of Had Intercepted 0 0 defensive highlights while the game was tied at 27 early in the fourth Sacked/Yards Lost 1/12 2/13 quarter. Just two plays after Malcolm Jenkins and Marshon Lattimore Punts/Average 1/38.0 3/38.3 combined to stop running back Aaron Jones short on fourth-and-1, Penalties/Yards 2/10 8/83 Za’Darius Smith stripped Taysom Hill on a read-option run and recovered the Fumbles/Lost 0/0 3/1 fumble to give Green Bay possession again near midfield. The Packers Possession Time 31:40 28:20 parlayed the turnover into a go-ahead, 49-yard field goal by Mason Crosby with 8:47 to play.
2020 GREEN BAY PACKERS 73 GAME SUMMARIES Atlanta Falcons ...... 0 3 6 7 — 16 Green Bay Packers ...... 7 13 7 3 — 30 Atlanta Falcons Starters Green Bay Packers Starters OFFENSE DEFENSE OFFENSE DEFENSE WR 11 J. Jones DE 56 D. Fowler Jr. WR 86 M. Taylor DE 94 D. Lowry WR 18 C. Ridley DE 55 S. Means LT 69 D. Bakhtiari NT 95 T. Lancaster G 77 J. Carpenter DT 96 T. Davison LG 74 E. Jenkins DE 96 K. Keke G 63 C. Lindstrom DT 97 G. Jarrett C 63 C. Linsley OLB 91 P. Smith C 51 A. Mack LB 54 F. Oluokun RG 62 L. Patrick ILB 51 K. Barnes TE 88 L. Stocker LB 45 D. Jones RT 77 B. Turner ILB 44 T. Summers T 70 J. Matthews LB 43 M. Walker TE 85 R. Tonyan OLB 55 Z. Smith T 76 K. McGary CB 26 I. Oliver WR 83 M. Valdes-Scantling CB 23 J. Alexander QB 2 M. Ryan CB 20 K. Sheffield QB 12 A. Rodgers CB 20 K. King RB 21 T. Gurley II S 32 J. Hawkins RB 33 A. Jones S 31 A. Amos FB 40 K. Smith S 27 D. Kazee RB 30 J. Williams S 26 D. Savage
Scoring Drives TEAM QTR TIME SCORING PLAY ATL GB Packers 1 10:01 A.Jones 6 yd. pass from A.Rodgers (M.Crosby kick) (7-73, 3:32) 0 7 Falcons 2 07:38 E.Fry 23 yd. Field Goal (20-94,10:36) 3 7 Packers 2 02:28 R.Tonyan 19 yd. pass from A.Rodgers (kick failed, wl) (11-75, 5:10) 3 13 Packers 2 00:46 R.Tonyan 8 yd. pass from A.Rodgers (M.Crosby kick) (7-50, 0:51) 3 20 Falcons 3 07:20 T.Gurley 5 yd. run (kick failed, wr) (8-67, 4:22) 9 20 Packers 3 05:18 R.Tonyan 21 yd. pass from A.Rodgers (M.Crosby kick) (4-51, 2:02) 9 27 Falcons 4 12:52 T.Gurley 3 yd. run (E.Fry kick) (13-75, 7:26) 16 27 Packers 4 05:55 M.Crosby 48 yd. Field Goal (10-45, 6:57) 16 30 Atlanta Falcons Green Bay Packers PASSING ATT CP YDS SK/YD TD LG INT RTG PASSING ATT CP YDS SK/YD TD LG INT RTG Matt Ryan 39 28 285 4/36 0 21 0 92.4 Aaron Rodgers 33 27 327 1/12 4 29 0 147.5 TOTAL 39 28 285 4/36 0 21 0 92.4 TOTAL 33 27 327 1/12 4 29 0 147.5
RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD Todd Gurley II 16 57 3.6 13 2 Aaron Jones 15 71 4.7 23 0 Brian Hill 4 10 2.5 6 0 Jamaal Williams 8 10 1.3 5 0 Matt Ryan 2 10 5.0 6 0 Aaron Rodgers 1 5 5.0 5 0 Ito Smith 2 3 1.5 3 0 AJ Dillon 1 3 3.0 3 0 Russell Gage 1 -2 -2.0 -2 0 Tim Boyle 1 -1 -1.0 -1 0 TOTAL 25 78 3.1 13 2 TOTAL 26 88 3.4 23 0
RECEIVING NO YDS AVG LG TD RECEIVING NO YDS AVG LG TD Olamide Zaccheaus 8 86 10.8 16 0 Jamaal Williams 8 95 11.9 29 0 Hayden Hurst 4 51 12.8 18 0 Robert Tonyan 6 98 16.3 27 3 Julio Jones 4 32 8.0 19 0 Aaron Jones 5 40 8.0 23 1 Christian Blake 3 47 15.7 21 0 Marquez Valdes-Scantling 4 45 11.3 17 0 Ito Smith 3 24 8.0 11 0 Darrius Shepherd 2 21 10.5 19 0 Russell Gage 2 22 11.0 13 0 Malik Taylor 1 20 20.0 20 0 Brian Hill 2 13 6.5 9 0 Tyler Ervin 1 8 8.0 8 0 Todd Gurley II 1 6 6.0 6 0 TOTAL 27 327 12.1 29 4 Keith Smith 1 4 4.0 4 0 TOTAL 28 285 10.2 21 0
TOP DEFENSE TOT SOLO AST SCK YDS INT TOP DEFENSE TOT SOLO AST SCK YDS INT Deion Jones 8 6 2 0.0 0.0 0 Za'Darius Smith 8 6 2 3.0 25.0 0 Foyesade Oluokun 8 5 3 0.0 0.0 0 Raven Greene 7 4 3 1.0 11.0 0 Kendall Sheffield 6 6 0 0.0 0.0 0 Ty Summers 7 6 1 0.0 0.0 0
FIELD GOALS FGM/FGA PERCENT RESULTS FIELD GOALS FGM/FGA PERCENT RESULTS Elliott Fry 1-1 100.0 (23) Mason Crosby 1-1 100.0 (48) TOTAL 1-1 100.0 TOTAL 1-1 100.0
GREEN BAY, Wis. (AP) — Tight End Robert Tonyan caught three of Aaron Team Statistics Falcons Packers Rodgers’ four touchdown passes, Za’Darius Smith recorded three sacks and First Downs 24 22 the Packers remained unbeaten with a 30-16 victory over the winless Atlanta 3rd Down Eff. (Made/Att/Pct) 3/12/25% 6/11/55% Falcons on Monday night. The Packers (4-0) have opened a season by 4th Down Eff. (Made/Att/Pct) 2/4/50% 1/2/50% scoring at least 30 points in four straight games for the first time in franchise Total Net Yards 327 403 history. Star receiver Davante Adams sat out a second straight game with a Total Plays 68 60 hamstring injury, receiver Allen Lazard is on injured reserve with a core Yards Per Play 4.8 6.7 problem, and a knee injury sidelined veteran tight end Marcedes Lewis. Yet Rushes/Net Yards 25/78 26/88 that didn’t slow down Rodgers, who capitalized on Atlanta’s depleted Net Passing 249 315 secondary to finish 27 of 33 for 327 yards and four touchdowns. Tonyan had Pass Attempts/Completions 39/28 33/27 touchdown receptions of 19 and 8 yards to cap the Packers’ final two first- Had Intercepted 0 0 half possessions before adding a 21-yard touchdown reception midway Sacked/Yards Lost 4/36 1/12 through the third quarter. Todd Gurley’s two touchdown runs couldn’t stop Punts/Average 3/40.7 2/40.5 the Falcons from their first 0-4 start since 1999. Atlanta already was playing Penalties/Yards 3/23 3/30 without safeties Ricardo Allen (elbow) and Keanu Neal (hamstring) as well as Fumbles/Lost 0/0 0/0 cornerback A.J. Terrell (COVID-19 reserve). That beleaguered secondary Possession Time 30:22 29:38 took more hits when Damontae Kazee got carted off the field and Jaylinn Hawkins left with a concussion in the second quarter. Green Bay capitalized by scoring touchdowns on three of its four first-half possessions to build a 20-3 halftime lead. The Packers’ other first-half series ended less than a yard away from the end zone when Deion Jones stuffed Jamaal Williams on fourth-and-goal.
2020 GREEN BAY PACKERS 74 GAME SUMMARIES Green Bay Packers ...... 10 0 0 0 — 10 Tampa Bay Buccaneers ...... 0 28 10 0 — 38 Tampa Bay Buccaneers Starters Green Bay Packers Starters OFFENSE DEFENSE OFFENSE DEFENSE WR 13 M. Evans DL 92 W. Gholston WR 17 D. Adams DE 94 D. Lowry WR 14 C. Godwin DL 56 R. Nuñez-Roches TE 89 M. Lewis NT 97 K. Clark WR 18 T. Johnson DL 93 N. Suh LT 69 D. Bakhtiari DE 96 K. Keke G 65 A. Cappa CB 24 C. Davis III LG 74 E. Jenkins OLB 91 P. Smith G 74 A. Marpet CB 23 S. Murphy-Bunting C 63 C. Linsley ILB 51 K. Barnes C 66 R. Jensen S 31 A. Winfield Jr. RG 62 L. Patrick OLB 55 Z. Smith TE 87 R. Gronkowski S 33 J. Whitehead RT 77 B. Turner CB 23 J. Alexander T 76 D. Smith ------TE 85 R. Tonyan CB 37 J. Jackson T 78 T. Wirfs ------WR 83 M. Valdes-Scantling CB 39 C. Sullivan QB 12 T. Brady ------QB 12 A. Rodgers S 31 A. Amos RB 27 R. Jones II ------RB 33 A. Jones S 26 D. Savage
Scoring Drives TEAM QTR TIME SCORING PLAY GB TB Packers 1 10:27 M.Crosby 39 yd. Field Goal (10-54, 4:33) 3 0 Packers 1 00:48 A.Jones 1 yd. run (M.Crosby kick) (11-80, 7:32) 10 0 Buccaneers 2 12:42 J.Dean 32 yd. interception return (R.Succop kick) 10 7 Buccaneers 2 11:02 R.Jones 2 yd. run (R.Succop kick) (1-2, 0:03) 10 14 Buccaneers 2 04:35 T.Johnson 7 yd. pass from T.Brady (R.Succop kick) (11-65, 6:05) 10 21 Buccaneers 2 01:02 R.Gronkowski 12 yd. pass from T.Brady (R.Succop kick) (7-62, 1:40) 10 28 Buccaneers 3 12:14 R.Succop 50 yd. Field Goal (6-43, 2:46) 10 31 Buccaneers 3 02:40 R.Jones 1 yd. run (R.Succop kick) (7-85, 2:47) 10 38 Green Bay Packers Tampa Bay Buccaneers PASSING ATT CP YDS SK/YD TD LG INT RTG PASSING ATT CP YDS SK/YD TD LG INT RTG Aaron Rodgers 35 16 160 4/42 0 20 2 35.4 Tom Brady 27 17 166 0/0 2 31 0 104.9 Tim Boyle 0 0 0 1/11 0 0 0 0.0 Blaine Gabbert 1 0 0 0/0 0 0 0 39.6 TOTAL 35 16 160 5/53 0 20 2 35.4 TOTAL 28 17 166 0/0 2 31 0 101.2
RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD Jamaal Williams 4 34 8.5 25 0 Ronald Jones II 23 113 4.9 25 2 AJ Dillon 5 31 6.2 20 0 Ke'Shawn Vaughn 5 42 8.4 19 0 Aaron Jones 10 15 1.5 7 1 Blaine Gabbert 3 2 0.7 2 0 Aaron Rodgers 2 14 7.0 8 0 LeSean McCoy 4 1 0.3 2 0 TOTAL 21 94 4.5 25 1 TOTAL 35 158 4.5 25 2
RECEIVING NO YDS AVG LG TD RECEIVING NO YDS AVG LG TD Davante Adams 6 61 10.2 18 0 Rob Gronkowski 5 78 15.6 31 1 Marquez Valdes-Scantling 3 32 10.7 15 0 Chris Godwin 5 48 9.6 25 0 Aaron Jones 3 26 8.7 20 0 Ronald Jones II 2 8 4.0 6 0 Robert Tonyan 3 25 8.3 11 0 Mike Evans 1 10 10.0 10 0 Darrius Shepherd 1 16 16.0 16 0 Tyler Johnson 1 7 7.0 7t 1 TOTAL 16 160 10.0 20 0 LeSean McCoy 1 6 6.0 6 0 Scotty Miller 1 6 6.0 6 0 Cameron Brate 1 3 3.0 3 0 TOTAL 17 166 9.8 31 2
TOP DEFENSE TOT SOLO AST SCK YDS INT TOP DEFENSE TOT SOLO AST SCK YDS INT Krys Barnes 10 7 3 0.0 0.0 0 Devin White 10 9 1 1.0 11.0 0 Josh Jackson 6 5 1 0.0 0.0 0 Lavonte David 8 6 2 1.5 15.0 0 Kingsley Keke 6 0 6 0.0 0.0 0 Carlton Davis III 6 5 1 0.0 0.0 0
FIELD GOALS FGM/FGA PERCENT RESULTS FIELD GOALS FGM/FGA PERCENT RESULTS Mason Crosby 1-1 100.0 (39) Ryan Succop 1-1 100.0 (50) TOTAL 1-1 100.0 TOTAL 1-1 100.0
TAMPA, Fla. (AP) — A stingy Buccaneers defense turned a rare meeting Team Statistics Packers Buccaneers between Tom Brady and Aaron Rodgers into a mismatch. Brady outplayed First Downs 13 21 Rodgers, however a young Bucs secondary was equally impressive in setting 3rd Down Eff. (Made/Att/Pct) 7/17/41% 5/12/42% the tone for a 38-10 rout of the previously unbeaten Packers, who unraveled 4th Down Eff. (Made/Att/Pct) 0/0/0% 0/0/0% after taking a 10-0 lead thanks to a Mason Crosby field goal and Aaron Jones Total Net Yards 201 324 rushing touchdown and limiting Tampa Bay to just five offensive plays in the Total Plays 61 63 first quarter. Rodgers threw two interceptions — Green Bay’s first turnovers Yards Per Play 3.3 5.1 of the season — within a three-pass span of the second quarter to turn the Rushes/Net Yards 21/94 35/158 10-point lead into a 14-10 deficit. Cornerback Jamel Dean returned the first Net Passing 107 166 pick 32 yards for a touchdown, while safety Mike Edwards ran the other back Pass Attempts/Completions 35/16 28/17 38 yards to the Packers 2 to set up another TD. Brady got his favorite target Had Intercepted 2 0 from his days with the Patriots into the mix, throwing a 12-yard touchdown Sacked/Yards Lost 5/53 0/0 pass to Rob Gronkowski for a 28-10 halftime lead. Brady also threw a 7-yard Punts/Average 7/46.4 5/38.4 TD pass to rookie Tyler Johnson and Ronald Jones rushed for 113 yards and Penalties/Yards 6/76 0/0 a pair of TDs for Tampa Bay, which didn’t turn the ball over, allow a sack or Fumbles/Lost 1/0 0/0 commit a single penalty after being flagged 11 times in a one-point loss to Possession Time 31:37 28:23 Chicago in its previous game. Both of Rodgers’ interceptions — his first with multiple picks since throwing three in a loss to Carolina on Dec. 17, 2017 — came on throws intended for Davante Adams, who had a team-leading six catches for 61 yards in his return from a hamstring injury that sidelined him two games. Rodgers finished 16 of 35 for 160 yards and no touchdowns after completing 70.5 percent of his passes and throwing for 13 TDs and no interceptions in Green Bay’s first four games.
2020 GREEN BAY PACKERS 75 GAME SUMMARIES Green Bay Packers ...... 7 14 7 7 — 35 Houston Texans ...... 0 0 7 13 — 20 Houston Texans Starters Green Bay Packers Starters OFFENSE DEFENSE OFFENSE DEFENSE C 73 Z. Fulton DT 96 P. Hall WR 17 D. Adams DE 94 D. Lowry C 66 N. Martin DT 92 B. Dunn TE 89 M. Lewis NT 97 K. Clark TE 87 D. Fells DE 91 C. Watkins LT 77 B. Turner OLB 91 P. Smith TE 85 P. Brown DE 99 J. Watt LG 74 E. Jenkins ILB 51 K. Barnes QB 4 D. Watson CB 26 V. Hargreaves III C 63 C. Linsley ILB 54 K. Martin RB 31 D. Johnson CB 21 B. Roby RG 62 L. Patrick OLB 55 Z. Smith WR 13 B. Cooks S 23 E. Murray RT 71 R. Wagner CB 23 J. Alexander WR 15 W. Fuller V S 20 J. Reid TE 85 R. Tonyan CB 37 J. Jackson WR 83 M. Valdes-Scantling CB 39 C. Sullivan QB 12 A. Rodgers S 31 A. Amos RB 30 J. Williams S 25 W. Redmond
OFFICIALS: Referee: Clay Martin (19), Umpire: Tony Michalek (115), Down Judge: Derick Bowers (74), Field Judge: Mike Weatherford (116), Side Judge: Eugene Hall (103), Back Judge: Steve Patrick (17), Replay Assistant: Kevin Stine, Replay Assistant: Yvonda Lewis
Scoring Drives TEAM QTR TIME SCORING PLAY GB HOU Packers 1 09:21 D.Adams 3 yd. pass from A.Rodgers (M.Crosby kick) (10-75, 5:39) 7 0 Packers 2 13:33 J.Sternberger 3 yd. pass from A.Rodgers (M.Crosby kick) (9-88, 4:37) 14 0 Packers 2 00:14 M.Taylor 1 yd. pass from A.Rodgers (M.Crosby kick) (9-69, 2:24) 21 0 Texans 3 08:55 Da.Johnson 3 yd. pass from D.Watson (K.Fairbairn kick) (11-75, 6:05) 21 7 Packers 3 04:44 D.Adams 45 yd. pass from A.Rodgers (M.Crosby kick) (8-75, 4:11) 28 7 Texans 4 14:12 K.Fairbairn 38 yd. Field Goal (7-47, 3:36) 28 10 Texans 4 09:56 K.Fairbairn 29 yd. Field Goal (7-11, 2:12) 28 13 Packers 4 03:40 J.Williams 1 yd. run (M.Crosby kick) (7-46, 3:18) 35 13 Texans 4 01:33 W.Fuller 6 yd. pass from D.Watson (K.Fairbairn kick) (9-75, 2:07) 35 20 Green Bay Packers Houston Texans PASSING ATT CP YDS SK/YD TD LG INT RTG PASSING ATT CP YDS SK/YD TD LG INT RTG Aaron Rodgers 34 23 283 0/0 4 45 0 132.4 Deshaun Watson 39 29 309 3/23 2 30 0 114.2 TOTAL 34 23 283 0/0 4 45 0 132.4 TOTAL 39 29 309 3/23 2 30 0 114.2
RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD Jamaal Williams 19 77 4.1 13 1 David Johnson 14 42 3.0 13 0 AJ Dillon 5 11 2.2 5 0 Deshaun Watson 7 38 5.4 14 0 Marquez Valdes-Scantling 1 9 9.0 9 0 Duke Johnson 1 -1 -1.0 -1 0 Tim Boyle 2 -1 -0.5 0 0 TOTAL 22 79 3.6 14 0 TOTAL 27 96 3.6 13 1
RECEIVING NO YDS AVG LG TD RECEIVING NO YDS AVG LG TD Davante Adams 13 196 15.1 45t 2 Randall Cobb 8 95 11.9 28 0 Jamaal Williams 4 37 9.3 17 0 Brandin Cooks 7 60 8.6 12 0 Robert Tonyan 2 32 16.0 31 0 Duke Johnson 5 43 8.6 30 0 Malik Taylor 2 6 3.0 5 1 David Johnson 4 42 10.5 16 1 Marcedes Lewis 1 9 9.0 9 0 Will Fuller V 3 35 11.7 24 1 Jace Sternberger 1 3 3.0 3t 1 Kenny Stills 2 34 17.0 18 0 TOTAL 23 283 12.3 45T 4 TOTAL 29 309 10.7 30 2
TOP DEFENSE TOT SOLO AST SCK YDS INT TOP DEFENSE TOT SOLO AST SCK YDS INT Krys Barnes 8 4 4 1.0 5.0 0 Zach Cunningham 11 4 7 0.0 0.0 0 Raven Greene 7 5 2 0.0 0.0 0 Tyrell Adams 10 5 5 0.0 0.0 0 Adrian Amos 6 5 1 1.0 12.0 0 Eric Murray 6 4 2 0.0 0.0 0
FIELD GOALS FGM/FGA PERCENT RESULTS FIELD GOALS FGM/FGA PERCENT RESULTS No Field Goals Ka'imi Fairbairn 2-3 66.7 41WL (38, 29) TOTAL 2-3 66.7
HOUSTON (AP) — Aaron Rodgers threw for 283 yards and four touchdowns Team Statistics Packers Texans to lead the Packers to a 35-20 victory over the Texans. Rodgers played a First Downs 22 20 near-flawless game and tied his season high for TD passes, despite being 3rd Down Eff. (Made/Att/Pct) 7/12/58% 6/14/43% without leading rusher Aaron Jones and left tackle David Bakhtiari. Green 4th Down Eff. (Made/Att/Pct) 0/0/0% 0/1/0% Bay’s strong day on offense was aided by a career-high 196 yards receiving Total Net Yards 379 365 by Davante Adams, who had touchdown receptions of 3 and 45 yards. The Total Plays 61 64 Packers took an early lead when Adams grabbed a 3-yard touchdown Yards Per Play 6.2 5.7 reception on the first possession. They made it 14-0 when Jace Sternberger Rushes/Net Yards 27/96 22/79 caught a 3-yard TD pass early in the second quarter, a play that was set up Net Passing 283 286 by a 36-yard reception by Adams two plays earlier. Malik Taylor scored his Pass Attempts/Completions 34/23 39/29 first career touchdown on a 1-yard reception late in the second quarter that Had Intercepted 0 0 put the Packers up 21-0 at halftime. The Texans finally got on the board Sacked/Yards Lost 0/0 3/23 when Watson threw a 3-yard pass to Johnson to cut the lead to 21-7 early in Punts/Average 5/41.4 4/51.3 the third quarter, but Green Bay pushed its advantage to 21 again later in the Penalties/Yards 5/40 6/55 third when Adams got in front of the defense to grab a 45-yard reception. It Fumbles/Lost 0/0 2/1 marked the second game for Adams this season with at least 150 yards Possession Time 28:54 31:06 receiving and two touchdowns, making him just the third player in franchise history to have two such games in one year and the first since Antonio Freeman in 1998. The Texans added a field goal early in the fourth quarter and got another one following a blocked punt that got them within 28-13 with about 10 minutes left, before Green Bay made it 35-13 when Jamaal Williams scored on a 1-yard run with about four minutes to go. Deshaun Watson threw a 6-yard touchdown pass to Will Fuller with about 90 seconds left before the Texans recovered an onside kick. But David Johnson fumbled after a reception on the next play and the Packers ran out the clock.
2020 GREEN BAY PACKERS 76 GAME SUMMARIES Minnesota Vikings ...... 7 7 14 0 — 28 Green Bay Packers ...... 7 7 0 8 — 22 Minnesota Vikings Starters Green Bay Packers Starters OFFENSE DEFENSE OFFENSE DEFENSE C 56 G. Bradbury DT 94 J. Johnson WR 17 D. Adams DE 94 D. Lowry TE 82 K. Rudolph DT 93 S. Stephen TE 89 M. Lewis NT 97 K. Clark WR 18 J. Jefferson DE 90 J. Holmes LT 77 B. Turner DE 96 K. Keke WR 19 A. Thielen DE 95 I. Odenigbo LG 74 E. Jenkins OLB 91 P. Smith QB 8 K. Cousins CB 27 C. Dantzler C 63 C. Linsley ILB 51 K. Barnes RB 33 D. Cook CB 20 J. Gladney RG 62 L. Patrick ILB 54 K. Martin FB 30 C. Ham S 41 A. Harris RT 71 R. Wagner OLB 55 Z. Smith ------S 22 H. Smith TE 85 R. Tonyan CB 23 J. Alexander WR 83 M. Valdes-Scantling CB 37 J. Jackson QB 12 A. Rodgers S 31 A. Amos RB 30 J. Williams S 26 D. Savage
Scoring Drives TEAM QTR TIME SCORING PLAY MIN GB Packers 1 07:01 D.Adams 5 yd. pass from A.Rodgers (M.Crosby kick) (13-75, 7:59) 0 7 Vikings 1 00:47 D.Cook 21 yd. run (D.Bailey kick) (10-73, 6:14) 7 7 Packers 2 06:53 D.Adams 1 yd. pass from A.Rodgers (M.Crosby kick) (15-72, 8:54) 7 14 Vikings 2 00:31 D.Cook 1 yd. run (D.Bailey kick) (12-67, 6:22) 14 14 Vikings 3 10:00 D.Cook 1 yd. run (D.Bailey kick) (10-85, 5:00) 21 14 Vikings 3 05:52 D.Cook 50 yd. pass from K.Cousins (D.Bailey kick) (4-63, 2:06) 28 14 Packers 4 02:42 D.Adams 7 yd. pass from A.Rodgers (J.Williams run) (9-74, 3:05) 28 22 Minnesota Vikings Green Bay Packers PASSING ATT CP YDS SK/YD TD LG INT RTG PASSING ATT CP YDS SK/YD TD LG INT RTG Kirk Cousins 14 11 160 1/9 1 50 0 138.1 Aaron Rodgers 41 27 291 1/0 3 45 0 110.9 TOTAL 14 11 160 1/9 1 50 0 138.1 TOTAL 41 27 291 1/0 3 45 0 110.9
RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD Dalvin Cook 30 163 5.4 37 3 Jamaal Williams 16 75 4.7 10 0 Alexander Mattison 3 8 2.7 3 0 AJ Dillon 5 21 4.2 8 0 C.J. Ham 1 2 2.0 2 0 Aaron Rodgers 2 9 4.5 7 0 TOTAL 34 173 5.1 37 3 Marquez Valdes-Scantling 1 4 4.0 4 0 TOTAL 24 109 4.5 10 0
RECEIVING NO YDS AVG LG TD RECEIVING NO YDS AVG LG TD Adam Thielen 3 27 9.0 12 0 Davante Adams 7 53 7.6 15 3 Justin Jefferson 3 26 8.7 12 0 Jamaal Williams 6 27 4.5 7 0 Dalvin Cook 2 63 31.5 50t 1 Robert Tonyan 5 79 15.8 45 0 Chad Beebe 1 16 16.0 16 0 Jace Sternberger 3 46 15.3 27 0 Irv Smith Jr. 1 16 16.0 16 0 Malik Taylor 1 26 26.0 26 0 Kyle Rudolph 1 12 12.0 12 0 Marquez Valdes-Scantling 1 19 19.0 19 0 TOTAL 11 160 14.5 50T 1 AJ Dillon 1 16 16.0 16 0 Equanimeous St. Brown 1 12 12.0 12 0 Tyler Ervin 1 7 7.0 7 0 Darrius Shepherd 1 6 6.0 6 0 TOTAL 27 291 10.8 45 3
TOP DEFENSE TOT SOLO AST SCK YDS INT TOP DEFENSE TOT SOLO AST SCK YDS INT Eric Kendricks 12 8 4 0.0 0.0 0 Adrian Amos 7 6 1 0.0 0.0 0 Harrison Smith 8 5 3 0.0 0.0 0 Za'Darius Smith 6 3 3 0.0 0.0 0 Jeff Gladney 8 6 2 0.0 0.0 0 Jaire Alexander 5 5 0 0.0 0.0 0
FIELD GOALS FGM/FGA PERCENT RESULTS FIELD GOALS FGM/FGA PERCENT RESULTS No Field Goals No Field Goals
GREEN BAY, Wis. (AP) — Dalvin Cook gained 226 yards from scrimmage Team Statistics Vikings Packers and became the first Minnesota Viking in over four decades to score four First Downs 20 24 touchdowns in a single game as Minnesota defeated the Green Bay Packers 3rd Down Eff. (Made/Att/Pct) 4/8/50% 5/11/45% 28-22. Cook rushed for 163 yards on 30 carries and had two catches for 63 4th Down Eff. (Made/Att/Pct) 1/1/100% 3/5/60% yards, as his presence gave the Vikings a edge on a day when winds started Total Net Yards 324 400 out at 23 mph and occasionally got stronger, making it difficult to throw Total Plays 49 66 downfield. Each of the Vikings’ first four possessions ended with Cook Yards Per Play 6.6 6.1 touchdowns. He had two 1-yard touchdown bursts plus a touchdown run Rushes/Net Yards 34/173 24/109 from 21 yards out. He also caught a third-and-9 pass behind the line of Net Passing 151 291 scrimmage and turned it into a 50-yard score that put Minnesota ahead Pass Attempts/Completions 14/11 41/27 28-14. Minnesota withstood a three-touchdown performance from Green Had Intercepted 0 0 Bay’s Davante Adams, who had seven catches for 53 yards. Green Bay didn’t Sacked/Yards Lost 1/9 1/0 have leading rusher Aaron Jones, who missed a second straight game with a Punts/Average 3/37.7 1/38.0 calf injury. The Packers were able to cut the lead to 28-22 when Adams Penalties/Yards 7/36 9/85 caught a 7-yard touchdown pass and Jamaal Williams ran in a two-point Fumbles/Lost 0/0 1/1 conversion with 2:42 left. Williams was initially ruled down shy of the goal Possession Time 27:48 32:12 line before replays determined he had scored. Green Bay got the ball back and reached Minnesota’s 41-yard line with 12 seconds and no timeouts left, but rookie D.J. Wonnum sacked Aaron Rodgers and knocked the ball loose. Eric Wilson recovered at the 24 as time expired.
2020 GREEN BAY PACKERS 77 GAME SUMMARIES Green Bay Packers ...... 7 14 10 3 — 34 San Francisco 49ers ...... 3 0 0 14 — 17 San Francisco 49ers Starters Green Bay Packers Starters OFFENSE DEFENSE OFFENSE DEFENSE WR 13 R. James DT 99 J. Kinlaw WR 17 D. Adams DE 94 D. Lowry WR 15 T. Taylor DL 92 K. Hyder Jr. TE 89 M. Lewis NT 97 K. Clark WR 1 R. Cracraft DL 91 A. Armstead LT 77 B. Turner DE 96 K. Keke OL 60 D. Brunskill DL 93 D. Jones LG 74 E. Jenkins OLB 91 P. Smith OL 66 T. Compton LB 51 A. Al-Shaair C 63 C. Linsley ILB 51 K. Barnes OL 67 J. Skule LB 57 D. Greenlaw RG 62 L. Patrick OLB 55 Z. Smith OL 75 L. Tomlinson LB 54 F. Warner RT 71 R. Wagner CB 23 J. Alexander TE 82 R. Dwelley CB 41 E. Moseley TE 85 R. Tonyan CB 37 J. Jackson T 69 M. McGlinchey CB 22 J. Verrett WR 83 M. Valdes-Scantling CB 39 C. Sullivan QB 4 N. Mullens S 29 J. Tartt QB 12 A. Rodgers S 31 A. Amos RB 28 J. McKinnon ------RB 33 A. Jones S 26 D. Savage
Scoring Drives TEAM QTR TIME SCORING PLAY GB SF Packers 1 11:42 D.Adams 36 yd. pass from A.Rodgers (M.Crosby kick) (6-75, 3:18) 7 0 49ers 1 00:47 R.Gould 22 yd. Field Goal (11-76, 6:11) 7 3 Packers 2 07:01 M.Lewis 1 yd. pass from A.Rodgers (M.Crosby kick) (9-38, 4:41) 14 3 Packers 2 01:53 M.Valdes-Scantling 52 yd. pass from A.Rodgers (M.Crosby kick) (8-87, 3:33) 21 3 Packers 3 07:17 M.Valdes-Scantling 1 yd. pass from A.Rodgers (M.Crosby kick) (9-80, 6:00) 28 3 Packers 3 02:01 M.Crosby 19 yd. Field Goal (7-46, 3:26) 31 3 Packers 4 06:15 M.Crosby 53 yd. Field Goal (12-60, 8:14) 34 3 49ers 4 05:00 R.James 41 yd. pass from N.Mullens (R.Gould kick) (4-80, 1:15) 34 10 49ers 4 00:04 J.McKinnon 1 yd. run (R.Gould kick) (10-75, 2:35) 34 17 Green Bay Packers San Francisco 49ers PASSING ATT CP YDS SK/YD TD LG INT RTG PASSING ATT CP YDS SK/YD TD LG INT RTG Aaron Rodgers 31 25 305 1/11 4 52 0 147.2 Nick Mullens 35 22 291 1/9 1 47 1 86.7 TOTAL 31 25 305 1/11 4 52 0 147.2 TOTAL 35 22 291 1/9 1 47 1 86.7
RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD Aaron Jones 15 58 3.9 11 0 Jerick McKinnon 12 52 4.3 11 1 Tyler Ervin 8 24 3.0 8 0 JaMycal Hasty 4 3 0.8 4 0 Malik Taylor 1 9 9.0 9 0 Nick Mullens 1 0 0.0 0 0 Dexter Williams 2 8 4.0 5 0 TOTAL 17 55 3.2 11 1 Aaron Rodgers 1 7 7.0 7 0 John Lovett 3 6 2.0 4 0 Tim Boyle 1 -1 -1.0 -1 0 TOTAL 31 111 3.6 11 0
RECEIVING NO YDS AVG LG TD RECEIVING NO YDS AVG LG TD Davante Adams 10 173 17.3 49 1 Richie James 9 184 20.4 47 1 Aaron Jones 5 21 4.2 15 0 Ross Dwelley 3 52 17.3 36 0 Tyler Ervin 4 48 12.0 24 0 Jerick McKinnon 3 16 5.3 8 0 Marquez Valdes-Scantling 2 53 26.5 52t 2 River Cracraft 2 13 6.5 8 0 Robert Tonyan 1 5 5.0 5 0 JaMycal Hasty 2 10 5.0 7 0 Darrius Shepherd 1 3 3.0 3 0 Trent Taylor 1 9 9.0 9 0 Jace Sternberger 1 1 1.0 1 0 Kyle Juszczyk 1 4 4.0 4 0 Marcedes Lewis 1 1 1.0 1t 1 Jordan Reed 1 3 3.0 3 0 TOTAL 25 305 12.2 52T 4 TOTAL 22 291 13.2 47 1
TOP DEFENSE TOT SOLO AST SCK YDS INT TOP DEFENSE TOT SOLO AST SCK YDS INT Adrian Amos 5 5 0 0.0 0.0 0 Fred Warner 13 8 5 0.0 0.0 0 Oren Burks 5 3 2 0.0 0.0 0 Dre Greenlaw 8 4 4 0.0 0.0 0 Josh Jackson 4 4 0 0.0 0.0 0 Jaquiski Tartt 7 3 4 0.0 0.0 0
FIELD GOALS FGM/FGA PERCENT RESULTS FIELD GOALS FGM/FGA PERCENT RESULTS Mason Crosby 2-2 100.0 (19, 53) Robbie Gould 1-1 100.0 (22) TOTAL 2-2 100.0 TOTAL 1-1 100.0
SANTA CLARA, Calif. (AP) — Aaron Rodgers threw for 305 yards and four Team Statistics Packers 49ers touchdowns as the Packers overwhelmed the depleted 49ers 34-17 on First Downs 21 17 Thursday Night Football. Rodgers connected on deep shots to Davante 3rd Down Eff. (Made/Att/Pct) 6/12/50% 3/10/30% Adams and Marquez Valdes-Scantling, and a short toss to Marcedes Lewis 4th Down Eff. (Made/Att/Pct) 1/1/100% 0/1/0% in the first half to get the Packers (6-2) out to a 21-3 lead over the Niners Total Net Yards 405 337 (4-5). The game looked little like the two meetings between the teams during Total Plays 63 53 the 2019 season, as San Francisco was without several prominant players, Yards Per Play 6.4 6.4 including quarterback Jimmy Garoppolo and All-Pro tight end George Kittle. Rushes/Net Yards 31/111 17/55 The Packers, who were missing three players on the COVID-19 list, took Net Passing 294 282 advantage of the opportunity. Rodgers capped the opening drive with a 36- Pass Attempts/Completions 31/25 35/22 yard shot to Adams, who made an acrobatic catch in the end zone for his Had Intercepted 0 1 league-leading eighth TD reception of the season. Nick Mullens had an Sacked/Yards Lost 1/11 1/9 apparent TD throw to River Cracraft wiped out on replay for San Francisco Punts/Average 3/51.3 4/54.8 and then threw an interception to Raven Greene after backup left tackle Penalties/Yards 5/45 4/33 Justin Skule got beat for a pressure from Preston Smith. That mistake led to Fumbles/Lost 0/0 1/1 Rodgers’ 1-yard throw to Lewis and the Packers took control when Valdes- Possession Time 36:30 23:30 Scantling got behind the defense for the 52-yard catch late in the first half. Rodgers added a second TD pass to Valdes-Scantling and the rout was on. Adams finished with 10 catches for 173 yards, making him the first Packers player with three 150-yard receiving games since Donald Driver in 2006.
2020 GREEN BAY PACKERS 78 GAME SUMMARIES Jacksonville Jaguars ...... 3 7 7 3 — 20 Green Bay Packers ...... 0 17 0 7 — 24 Jacksonville Jaguars Starters Green Bay Packers Starters OFFENSE DEFENSE OFFENSE DEFENSE WR 17 D. Chark Jr. DE 41 J. Allen WR 17 D. Adams DE 94 D. Lowry WR 84 K. Cole DE 96 A. Gotsis TE 89 M. Lewis NT 97 K. Clark WR 18 C. Conley DT 52 D. Hamilton LT 69 D. Bakhtiari DE 96 K. Keke OL 60 A. Cann DL 90 T. Bryan LG 74 E. Jenkins OLB 91 P. Smith OL 68 A. Norwell LB 55 K. Correa C 63 C. Linsley ILB 58 C. Kirksey OL 74 C. Robinson LB 44 M. Jack RG 62 L. Patrick OLB 55 Z. Smith OL 69 T. Shatley LB 47 J. Schobert RT 77 B. Turner CB 39 C. Sullivan OL 75 J. Taylor CB 23 C. Henderson TE 85 R. Tonyan CB 37 J. Jackson TE 80 J. O'Shaughnessy CB 22 S. Jones WR 83 M. Valdes-Scantling CB 29 K. Hollman QB 6 J. Luton S 20 D. Thomas QB 12 A. Rodgers S 31 A. Amos RB 30 J. Robinson S 26 J. Wilson RB 33 A. Jones S 26 D. Savage
Scoring Drives TEAM QTR TIME SCORING PLAY JAX GB Jaguars 1 10:36 C.McLaughlin 52 yd. Field Goal (7-29, 2:46) 3 0 Packers 2 14:47 M.Valdes-Scantling 78 yd. pass from A.Rodgers (M.Crosby kick) (4-91, 2:00) 3 7 Jaguars 2 10:06 K.Cole Sr. 91 yd. punt return (C.McLaughlin kick) 10 7 Packers 2 02:15 A.Rodgers 5 yd. run (M.Crosby kick) (13-81, 7:51) 10 14 Packers 2 00:02 M.Crosby 39 yd. Field Goal (6-5, 1:26) 10 17 Jaguars 3 10:30 K.Cole Sr. 12 yd. pass from J.Luton (C.McLaughlin kick) (3-16, 1:26) 17 17 Jaguars 4 12:40 C.McLaughlin 31 yd. Field Goal (7-43, 3:36) 20 17 Packers 4 09:03 D.Adams 6 yd. pass from A.Rodgers (M.Crosby kick) (7-75, 3:37) 20 24 Jacksonville Jaguars Green Bay Packers PASSING ATT CP YDS SK/YD TD LG INT RTG PASSING ATT CP YDS SK/YD TD LG INT RTG Jake Luton 35 18 169 3/18 1 21 1 62.7 Aaron Rodgers 34 24 325 1/10 2 78 1 108.1 TOTAL 35 18 169 3/18 1 21 1 62.7 TOTAL 34 24 325 1/10 2 78 1 108.1
RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD James Robinson 23 109 4.7 20 0 Aaron Jones 13 46 3.5 20 0 TOTAL 23 109 4.7 20 0 Jamaal Williams 8 30 3.8 7 0 Aaron Rodgers 3 4 1.3 5t 1 Tyler Ervin 1 0 0.0 0 0 TOTAL 25 80 3.2 20 1
RECEIVING NO YDS AVG LG TD RECEIVING NO YDS AVG LG TD Keelan Cole 5 47 9.4 13 1 Davante Adams 8 66 8.3 22 1 DJ Chark Jr. 4 56 14.0 21 0 Aaron Jones 5 49 9.8 14 0 Chris Conley 4 43 10.8 18 0 Marquez Valdes-Scantling 4 149 37.3 78t 1 Tyler Eifert 2 15 7.5 8 0 Robert Tonyan 3 33 11.0 23 0 James Robinson 2 3 1.5 2 0 Jamaal Williams 3 25 8.3 12 0 Dare Ogunbowale 1 5 5.0 5 0 Tyler Ervin 1 3 3.0 3 0 TOTAL 18 169 9.4 21 1 TOTAL 24 325 13.5 78T 2
TOP DEFENSE TOT SOLO AST SCK YDS INT TOP DEFENSE TOT SOLO AST SCK YDS INT Joe Schobert 9 4 5 0.0 0.0 0 Christian Kirksey 7 4 3 0.0 0.0 0 Sidney Jones 9 6 3 0.0 0.0 1 Chandon Sullivan 6 6 0 0.0 0.0 0 Daniel Thomas 8 5 3 0.0 0.0 0 Darnell Savage 5 4 1 0.0 0.0 0
FIELD GOALS FGM/FGA PERCENT RESULTS FIELD GOALS FGM/FGA PERCENT RESULTS Chase McLaughlin 2-2 100.0 (52, 31) Mason Crosby 1-1 100.0 (39) TOTAL 2-2 100.0 TOTAL 1-1 100.0
GREEN BAY, Wis. (AP) — Aaron Rodgers threw two touchdown passes and Team Statistics Jaguars Packers ran for a score, but the Packers needed to make a defensive stand in the final First Downs 16 16 minute to eke out a 24-20 victory over the slumping Jacksonville Jaguars on 3rd Down Eff. (Made/Att/Pct) 4/13/31% 5/13/38% Sunday. Rodgers withstood windy conditions and put the Packers (7-2) 4th Down Eff. (Made/Att/Pct) 0/1/0% 0/1/0% ahead for good with 9:03 left by throwing a 6-yard TD pass to Davante Total Net Yards 260 395 Adams, who had left with an ankle injury earlier in the second half. Rodgers Total Plays 61 60 also had a 5-yard touchdown run and a 78-yard scoring strike to Marquez Yards Per Play 4.3 6.6 Valdes-Scantling, who caught four passes for a career-high 149 yards. Green Rushes/Net Yards 23/109 25/80 Bay’s victory wasn’t secure until the final minutes. Jacksonville began its last Net Passing 151 315 drive on its own 47-yard line with 2:25 left after a 30-yard punt by JK Scott Pass Attempts/Completions 35/18 34/24 that followed a third-and-1 stop of Aaron Jones. The Jaguars got as far as Had Intercepted 1 1 Green Bay’s 36, but back-to-back sacks by Rashan Gary and Preston Smith Sacked/Yards Lost 3/18 1/10 pushed them back to their own side of the field before rookie Jake Luton Punts/Average 6/45.8 5/43.0 threw incomplete on fourth-and-26 with 1:01 remaining. Luton, who had Penalties/Yards 7/86 4/35 thrown for 304 yards in his first career start last week, was 18 of 35 for 169 Fumbles/Lost 0/0 2/1 yards Sunday with one touchdown and one interception. Rodgers was 24 of Possession Time 28:19 31:41 34 for 325 yards. Keelan Cole scored on a franchise-record 91-yard punt return and a 12-yard reception for Jacksonville (1-8), which lost its eighth straight. Jacksonville’s James Robinson rushed for 109 yards on 23 carries.
2020 GREEN BAY PACKERS 79 GAME SUMMARIES Green Bay Packers ...... 7 21 0 3 0 — 31 Indianapolis Colts ...... 7 7 11 6 3 — 34 Indianapolis Colts Starters Green Bay Packers Starters OFFENSE DEFENSE OFFENSE DEFENSE LT 74 A. Castonzo DE 50 J. Houston WR 17 D. Adams DE 94 D. Lowry LG 56 Q. Nelson DT 99 D. Buckner TE 89 M. Lewis NT 97 K. Clark C 78 R. Kelly NT 90 G. Stewart LT 69 D. Bakhtiari OLB 91 P. Smith RG 64 M. Glowinski DE 94 T. Lewis LG 74 E. Jenkins ILB 58 C. Kirksey RT 62 L. Clark WLB 53 D. Leonard C 63 C. Linsley ILB 54 K. Martin TE 81 M. Alie-Cox MLB 54 A. Walker RG 62 L. Patrick OLB 55 Z. Smith WR 11 M. Pittman Jr. FS 32 J. Blackmon RT 77 B. Turner CB 23 J. Alexander WR 13 T. Hilton SS 37 K. Willis WR 83 M. Valdes-Scantling CB 20 K. King WR 14 Z. Pascal CB 23 K. Moore II WR 19 E. St. Brown CB 39 C. Sullivan QB 17 P. Rivers CB 27 X. Rhodes QB 12 A. Rodgers S 31 A. Amos RB 21 N. Hines CB 26 R. Ya-Sin RB 33 A. Jones S 26 D. Savage
OFFICIALS: Referee: Shawn Hochuli (83), Umpire: Ramon George (128), Down Judge: Sarah Thomas (53), Line Judge: Rusty Baynes (59), Field Judge: Tom Hill (97), Side Judge: Chad Hill (125), Back Judge: Rich Martinez (39), Replay Official: John McGrath, Replay Assistant: Chad Adams
Scoring Drives TEAM QTR TIME SCORING PLAY GB IND Packers 1 08:21 R.Tonyan 25 yd. pass from A.Rodgers (M.Crosby kick) (7-51, 4:06) 7 0 Colts 1 05:45 M.Pittman 45 yd. pass from P.Rivers (R.Blankenship kick) (5-75, 2:36) 7 7 Packers 2 09:55 A.Jones 2 yd. run (M.Crosby kick) (6-60, 4:14) 14 7 Packers 2 07:48 D.Adams 5 yd. pass from A.Rodgers (M.Crosby kick) (4-29, 1:53) 21 7 Colts 2 01:52 T.Burton 17 yd. pass from P.Rivers (R.Blankenship kick) (12-75, 5:56) 21 14 Packers 2 00:16 J.Williams 4 yd. pass from A.Rodgers (M.Crosby kick) (6-75, 1:36) 28 14 Colts 3 07:43 R.Blankenship 37 yd. Field Goal (14-56, 7:17) 28 17 Colts 3 01:59 J.Doyle 6 yd. pass from P.Rivers (N.Hines run) (10-55, 3:57) 28 25 Colts 4 11:12 R.Blankenship 32 yd. Field Goal (8-50, 3:56) 28 28 Colts 4 08:56 R.Blankenship 43 yd. Field Goal (4-3, 2:06) 28 31 Packers 4 00:03 M.Crosby 26 yd. Field Goal (10-86, 1:22) 31 31 Colts OT 07:10 R.Blankenship 39 yd. Field Goal (4-8, 2:02) 31 34 Green Bay Packers Indianapolis Colts PASSING ATT CP YDS SK/YD TD LG INT RTG PASSING ATT CP YDS SK/YD TD LG INT RTG Aaron Rodgers 38 27 311 1/10 3 47 1 110.7 Philip Rivers 36 24 288 1/8 3 45 1 107.2 TOTAL 38 27 311 1/10 3 47 1 110.7 TOTAL 36 24 288 1/8 3 45 1 107.2
RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD Aaron Jones 10 41 4.1 15 1 Jonathan Taylor 22 90 4.1 18 0 Aaron Rodgers 3 13 4.3 9 0 Jordan Wilkins 4 21 5.3 8 0 Jamaal Williams 5 12 2.4 4 0 DeMichael Harris 2 19 9.5 19 0 TOTAL 18 66 3.7 15 1 Jacoby Brissett 2 9 4.5 5 0 Nyheim Hines 6 2 0.3 4 0 Philip Rivers 1 -1 -1.0 -1 0 TOTAL 37 140 3.8 19 0
RECEIVING NO YDS AVG LG TD RECEIVING NO YDS AVG LG TD Davante Adams 7 106 15.1 33 1 Jonathan Taylor 4 24 6.0 9 0 Robert Tonyan 5 44 8.8 25t 1 Michael Pittman Jr. 3 66 22.0 45t 1 Aaron Jones 4 30 7.5 14 0 Zach Pascal 3 54 18.0 20 0 Marquez Valdes-Scantling 3 55 18.3 47 0 T.Y. Hilton 3 36 12.0 23 0 Jace Sternberger 3 23 7.7 12 0 Nyheim Hines 3 31 10.3 13 0 Allen Lazard 2 18 9.0 10 0 Trey Burton 2 25 12.5 17t 1 Equanimeous St. Brown 1 23 23.0 23 0 Mo Alie-Cox 2 16 8.0 8 0 Marcedes Lewis 1 8 8.0 8 0 Jordan Wilkins 1 15 15.0 15 0 Jamaal Williams 1 4 4.0 4t 1 Marcus Johnson 1 14 14.0 14 0 TOTAL 27 311 11.5 47 3 Jack Doyle 1 6 6.0 6t 1 DeMichael Harris 1 1 1.0 1 0 TOTAL 24 288 12.0 45T 3
TOP DEFENSE TOT SOLO AST SCK YDS INT TOP DEFENSE TOT SOLO AST SCK YDS INT Christian Kirksey 11 6 5 0.0 0.0 1 Kenny Moore II 10 10 0 0.0 0.0 0 Raven Greene 8 7 1 0.0 0.0 0 Darius Leonard 6 4 2 0.0 0.0 0 Adrian Amos 7 4 3 0.0 0.0 0 Julian Blackmon 5 5 0 0.0 0.0 0
FIELD GOALS FGM/FGA PERCENT RESULTS FIELD GOALS FGM/FGA PERCENT RESULTS Mason Crosby 1-1 100.0 (26) Rodrigo Blankenship 4-5 80.0 50CR (37, 32, 43, 39) TOTAL 1-1 100.0 TOTAL 4-5 80.0
INDIANAPOLIS (AP) — After allowing 28 first-half points, the Colts held Team Statistics Packers Colts Green Bay to three second-half points, forced a key fumble in overtime and First Downs 21 23 set up K Rodrigo Blankship’s decisive 39-yard field goal for a 34-31 win. The 3rd Down Eff. (Made/Att/Pct) 4/9/44% 6/16/38% Colts certainly lived up to their No. 1 defensive ranking over the final 33 4th Down Eff. (Made/Att/Pct) 0/1/0% 2/2/100% minutes, forcing three fumbles and an interception, holding RB Aaron Jones Total Net Yards 367 420 to 41 yards rushing on 10 carries and limiting Green Bay (7-3) to 18 Total Plays 57 74 offensive snaps over the final two-plus quarters. Yet it almost still wasn’t Yards Per Play 6.4 5.7 enough. Five Colts holding penalties allowed QB Aaron Rodgers to get one Rushes/Net Yards 18/66 37/140 more shot in regulation, starting at the 6-yard line with 85 seconds left. On Net Passing 301 280 third-and-10 he hit Marquez Valdes-Scantling for 47 yards before Mason Pass Attempts/Completions 38/27 36/24 Crosby hit a 26-yard field goal to tie the score with 3 seconds left. But after Had Intercepted 1 1 the Packers won the coin toss and took the ball, rookie S Julian Blackmon Sacked/Yards Lost 1/10 1/8 split two blockers to strip the ball from Valdes Scantling. DT DeForest Punts/Average 3/39.0 2/35.5 Buckner recovered and Blankenship won it moments later. Penalties/Yards 7/45 8/116 Fumbles/Lost 3/3 1/1 Possession Time 27:49 35:01
2020 GREEN BAY PACKERS 80 GAME SUMMARIES National Football League Game Summary NFL Copyright © 2020 by The National Football League. All rights reserved. This summary and play-by-play is for the express purpose of assisting media in their coverage of the game; any other use of this material is prohibited without the written permission of the National Football League.
Date: Sunday, 11/22/2020 Green Bay Packers at Indianapolis Colts Start Time: 4:25 PM EST at Lucas Oil Stadium, Indianapolis, Ind. Game Day Weather Game Weather: Cloudy, 38 degr. Wind NNW at 10 mph Temp: 38° F (3.3° C) Humidity: 91%, Wind: NNW 10 mph Played Retractable Roof - Closed on Turf: Artifici Outdoor Weather: Cloudy, 38 degr. Wind NNW at 10 mph, Wind Chill: 31
Officials Referee: Hochuli, Shawn (83) Umpire: George, Ramon (128) Down Judge: Thomas, Sarah (53) Line Judge: Baynes, Rusty (59) Field Judge: Hill, Tom (97) Side Judge: Hill, Chad (125) Back Judge: Martinez, Rich (39) Replay Official: McGrath, John (0)
Lineups
Green Bay Packers Indianapolis Colts Offense Defense Offense Defense WR 17 D.Adams DE 94 D.Lowry WR 13 T.Hilton DE 50 J.Houston LT 69 D.Bakhtiari NT 97 K.Clark LT 74 A.Castonzo DT 99 D.Buckner LG 74 E.Jenkins OLB 91 P.Smith LG 56 Q.Nelson NT 90 G.Stewart C 63 C.Linsley ILB 58 C.Kirksey C 78 R.Kelly DE 94 T.Lewis RG 62 L.Patrick ILB 54 K.Martin RG 64 M.Glowinski WLB 53 D.Leonard RT 77 B.Turner OLB 55 Z.Smith RT 62 L.Clark MLB 54 A.Walker TE 89 M.Lewis CB 39 C.Sullivan TE 81 M.Alie-Cox CB 23 K.Moore WR 83 M.Valdes-Scantling CB 23 J.Alexander WR 14 Z.Pascal CB 26 R.Ya-Sin WR 19 E.St. Brown CB 20 K.King WR 11 M.Pittman FS 32 J.Blackmon QB 12 A.Rodgers S 31 A.Amos QB 17 P.Rivers SS 37 K.Willis RB 33 A.Jones S 26 D.Savage RB 21 N.Hines CB 27 X.Rhodes
Substitutions Substitutions K 2 M.Crosby, P 6 J.Scott, WR 13 A.Lazard, S 24 R.Greene, S 25 W.Redmond, K 3 R.Blankenship, QB 7 J.Brissett, P 8 R.Sanchez, WR 12 D.Harris, RB 20 RB 30 J.Williams, S 36 V.Scott, CB 37 J.Jackson, LB 42 O.Burks, LS 43 J.Wilkins, RB 28 J.Taylor, S 30 G.Odum, S 31 T.Wilson, CB 35 T.Smith, CB 38 H.Bradley, LB 44 T.Summers, LB 52 R.Gary, LB 56 R.Ramsey, LB 57 J.Burgess, T.Carrie, LB 44 Z.Franklin, LB 45 E.Speed, LS 46 L.Rhodes, DE 55 C.Marsh, DE T 71 R.Wagner, T 73 Y.Nijman, G 76 J.Runyan, WR 82 D.Shepherd, TE 85 57 K.Turay, LB 58 B.Okereke, LB 59 J.Glasgow, G 63 D.Pinter, C 68 J.Hunt, T R.Tonyan, WR 86 M.Taylor, TE 87 J.Sternberger, DL 93 B.Winn, DL 95 75 C.Green, DT 76 T.Stallworth, TE 80 T.Burton, WR 83 M.Johnson, TE 84 T.Lancaster, DL 96 K.Keke J.Doyle, DT 93 R.Windsor, DE 97 A.Muhammad
Did Not Play Did Not Play QB 8 T.Boyle, RB 38 M.Weber
Not Active Not Active P 9 D.Kaser, QB 10 J.Love, CB 29 K.Hollman, RB 32 T.Ervin, LB 53 J.Garvin, DL QB 9 J.Eason, CB 34 I.Rodgers, LB 49 M.Adams, DE 52 B.Banogu, T/G 72 90 M.Adams B.Smith, WR 85 D.Patmon, TE 86 N.Togiai Field Goals (made ( ) & missed)
M.Crosby (26) R.Blankenship 50CR (37) (32) (43) (39)
1 2 3 4 OT Total VISITOR: Green Bay Packers 7 21 0 3 0 31 HOME: Indianapolis Colts 7 7 11 6 3 34 Scoring Plays Team Qtr Time Play Description (Extra Point) (Drive Info) Visitor Home Packers 1 8:21 R.Tonyan 25 yd. pass from A.Rodgers (M.Crosby kick) (7-51, 4:06) 7 0 Colts 1 5:45 M.Pittman 45 yd. pass from P.Rivers (R.Blankenship kick) (5-75, 2:36) 7 7 Packers 2 9:55 A.Jones 2 yd. run (M.Crosby kick) (6-60, 4:14) 14 7 Packers 2 7:48 D.Adams 5 yd. pass from A.Rodgers (M.Crosby kick) (4-29, 1:53) 21 7 Colts 2 1:52 T.Burton 17 yd. pass from P.Rivers (R.Blankenship kick) (12-75, 5:56) 21 14 Packers 2 0:16 J.Williams 4 yd. pass from A.Rodgers (M.Crosby kick) (6-75, 1:36) 28 14 Colts 3 7:43 R.Blankenship 37 yd. Field Goal (14-56, 7:17) 28 17 Colts 3 1:59 J.Doyle 6 yd. pass from P.Rivers (N.Hines run) (10-55, 3:57) 28 25 Colts 4 11:12 R.Blankenship 32 yd. Field Goal (8-50, 3:56) 28 28
2020 GREEN BAY PACKERS 81 GAMEBOOK National Football League Game Summary NFL Copyright © 2020 by The National Football League. All rights reserved. This summary and play-by-play is for the express purpose of assisting media in their coverage of the game; any other use of this material is prohibited without the written permission of the National Football League.
Colts 4 8:56 R.Blankenship 43 yd. Field Goal (4-3, 2:06) 28 31 Packers 4 0:03 M.Crosby 26 yd. Field Goal (10-86, 1:22) 31 31 Colts 5 7:10 R.Blankenship 39 yd. Field Goal (4-8, 2:02) 31 34 Paid Attendance: 12,495 Time: 3:27
2020 GREEN BAY PACKERS 82 GAMEBOOK Green Bay Packers vs Indianapolis Colts 11/22/2020 at Lucas Oil Stadium Final Individual Statistics Green Bay Packers Indianapolis Colts RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD A.Jones 10 41 4.1 15 1 J.Taylor 22 90 4.1 18 0 A.Rodgers 3 13 4.3 9 0 J.Wilkins 4 21 5.3 8 0 J.Williams 5 12 2.4 4 0 D.Harris 2 19 9.5 19 0 J.Brissett 2 9 4.5 5 0 N.Hines 6 2 0.3 4 0 P.Rivers 1 -1 -1.0 -1 0 Total 18 66 3.7 15 1 Total 37 140 3.8 19 0
PASSING ATT CMP YDS SK/YD LGTD IN RT PASSING ATT CMP YDS SK/YD LGTD IN RT A.Rodgers 38 27 311 1/10 3 47 1 110.7 P.Rivers 36 24 288 1/8 3 45 1 107.2 Total 38 27 311 1/10 3 47 1 110.7 Total 36 24 288 1/8 3 45 1 107.2
PASS RECEIVING TAR REC YDS AVG LG TD PASS RECEIVING TAR REC YDS AVG LG TD D.Adams 8 7 106 15.1 33 1 J.Taylor 4 4 24 6.0 9 0 R.Tonyan 5 5 44 8.8 25 1 M.Pittman 3 3 66 22.0 45 1 A.Jones 4 4 30 7.5 14 0 Z.Pascal 3 3 54 18.0 20 0 M.Valdes-Scantling 6 3 55 18.3 47 0 T.Hilton 6 3 36 12.0 23 0 J.Sternberger 3 3 23 7.7 12 0 N.Hines 4 3 31 10.3 13 0 A.Lazard 4 2 18 9.0 10 0 T.Burton 5 2 25 12.5 17 1 E.St. Brown 1 1 23 23.0 23 0 M.Alie-Cox 2 2 16 8.0 8 0 M.Lewis 1 1 8 8.0 8 0 J.Wilkins 1 1 15 15.0 15 0 J.Williams 2 1 4 4.0 4 1 M.Johnson 3 1 14 14.0 14 0 J.Doyle 2 1 6 6.0 6 1 D.Harris 1 1 1 1.0 1 0 Total 34 27 311 11.5 47 3 Total 34 24 288 12.0 45 3
INTERCEPTIONS NO YDS AVG LG TD INTERCEPTIONS NO YDS AVG LG TD C.Kirksey 1 8 8.0 8 0 R.Ya-Sin 1 0 0.0 0 0 Total 1 8 8.0 8 0 Total 1 0 0.0 0 0
PUNTING NO YDS AVG NET TB IN20 LG PUNTING NO YDS AVG NET TB IN20 LG J.Scott 3 117 39.0 36.0 0 0 40 R.Sanchez 2 71 35.5 35.5 0 2 38 Total 3 117 39.0 36.0 0 0 40 Total 2 71 35.5 35.5 0 2 38
PUNT RETURNS NO YDS AVG FC LG TD PUNT RETURNS NO YDS AVG FC LG TD [DOWNED] 1 0 0.0 0 0 0 N.Hines 2 9 4.5 0 5 0 [OUT OF BOUNDS] 1 0 0.0 0 0 0 [DOWNED] 1 0 0.0 0 0 0 Total 0 0 0.0 0 0 0 Total 2 9 4.5 0 5 0
KICKOFF RETURNS NO YDS AVG FC LG TD KICKOFF RETURNS NO YDS AVG FC LG TD D.Shepherd 7 138 19.7 0 30 0 T.Smith 3 73 24.3 0 33 0 [TOUCHBACK] 1 0 0.0 0 0 0 [TOUCHBACK] 3 0 0.0 0 0 0 Total 7 138 19.7 0 30 0 Total 3 73 24.3 0 33 0
Green Bay Packers FUMBLES FUM LOST OWN-REC YDSTD FORCED OPP-REC YDS TD OUT-BDS D.Shepherd 1 1 0 0 0 0 0 0 0 0 M.Valdes-Scantling 1 1 0 0 0 0 0 0 0 0 A.Rodgers 1 1 0 -1 0 0 0 0 0 0 R.Greene 0 0 0 0 0 1 0 0 0 0 D.Savage 0 0 0 0 0 0 1 0 0 0 Total 3 3 0 -1 0 1 1 0 0 0
Indianapolis Colts FUMBLES FUM LOST OWN-REC YDSTD FORCED OPP-REC YDS TD OUT-BDS M.Alie-Cox 1 1 0 0 0 0 0 0 0 0 J.Blackmon 0 0 0 0 0 1 0 0 0 0 C.Marsh 0 0 0 0 0 1 0 0 0 0
2020 GREEN BAY PACKERS 83 GAMEBOOK Green Bay Packers vs Indianapolis Colts 11/22/2020 at Lucas Oil Stadium Final Individual Statistics D.Buckner 0 0 0 0 0 0 1 0 0 0 D.Leonard 0 0 0 0 0 0 1 0 0 0 T.Wilson 0 0 0 0 0 0 1 0 0 0 Total 1 1 0 0 0 2 3 0 0 0
2020 GREEN BAY PACKERS 84 GAMEBOOK Green Bay Packers vs Indianapolis Colts 11/22/2020 at Lucas Oil Stadium Final Team Statistics Visitor Home Packers Colts TOTAL FIRST DOWNS 21 23 By Rushing 7 10 By Passing 13 12 By Penalty 1 1 THIRD DOWN EFFICIENCY 4-9-44% 6-16-38% FOURTH DOWN EFFICIENCY 0-1-0% 2-2-100% TOTAL NET YARDS 367 420 Total Offensive Plays (inc. times thrown passing) 57 74 Average gain per offensive play 6.4 5.7 NET YARDS RUSHING 66 140 Total Rushing Plays 18 37 Average gain per rushing play 3.7 3.8 Tackles for a loss-number and yards 0-0 3-6 NET YARDS PASSING 301 280 Times thrown - yards lost attempting to pass 1-10 1-8 Gross yards passing 311 288 PASS ATTEMPTS-COMPLETIONS-HAD INTERCEPTED 38-27-1 36-24-1 Avg gain per pass play (inc.# thrown passing) 7.7 7.6 KICKOFFS Number-In End Zone-Touchbacks 6-5-3 8-2-1 PUNTS Number and Average 3-39.0 2-35.5 Had Blocked 0 0 FGs - PATs Had Blocked 0-0 0-0 Net Punting Average 36.0 35.5 TOTAL RETURN YARDAGE (Not Including Kickoffs) 8 9 No. and Yards Punt Returns 0-0 2-9 No. and Yards Kickoff Returns 7-138 3-73 No. and Yards Interception Returns 1-8 1-0 PENALTIES Number and Yards 7-45 8-116 FUMBLES Number and Lost 3-3 1-1 TOUCHDOWNS 4 3 Rushing 1 0 Passing 3 3 EXTRA POINTS Made-Attempts 4-4 3-3 Kicking Made-Attempts 4-4 2-2 Rushing Made-Attempts 0-0 1-1 FIELD GOALS Made-Attempts 1-1 4-5 RED ZONE EFFICIENCY 3-4-75% 2-4-50% GOAL TO GO EFFICIENCY 3-3-100% 1-2-50% SAFETIES 0 0 FINAL SCORE 31 34 TIME OF POSSESSION 27:49 35:01
2020 GREEN BAY PACKERS 85 GAMEBOOK Green Bay Packers vs Indianapolis Colts 11/22/2020 at Lucas Oil Stadium Ball Possession And Drive Chart Green Bay Packers
# Time Time Time How Ball Drive # Yds Yds Net 1st Last How Given Recd Lost Poss Obtained Began Play Gain Pen Yds Down Scrm Up
1 15:00 13:43 1:17 Kickoff GB 21 3 40 0 40 1 IND 38 Fumble 2 12:27 8:21 4:06 Fumble GB 49 7 51 0 51 3 IND 25 Touchdown 3 5:45 3:57 1:48 Kickoff GB 34 3 -9 0 -9 0 GB 25 Punt 4 1:10 0:03 1:07 Punt GB 10 2 15 -10 5 1 GB 15 Interception
5 14:09 9:55 4:14 Missed FG GB 40 6 55 5 60 4 * IND 2 Touchdown 6 9:41 7:48 1:53 Interception IND 29 4 29 0 29 3 * IND 5 Touchdown 7 1:52 0:16 1:36 Kickoff GB 25 6 24 51 75 3 * IND 4 Touchdown
8 7:43 5:56 1:47 Kickoff GB 14 3 6 0 6 0 GB 20 Punt 9 1:59 0:08 1:51 Kickoff GB 22 3 9 -5 4 0 GB 26 Punt
10 11:12 11:02 0:10 Kickoff 0 0 0 0 0 Fumble 11 8:56 3:06 5:50 Kickoff GB 23 9 53 -10 43 3 IND 34 Downs 12 1:25 0:03 1:22 Punt GB 6 10 86 0 86 3 * IND 8 Field Goal
13 10:00 9:12 0:48 Kickoff GB 22 2 7 0 7 0 GB 30 Fumble
(337) Average GB 28
Indianapolis Colts
# Time Time Time How Ball Drive # Yds Yds Net 1st Last How Given Recd Lost Poss Obtained Began Play Gain Pen Yds Down Scrm Up
1 13:43 12:27 1:16 Fumble IND 39 3 22 -10 12 0 IND 43 Fumble 2 8:21 5:45 2:36 Kickoff IND 25 5 75 0 75 3 GB 45 Touchdown 3 3:57 1:10 2:47 Punt IND 40 5 22 -10 12 1 GB 48 Punt
4 0:03 14:09 0:54 Interception GB 35 4 3 0 3 0 GB 32 Missed FG 5 9:55 9:41 0:14 Kickoff IND 29 1 0 0 0 0 IND 29 Interception 6 7:48 1:52 5:56 Kickoff IND 25 12 75 0 75 5 * GB 17 Touchdown 7 0:16 0:00 0:16 Kickoff IND 28 1 -1 0 -1 0 IND 28 End of Half
8 15:00 7:43 7:17 Kickoff IND 25 14 56 0 56 4 * GB 19 Field Goal 9 5:56 1:59 3:57 Punt IND 45 10 55 0 55 4 * GB 6 Touchdown
10 0:08 11:12 3:56 Punt IND 36 8 50 0 50 3 * GB 14 Field Goal 11 11:02 8:56 2:06 Fumble GB 28 4 8 -5 3 0 GB 25 Field Goal 12 3:06 1:25 1:41 Downs IND 34 8 47 -20 27 3 GB 39 Punt 13 0:03 0:00 0:03 Kickoff 0 0 0 0 0 End of Half
14 9:12 7:10 2:02 Fumble GB 29 4 8 0 8 0 GB 21 Field Goal
(534) Average IND 41
* inside opponent's 20
Time of Possession by Quarter 1st 2nd 3rd 4th OT Total Visitor Green Bay Packers 8:18 7:43 3:38 7:22 0:48 27:49 Home Indianapolis Colts 6:42 7:17 11:22 7:38 2:02 35:01
Kickoff Drive No.-Start Average Packers: 7 - GB 23 Colts: 5 - IND 26
2020 GREEN BAY PACKERS 86 GAMEBOOK Green Bay Packers vs Indianapolis Colts 11/22/2020 at Lucas Oil Stadium Final Defensive Statistics Green Bay Packers Regular Defensive Plays Special Teams Misc
TKL AST COMB SK / YDS TFL Q IN PD FF FR TKL AST FF FR BL TKL AST FF FR C.Kirksey 6 5 11 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 R.Greene 7 1 8 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 K.King 5 2 7 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A.Amos 4 3 7 0 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 K.Clark 5 1 6 1 8 1 2 0 0 0 0 0 0 0 0 0 0 0 0 0 Z.Smith 5 1 6 0 0 1 2 0 1 0 0 0 0 0 0 0 0 0 0 0 D.Savage 4 2 6 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 C.Sullivan 4 1 5 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 J.Alexander 3 2 5 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 0 P.Smith 3 1 4 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 K.Martin 3 1 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R.Gary 2 1 3 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 0 K.Keke 2 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 T.Lancaster 1 1 2 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 D.Lowry 1 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 T.Summers 0 1 1 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 B.Winn 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 O.Burks 0 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 W.Redmond 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 R.Ramsey 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 J.Jackson 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 M.Valdes-Scantling 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 Total 55 23 78 1 8 4 5 1 10 1 1 3 3 0 0 0 1 0 0 0
TKL = Tackle AST = Assist COMB = Combined QH=QB Hit IN = Interception PD = Pass Defense FF = Forced Fumble FR = Fumble Recovery
Indianapolis Colts Regular Defensive Plays Special Teams Misc TKL AST COMB SK / YDS QHTFL IN PD FF FR TKL AST FF FR BL TKL AST FF FR K.Moore 10 0 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 D.Leonard 4 2 6 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 J.Blackmon 5 0 5 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 R.Ya-Sin 3 1 4 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 K.Willis 3 1 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 T.Lewis 3 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 J.Houston 2 1 3 1 10 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 D.Buckner 2 0 2 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 A.Walker 2 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 G.Stewart 0 2 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 A.Muhammad 1 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 B.Okereke 1 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R.Windsor 1 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 X.Rhodes 1 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 G.Odum 0 0 0 0 0 0 0 0 0 0 0 2 2 0 0 0 0 0 0 0 C.Marsh 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 0 0 0 0 0 T.Wilson 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 T.Smith 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 E.Speed 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 Z.Franklin 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 J.Glasgow 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 N.Hines 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 Total 38 7 45 1 10 1 1 1 2 1 2 6 4 1 1 0 1 0 0 0
2020 GREEN BAY PACKERS 87 GAMEBOOK Green Bay Packers vs Indianapolis Colts 11/22/2020 at Lucas Oil Stadium First Half Summary PERIOD SCORES TIME OF POSSESSION Packers 7 21 = 28 Packers 16:01 Colts 7 7 = 14 Colts 13:59 Scoring Plays Team Qtr Time Play Description (Extra Point) (Drive Info) Visitor Home Packers 1 8:21 R.Tonyan 25 yd. pass from A.Rodgers (M.Crosby kick) (7-51, 4:06) 7 0 Colts 1 5:45 M.Pittman 45 yd. pass from P.Rivers (R.Blankenship kick) (5-75, 2:36) 7 7 Packers 2 9:55 A.Jones 2 yd. run (M.Crosby kick) (6-60, 4:14) 14 7 Packers 2 7:48 D.Adams 5 yd. pass from A.Rodgers (M.Crosby kick) (4-29, 1:53) 21 7 Colts 2 1:52 T.Burton 17 yd. pass from P.Rivers (R.Blankenship kick) (12-75, 5:56) 21 14 Packers 2 0:16 J.Williams 4 yd. pass from A.Rodgers (M.Crosby kick) (6-75, 1:36) 28 14
Green Bay Packers Indianapolis Colts TOTAL FIRST DOWNS 15 9 First Downs Rushing-Passing-by Penalty 6 - 8 - 1 3 - 6 - 0 THIRD DOWN EFFICIENCY 3-4-75% 3-6-50% TOTAL NET YARDS 206 196 Total Offensive Plays 31 30 NET YARDS RUSHING 56 43 NET YARDS PASSING 150 153 Gross Yards Passing 160 153 Times thrown-yards lost attempting to pass 1-10 0-0 Pass Attempts-Completions-Had Intercepted 16 - 13 - 1 17 - 12 - 1 Punts-Number and Average 1 - 39 1 - 38 Penalties-Number and Yards 1 - 10 4 - 76 Fumbles-Number and Lost 1 - 1 1 - 1 Red Zone Efficiency 3-3-100% 1-1-100% Average Drive Start GB 36 IND 36
Green Bay Packers Indianapolis Colts
RUSHING ATT YDS AVG LG TD RUSHING ATT YDS AVG LG TD A.Jones 6 31 5.2 15 1 D.Harris 1 19 19.0 19 0 A.Rodgers 3 13 4.3 9 0 J.Taylor 7 18 2.6 5 0 J.Williams 5 12 2.4 4 0 J.Wilkins 1 8 8.0 8 0 N.Hines 3 -1 -0.3 1 0 P.Rivers 1 -1 -1.0 -1 0 Total 14 56 4.0 15 1 Total 13 43 3.3 19 0
PASSING ATT CMP YDS SK/YD LGTD IN RT PASSING ATT CMP YDS SK/YD LGTD IN RT A.Rodgers 16 13 160 1/10 3 33 1 121.9 P.Rivers 17 12 153 0/0 2 45 1 113.1 Total 16 13 160 1/10 3 33 1 121.9 Total 17 12 153 0/0 2 45 1 113.1
PASS RECEIVING TAR REC YDS AVG LG TD PASS RECEIVING TAR REC YDS AVG LG TD D.Adams 4 4 63 15.8 33 1 M.Pittman 3 3 66 22.0 45 1 R.Tonyan 2 2 29 14.5 25 1 J.Taylor 3 3 15 5.0 9 0 J.Sternberger 2 2 20 10.0 12 0 Z.Pascal 2 2 34 17.0 20 0 E.St. Brown 1 1 23 23.0 23 0 T.Hilton 4 2 13 6.5 13 0 A.Lazard 1 1 8 8.0 8 0 T.Burton 2 1 17 17.0 17 1 M.Lewis 1 1 8 8.0 8 0 M.Alie-Cox 1 1 8 8.0 8 0 A.Jones 1 1 5 5.0 5 0 N.Hines 1 0 0 0.0 0 0 J.Williams 1 1 4 4.0 4 1 M.Valdes-Scantling 2 0 0 0.0 0 0 Total 15 13 160 12.3 33 3 Total 16 12 153 12.8 45 2
Green Bay Packers Regular Defensive Plays Special Teams Misc
2020 GREEN BAY PACKERS 88 GAMEBOOK Green Bay Packers vs Indianapolis Colts 11/22/2020 at Lucas Oil Stadium First Half Summary TKL AST COMB SK / YDS TFL Q IN PD FF FR TKL AST FF FR BL TKL AST FF FR Z.Smith 4 1 5 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 R.Greene 4 0 4 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 K.King 2 1 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 C.Kirksey 2 1 3 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 Total 12 3 15 0 0 1 1 1 1 1 0 0 0 0 0 0 0 0 0 0
Indianapolis Colts Regular Defensive Plays Special Teams Misc TKL AST COMB SK / YDS QHTFL IN PD FF FR TKL AST FF FR BL TKL AST FF FR K.Moore 4 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 D.Leonard 3 1 4 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 K.Willis 3 1 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 R.Ya-Sin 3 1 4 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 0 0 Total 13 3 16 0 0 0 0 1 1 0 1 0 0 0 0 0 0 0 0 0
2020 GREEN BAY PACKERS 89 GAMEBOOK Green Bay Packers vs Indianapolis Colts at Lucas Oil Stadium
Play By Play First Quarter 11/22/2020 IND wins the coin toss and elects to defer. GB elects to Receive, and IND elects to defend the north goal. R.Sanchez kicks 60 yards from IND 35 to GB 5. D.Shepherd to GB 21 for 16 yards (Z.Franklin; G.Odum). Green Bay Packers at 15:00, (1st play from scrimmage 14:55) 1-10-GB 21 (14:55) (Shotgun) A.Rodgers pass deep right to D.Adams pushed ob at IND 46 for 33 yards (R.Ya-Sin). P1 1-10-IND 46 (14:17) (Shotgun) A.Rodgers pass short right to A.Lazard pushed ob at IND 38 for 8 yards (R.Ya-Sin). 2-2-IND 38 (13:48) A.Rodgers FUMBLES (Aborted) at IND 39, RECOVERED by IND-D.Leonard at IND 39. Indianapolis Colts at 13:43 1-10-IND 39 (13:43) (Shotgun) P.Rivers pass short left to N.Hines pushed ob at GB 46 for 15 yards (K.Martin). PENALTY on IND-L.Clark, Offensive Holding, 10 yards, enforced at IND 39 - No Play. 1-20-IND 29 (13:21) (Shotgun) P.Rivers pass short middle to Z.Pascal to IND 43 for 14 yards (A.Amos). 2-6-IND 43 (12:39) (Shotgun) P.Rivers pass incomplete short middle to T.Hilton (A.Amos). 3-6-IND 43 (12:33) (Shotgun) P.Rivers pass short middle to M.Alie-Cox to GB 48 for 9 yards (R.Greene). FUMBLES (R.Greene), RECOVERED by GB- D.Savage at GB 49. Green Bay Packers at 12:27 1-10-GB 49 (12:27) (Shotgun) A.Jones left end to IND 44 for 7 yards (J.Blackmon). 2-3-IND 44 (11:46) A.Jones left end to IND 42 for 2 yards (K.Moore). 3-1-IND 42 (11:06) A.Rodgers scrambles left end ran ob at IND 38 for 4 yards (A.Muhammad). R2 1-10-IND 38 (10:29) A.Rodgers pass short right to R.Tonyan to IND 34 for 4 yards (R.Ya-Sin). 2-6-IND 34 (9:48) A.Rodgers pass short left to M.Lewis to IND 26 for 8 yards (K.Moore). P3 1-10-IND 26 (9:06) A.Jones right guard to IND 25 for 1 yard (K.Moore). 2-9-IND 25 (8:26) A.Rodgers pass deep middle to R.Tonyan for 25 yards, TOUCHDOWN. P4 M.Crosby extra point is GOOD, Center-H.Bradley, Holder-J.Scott. GB 7 IND 0, 7 plays, 51 yards, 4:06 drive, 6:39 elapsed M.Crosby kicks 65 yards from GB 35 to end zone, Touchback. Indianapolis Colts at 8:21 1-10-IND 25 (8:21) (Shotgun) N.Hines up the middle to IND 26 for 1 yard (Z.Smith). 2-9-IND 26 (7:40) (Shotgun) N.Hines right end to IND 23 for -3 yards (Z.Smith, D.Savage). 3-12-IND 23 (6:57) (Shotgun) P.Rivers pass short left to T.Hilton to IND 36 for 13 yards (C.Sullivan; K.King). P1 1-10-IND 36 (6:26) (No Huddle) D.Harris left end pushed ob at GB 45 for 19 yards (D.Savage). R2 1-10-GB 45 (5:54) (No Huddle, Shotgun) P.Rivers pass short middle to M.Pittman for 45 yards, TOUCHDOWN. P3 R.Blankenship extra point is GOOD, Center-L.Rhodes, Holder-R.Sanchez. GB 7 IND 7, 5 plays, 75 yards, 2:36 drive, 9:15 elapsed R.Sanchez kicks 61 yards from IND 35 to GB 4. D.Shepherd pushed ob at GB 34 for 30 yards (T.Wilson). Green Bay Packers at 5:45, (1st play from scrimmage 5:39) 1-10-GB 34 (5:39) (Shotgun) A.Rodgers pass incomplete deep left to M.Valdes-Scantling. 2-10-GB 34 (5:35) (Shotgun) J.Williams right end to GB 35 for 1 yard (K.Willis). 3-9-GB 35 (4:53) (Shotgun) A.Rodgers sacked at GB 25 for -10 yards (J.Houston). 4-19-GB 25 (4:06) J.Scott punts 39 yards to IND 36, Center-H.Bradley. N.Hines to IND 40 for 4 yards (W.Redmond). Indianapolis Colts at 3:57 1-10-IND 40 (3:57) (Shotgun) J.Wilkins up the middle to IND 48 for 8 yards (D.Savage, C.Kirksey). 2-2-IND 48 (3:27) (Shotgun) J.Taylor right guard to GB 47 for 5 yards (C.Kirksey, A.Amos). R4 1-10-GB 47 (3:02) (Shotgun) J.Taylor right end to GB 42 for 5 yards (C.Kirksey). PENALTY on IND-Q.Nelson, Offensive Holding, 10 yards, enforced at GB 47 - No Play. 1-20-IND 43 (2:42) (Shotgun) P.Rivers pass incomplete short left to N.Hines (R.Gary). 2-20-IND 43 (2:36) (Shotgun) P.Rivers pass short right to T.Hilton to IND 43 for no gain (Z.Smith). 3-20-IND 43 (1:58) (Shotgun) P.Rivers pass short right to J.Taylor to GB 48 for 9 yards (R.Greene, R.Gary). 4-11-GB 48 (1:18) R.Sanchez punts 38 yards to GB 10, Center-L.Rhodes, out of bounds. Green Bay Packers at 1:10 1-10-GB 10 (1:10) A.Jones left end pushed ob at GB 25 for 15 yards (J.Blackmon). R5 1-10-GB 25 (:35) A.Jones left end to GB 29 for 4 yards (X.Rhodes, C.Marsh). PENALTY on GB-D.Bakhtiari, Offensive Holding, 10 yards, enforced at GB 25 - No Play.
2020 GREEN BAY PACKERS 90 GAMEBOOK Green Bay Packers vs Indianapolis Colts at Lucas Oil Stadium 1-20-GB 15 (:09) (Shotgun) A.Rodgers pass deep right intended for M.Valdes-Scantling INTERCEPTED by R.Ya-Sin at GB 35. R.Ya-Sin to GB 35 for no gain (M.Valdes-Scantling). Indianapolis Colts at 0:03 1-10-GB 35 (:03) (Shotgun) P.Rivers pass short left to J.Taylor to GB 35 for no gain (P.Smith, K.Martin). END OF QUARTER Time First Downs Efficiencies Score Poss RPXT 3 Down 4 Down Green Bay Packers 7 8:18 2 3 0 5 1/2 0/0 Indianapolis Colts 7 6:42 2 2 0 4 1/3 0/0
2020 GREEN BAY PACKERS 91 GAMEBOOK Green Bay Packers vs Indianapolis Colts at Lucas Oil Stadium
Play By Play Second Quarter 11/22/2020 Indianapolis Colts continued. 2-10-GB 35 (15:00) (Shotgun) J.Taylor right guard to GB 32 for 3 yards (Z.Smith). 3-7-GB 32 (14:22) (Shotgun) P.Rivers pass incomplete short right [Z.Smith]. 4-7-GB 32 (14:14) R.Blankenship 50 yard field goal is No Good, Hit Crossbar, Center-L.Rhodes, Holder-R.Sanchez. Green Bay Packers at 14:09 1-10-GB 40 (14:09) A.Rodgers pass short middle to D.Adams to IND 40 for 20 yards (D.Leonard, K.Willis). P6 1-10-IND 40 (13:24) (Shotgun) A.Rodgers pass short right to A.Jones to IND 35 for 5 yards (R.Ya-Sin; D.Leonard). 2-5-IND 35 (12:41) A.Jones right tackle to IND 31 for 4 yards (J.Blackmon, G.Stewart). 3-1-IND 31 (11:57) (Shotgun) J.Williams up the middle to IND 30 for 1 yard (D.Buckner, G.Stewart). R7 1-10-IND 30 (11:08) (Shotgun) PENALTY on IND-G.Stewart, Neutral Zone Infraction, 5 yards, enforced at IND 30 - No Play. Timeout #1 by GB at 10:38. 1-5-IND 25 (10:38) (Shotgun) A.Rodgers pass short left to E.St. Brown pushed ob at IND 2 for 23 yards (K.Willis). P8 1-2-IND 2 (9:59) (Shotgun) A.Jones up the middle for 2 yards, TOUCHDOWN. R9 M.Crosby extra point is GOOD, Center-H.Bradley, Holder-J.Scott. GB 14 IND 7, 6 plays, 60 yards, 1 penalty, 4:14 drive, 5:05 elapsed M.Crosby kicks 66 yards from GB 35 to IND -1. T.Smith to IND 29 for 30 yards (T.Summers; O.Burks). Indianapolis Colts at 9:55, (1st play from scrimmage 9:49) 1-10-IND 29 (9:49) (Shotgun) P.Rivers pass short middle intended for T.Burton INTERCEPTED by C.Kirksey (B.Winn) [R.Gary] at IND 37. C.Kirksey to IND 29 for 8 yards (N.Hines). Green Bay Packers at 9:41 1-10-IND 29 (9:41) (Shotgun) A.Rodgers pass short left to J.Sternberger pushed ob at IND 21 for 8 yards (K.Moore). 2-2-IND 21 (9:11) (Shotgun) J.Williams right tackle to IND 17 for 4 yards (K.Willis). R10 1-10-IND 17 (8:27) A.Rodgers pass short right to J.Sternberger pushed ob at IND 5 for 12 yards (D.Leonard). P11 1-5-IND 5 (7:52) (Shotgun) A.Rodgers pass short left to D.Adams for 5 yards, TOUCHDOWN. P12 M.Crosby extra point is GOOD, Center-H.Bradley, Holder-J.Scott. GB 21 IND 7, 4 plays, 29 yards, 1:53 drive, 7:12 elapsed M.Crosby kicks 65 yards from GB 35 to end zone, Touchback. Indianapolis Colts at 7:48 1-10-IND 25 (7:48) (Shotgun) J.Taylor left guard to IND 29 for 4 yards (K.King). 2-6-IND 29 (7:12) P.Rivers pass short right to J.Taylor to IND 35 for 6 yards (P.Smith). P5 1-10-IND 35 (6:30) (Shotgun) J.Taylor right guard to IND 38 for 3 yards (J.Alexander). 2-7-IND 38 (5:53) (Shotgun) P.Rivers pass short right to M.Pittman to IND 43 for 5 yards (R.Greene, J.Alexander). 3-2-IND 43 (5:13) (Shotgun) J.Taylor right guard to IND 45 for 2 yards (K.Clark, P.Smith). #7 Brissett in at QB for IND. R6 1-10-IND 45 (4:32) (Shotgun) J.Taylor left tackle to IND 45 for no gain (R.Gary). #17 Rivers in at QB for IND. 2-10-IND 45 (3:53) (Shotgun) N.Hines right tackle to IND 46 for 1 yard (C.Kirksey). 3-9-IND 46 (3:13) (Shotgun) P.Rivers pass short middle to Z.Pascal pushed ob at GB 34 for 20 yards (R.Greene). P7 1-10-GB 34 (2:46) (No Huddle, Shotgun) P.Rivers pass incomplete deep right to T.Hilton. 2-10-GB 34 (2:39) (Shotgun) P.Rivers pass short middle to M.Pittman pushed ob at GB 18 for 16 yards (K.King). P8 Two-Minute Warning 1-10-GB 18 (2:00) (Shotgun) J.Taylor left end to GB 17 for 1 yard (K.Clark, Z.Smith). Timeout #2 by GB at 01:57. 2-9-GB 17 (1:57) (Shotgun) P.Rivers pass deep middle to T.Burton for 17 yards, TOUCHDOWN. P9 R.Blankenship extra point is GOOD, Center-L.Rhodes, Holder-R.Sanchez. GB 21 IND 14, 12 plays, 75 yards, 5:56 drive, 13:08 elapsed 8-R.Sanchez kicks 64 yards from IND 35 to GB 1. 82-D.Shepherd to GB 4 for 3 yards (30-G.Odum, 59-J.Glasgow). The Replay Official reviewed the touchback ruling, and the play was REVERSED. R.Sanchez kicks 65 yards from IND 35 to end zone, Touchback. Green Bay Packers at 1:52 1-10-GB 25 (1:52) (Shotgun) A.Rodgers pass short right to D.Adams ran ob at GB 30 for 5 yards (D.Leonard). 2-5-GB 30 (1:48) (Shotgun) J.Williams up the middle to GB 34 for 4 yards (J.Houston). 3-1-GB 34 (1:05) (No Huddle, Shotgun) J.Williams left guard to GB 36 for 2 yards (B.Okereke, J.Houston). R13 1-10-GB 36 (:42) (No Huddle, Shotgun) A.Rodgers pass incomplete short left.
2020 GREEN BAY PACKERS 92 GAMEBOOK Green Bay Packers vs Indianapolis Colts at Lucas Oil Stadium 2-10-GB 36 (:36) (Shotgun) A.Rodgers scrambles left end to GB 45 for 9 yards (D.Buckner). Timeout #3 by GB at 00:27. 3-1-GB 45 (:27) (Shotgun) A.Rodgers pass incomplete deep middle to M.Valdes-Scantling (R.Ya-Sin). PENALTY on IND-R.Ya-Sin, Defensive Pass Interference, 51 yards, enforced at GB 45 - No Play. X14 1-4-IND 4 (:20) (Shotgun) A.Rodgers pass short right to J.Williams for 4 yards, TOUCHDOWN. P15 M.Crosby extra point is GOOD, Center-H.Bradley, Holder-J.Scott. GB 28 IND 14, 6 plays, 75 yards, 1 penalty, 1:36 drive, 14:44 elapsed M.Crosby kicks 70 yards from GB 35 to IND -5. T.Smith to IND 28 for 33 yards (R.Ramsey). Indianapolis Colts at 0:16, (1st play from scrimmage 0:10) 1-10-IND 28 (:10) P.Rivers kneels to IND 27 for -1 yards. END OF QUARTER Time First Downs Efficiencies Score Poss RPXT 3 Down 4 Down Green Bay Packers 28 7:43 4 5 1 10 2/2 0/0 Indianapolis Colts 14 7:17 1 4 0 5 2/3 0/0
2020 GREEN BAY PACKERS 93 GAMEBOOK Green Bay Packers vs Indianapolis Colts at Lucas Oil Stadium
Play By Play Third Quarter 11/22/2020 IND elects to Receive, and GB elects to defend the South goal. M.Crosby kicks 65 yards from GB 35 to end zone, Touchback. Indianapolis Colts at 15:00 1-10-IND 25 (15:00) J.Taylor left end to IND 30 for 5 yards (D.Savage, K.King). 2-5-IND 30 (14:25) J.Taylor up the middle to IND 38 for 8 yards (C.Kirksey; A.Amos). R10 1-10-IND 38 (13:59) (Shotgun) J.Taylor up the middle to IND 42 for 4 yards (K.King). 2-6-IND 42 (13:30) J.Taylor up the middle to GB 40 for 18 yards (A.Amos). R11 1-10-GB 40 (12:57) (No Huddle, Shotgun) J.Taylor right tackle to GB 33 for 7 yards (R.Greene). 2-3-GB 33 (12:16) J.Taylor up the middle to GB 33 for no gain (A.Amos). 3-3-GB 33 (11:31) (Shotgun) J.Wilkins left tackle to GB 25 for 8 yards (C.Sullivan). #7 Brissett in at QB for IND. R12 1-10-GB 25 (11:05) (Shotgun) J.Brissett left end pushed ob at GB 20 for 5 yards (K.King). 2-5-GB 20 (10:30) (Shotgun) P.Rivers pass short left to D.Harris to GB 19 for 1 yard (K.Martin). 3-4-GB 19 (9:55) (Shotgun) P.Rivers pass short left to N.Hines to GB 10 for 9 yards (R.Greene, C.Kirksey). P13 1-10-GB 10 (9:21) (No Huddle, Shotgun) N.Hines right guard to GB 11 for -1 yards (P.Smith, C.Kirksey). 2-11-GB 11 (8:41) (Shotgun) P.Rivers sacked at GB 19 for -8 yards (K.Clark). 3-19-GB 19 (7:53) (Shotgun) P.Rivers pass incomplete deep middle to T.Hilton. 4-19-GB 19 (7:47) R.Blankenship 37 yard field goal is GOOD, Center-L.Rhodes, Holder-R.Sanchez. GB 28 IND 17, 14 plays, 56 yards, 7:17 drive, 7:17 elapsed R.Sanchez kicks 66 yards from IND 35 to GB -1. D.Shepherd to GB 14 for 15 yards (T.Smith). Green Bay Packers at 7:43, (1st play from scrimmage 7:39) 1-10-GB 14 (7:39) (Shotgun) A.Jones left guard to GB 17 for 3 yards (T.Lewis). 2-7-GB 17 (6:59) (Shotgun) A.Rodgers pass short middle to A.Jones to GB 20 for 3 yards (A.Walker). 3-4-GB 20 (6:16) (Shotgun) A.Rodgers pass incomplete deep right to M.Valdes-Scantling. 4-4-GB 20 (6:08) J.Scott punts 40 yards to IND 40, Center-H.Bradley. N.Hines to IND 45 for 5 yards (O.Burks, J.Jackson). Indianapolis Colts at 5:56 1-10-IND 45 (5:56) D.Pinter reported in as eligible. P.Rivers pass incomplete short right to M.Johnson (D.Savage). 2-10-IND 45 (5:51) (Shotgun) P.Rivers pass incomplete short middle to T.Burton (C.Sullivan). 3-10-IND 45 (5:46) (Shotgun) P.Rivers pass short right to J.Taylor to GB 46 for 9 yards (R.Greene). 4-1-GB 46 (5:03) J.Brissett left guard to GB 42 for 4 yards (C.Kirksey). R14 1-10-GB 42 (4:16) (Shotgun) P.Rivers pass incomplete deep middle to M.Johnson (T.Lancaster). 2-10-GB 42 (4:09) (Shotgun) P.Rivers pass short middle to N.Hines to GB 33 for 9 yards (C.Kirksey, R.Greene). 3-1-GB 33 (3:35) (No Huddle, Shotgun) N.Hines right guard to GB 29 for 4 yards (K.Clark). R15 1-10-GB 29 (2:56) (Shotgun) P.Rivers pass deep left to T.Hilton pushed ob at GB 6 for 23 yards (C.Sullivan). P16 1-6-GB 6 (2:33) (No Huddle, Shotgun) N.Hines up the middle to GB 6 for no gain (T.Lancaster). GB-T.Lancaster was injured during the play. 2-6-GB 6 (2:07) (Shotgun) P.Rivers pass short middle to N.Hines for 6 yards, TOUCHDOWN NULLIFIED by Penalty [B.Winn]. Penalty on IND-Q.Nelson, Offensive Holding, offsetting, enforced at GB 6 - No Play. Penalty on GB-Z.Smith, Defensive Offside, offsetting. 2-6-GB 6 (2:03) (Shotgun) P.Rivers pass short middle to J.Doyle for 6 yards, TOUCHDOWN. P17 TWO-POINT CONVERSION ATTEMPT. N.Hines rushes left end. ATTEMPT SUCCEEDS. PENALTY on GB-Z.Smith, Defensive Offside, 5 yards, enforced between downs. GB 28 IND 25, 10 plays, 55 yards, 3:57 drive, 13:01 elapsed R.Sanchez kicks 58 yards from IND 40 to GB 2. D.Shepherd to GB 22 for 20 yards (G.Odum, J.Glasgow). Green Bay Packers at 1:59, (1st play from scrimmage 1:54) 1-10-GB 22 (1:54) A.Rodgers pass short left to J.Sternberger to GB 25 for 3 yards (K.Moore). 2-7-GB 25 (1:08) A.Jones left end to GB 31 for 6 yards (R.Windsor). 3-1-GB 31 (:24) (Shotgun) A.Rodgers pass incomplete short middle to D.Adams (D.Leonard). 4-1-GB 31 (:21) (Punt formation) PENALTY on GB-R.Ramsey, False Start, 5 yards, enforced at GB 31 - No Play. 4-6-GB 26 (:21) J.Scott punts 38 yards to IND 36, Center-H.Bradley, downed by GB-T.Summers. Indianapolis Colts at 0:08 1-10-IND 36 (:08) (Shotgun) J.Taylor right end to 50 for 14 yards (K.King). R18
2020 GREEN BAY PACKERS 94 GAMEBOOK Green Bay Packers vs Indianapolis Colts at Lucas Oil Stadium END OF QUARTER Time First Downs Efficiencies Score Poss RPXT 3 Down 4 Down Green Bay Packers 28 3:38 0 0 0 0 0/2 0/0 Indianapolis Colts 25 11:22 6 3 0 9 3/5 1/1
2020 GREEN BAY PACKERS 95 GAMEBOOK Green Bay Packers vs Indianapolis Colts at Lucas Oil Stadium
Play By Play Fourth Quarter 11/22/2020 Indianapolis Colts continued. 1-10-50 (15:00) (Shotgun) P.Rivers pass deep right to Z.Pascal to GB 30 for 20 yards (K.Martin, J.Alexander) [K.Clark]. P19 1-10-GB 30 (14:19) P.Rivers pass short right to M.Alie-Cox to GB 22 for 8 yards (C.Kirksey). 2-2-GB 22 (13:48) (No Huddle, Shotgun) J.Taylor right guard to GB 20 for 2 yards (K.Keke, K.Clark). R20 1-10-GB 20 (13:08) (Shotgun) D.Harris left end to GB 20 for no gain (C.Sullivan, T.Lancaster). 2-10-GB 20 (12:28) (Shotgun) P.Rivers pass short middle to T.Burton to GB 12 for 8 yards (C.Sullivan). GB-C.Sullivan was injured during the play. 3-2-GB 12 (12:02) (Shotgun) J.Taylor up the middle to GB 14 for -2 yards (A.Amos). #7 Brissett in at QB for IND. 4-4-GB 14 (11:17) R.Blankenship 32 yard field goal is GOOD, Center-L.Rhodes, Holder-R.Sanchez. GB 28 IND 28, 8 plays, 50 yards, 3:56 drive, 3:48 elapsed R.Sanchez kicks 62 yards from IND 35 to GB 3. D.Shepherd to GB 25 for 22 yards (C.Marsh). FUMBLES (C.Marsh), RECOVERED by IND-T.Wilson at GB 28. Indianapolis Colts at 11:02 1-10-GB 28 (11:02) J.Taylor up the middle to GB 22 for 6 yards (A.Amos; T.Summers). 2-4-GB 22 (10:24) J.Taylor right guard to GB 20 for 2 yards (D.Lowry, D.Savage). #17 Rivers in at QB for IND. 3-2-GB 20 (9:40) J.Taylor up the middle for 20 yards, TOUCHDOWN NULLIFIED by Penalty. PENALTY on IND-Z.Pascal, Offensive Holding, 10 yards, enforced at GB 20 - No Play. #7 Brissett in at QB for IND. 3-12-GB 30 (9:34) (Shotgun) P.Rivers pass short right to Z.Pascal to GB 22 for 8 yards (C.Sullivan, K.King). PENALTY on GB-P.Smith, Defensive Offside, 5 yards, enforced at GB 30 - No Play. #17 Rivers in at QB for IND. 3-7-GB 25 (9:06) (Shotgun) P.Rivers pass incomplete short right to T.Burton (J.Alexander). 4-7-GB 25 (9:01) R.Blankenship 43 yard field goal is GOOD, Center-L.Rhodes, Holder-R.Sanchez. GB 28 IND 31, 4 plays, 3 yards, 1 penalty, 2:06 drive, 6:04 elapsed R.Sanchez kicks 63 yards from IND 35 to GB 2. D.Shepherd pushed ob at GB 23 for 21 yards (G.Odum). Green Bay Packers at 8:56, (1st play from scrimmage 8:52) 1-10-GB 23 (8:52) (Shotgun) A.Rodgers pass short right to M.Valdes-Scantling to GB 32 for 9 yards (K.Moore). 2-1-GB 32 (8:08) A.Jones right tackle to GB 33 for 1 yard (T.Lewis). R16 1-10-GB 33 (7:23) (Shotgun) A.Jones left end to GB 33 for no gain (T.Lewis). 2-10-GB 33 (6:41) (Shotgun) A.Rodgers pass short left to A.Jones to GB 47 for 14 yards (X.Rhodes). P17 1-10-GB 47 (5:54) A.Rodgers pass short left to A.Lazard ran ob at IND 43 for 10 yards. P18 1-10-IND 43 (5:14) J.Williams up the middle to IND 29 for 14 yards (D.Leonard, J.Blackmon). PENALTY on GB-M.Lewis, Offensive Holding, 10 yards, enforced at IND 43 - No Play. 1-20-GB 47 (4:45) (Shotgun) A.Rodgers pass short middle to D.Adams to IND 42 for 11 yards (D.Leonard). 2-9-IND 42 (4:01) (Shotgun) A.Rodgers pass short right to R.Tonyan to IND 41 for 1 yard (K.Moore). 3-8-IND 41 (3:17) (Shotgun) A.Rodgers pass short left to R.Tonyan ran ob at IND 34 for 7 yards. 4-1-IND 34 (3:11) A.Rodgers pass incomplete short left to J.Williams. Indianapolis Colts at 3:06 1-10-IND 34 (3:06) (Shotgun) P.Rivers pass short middle to M.Johnson to IND 48 for 14 yards (J.Alexander). P21 1-10-IND 48 (2:22) (Shotgun) J.Taylor up the middle to GB 49 for 3 yards (D.Lowry). PENALTY on GB-T.Lancaster, Defensive Offside, 5 yards, enforced at IND 48 - No Play. 1-5-GB 47 (2:17) (Shotgun) PENALTY on GB, Defensive Too Many Men on Field, 5 yards, enforced at GB 47 - No Play. X22 1-10-GB 42 (2:17) (Shotgun) J.Taylor up the middle to GB 35 for 7 yards (Z.Smith, D.Savage). PENALTY on IND-M.Pittman, Offensive Holding, 10 yards, enforced at GB 42 - No Play. 1-20-IND 48 (2:12) (Shotgun) J.Taylor right end to IND 48 for no gain (K.Martin). Penalty on IND-M.Glowinski, Offensive Holding, declined. 2-20-IND 48 (2:09) (Shotgun) J.Wilkins up the middle to IND 49 for 1 yard (R.Gary). Penalty on IND-Z.Pascal, Illegal Motion, declined. 3-19-IND 49 (2:04) (Shotgun) P.Rivers pass short right to J.Wilkins to GB 36 for 15 yards (C.Kirksey). Two-Minute Warning 4-4-GB 36 (1:58) (Shotgun) P.Rivers pass short middle to N.Hines to GB 23 for 13 yards (J.Alexander). P23 Timeout #1 by GB at 01:55. 1-10-GB 23 (1:55) J.Taylor up the middle to GB 17 for 6 yards (C.Kirksey). PENALTY on IND-M.Glowinski, Offensive Holding, 10 yards, enforced at GB 23 - No Play.
2020 GREEN BAY PACKERS 96 GAMEBOOK Green Bay Packers vs Indianapolis Colts at Lucas Oil Stadium 1-20-GB 33 (1:51) P.Rivers pass incomplete short right to J.Doyle (J.Alexander). 2-20-GB 33 (1:47) (Shotgun) J.Taylor right end to GB 24 for 9 yards (J.Alexander). PENALTY on IND-Q.Nelson, Offensive Holding, 10 yards, enforced at GB 33 - No Play. Penalty on IND-C.Green, Offensive Holding, declined. 2-30-GB 43 (1:42) (Shotgun) J.Wilkins up the middle to GB 39 for 4 yards (K.Clark). Timeout #2 by GB at 01:36. 3-26-GB 39 (1:36) (Shotgun) P.Rivers sacked at GB 46 for -7 yards (Z.Smith). FUMBLES (Z.Smith), RECOVERED by GB-C.Kirksey at GB 29. C.Kirksey for 71 yards, TOUCHDOWN. The Replay Official reviewed the fumble ruling, and the play was REVERSED. (Shotgun) P.Rivers pass incomplete middle (Z.Smith) [Z.Smith]. 4-26-GB 39 (1:33) R.Sanchez punts 33 yards to GB 6, Center-L.Rhodes, downed by IND-L.Rhodes. Green Bay Packers at 1:25 1-10-GB 6 (1:25) (Shotgun) A.Rodgers pass incomplete short middle to A.Lazard. 2-10-GB 6 (1:22) (Shotgun) A.Rodgers pass incomplete short middle to A.Lazard. 3-10-GB 6 (1:17) (Shotgun) A.Rodgers pass deep middle to M.Valdes-Scantling to IND 47 for 47 yards (J.Blackmon). P19 Timeout #3 by GB at 01:10. 1-10-IND 47 (1:10) (Shotgun) A.Rodgers pass short middle to D.Adams to IND 33 for 14 yards (K.Moore). P20 1-10-IND 33 (:58) (No Huddle, Shotgun) A.Rodgers spiked the ball to stop the clock. 2-10-IND 33 (:57) (Shotgun) A.Rodgers pass short middle to D.Adams to IND 15 for 18 yards (K.Moore). P21 1-10-IND 15 (:43) (No Huddle) A.Rodgers spiked the ball to stop the clock. 2-10-IND 15 (:42) (Shotgun) A.Rodgers pass short middle to R.Tonyan to IND 8 for 7 yards (K.Moore). 3-3-IND 8 (:12) (No Huddle, Shotgun) A.Rodgers pass incomplete short left. 4-3-IND 8 (:07) M.Crosby 26 yard field goal is GOOD, Center-H.Bradley, Holder-J.Scott. GB 31 IND 31, 10 plays, 86 yards, 1:22 drive, 14:57 elapsed M.Crosby kicks 54 yards from GB 35 to IND 11. T.Smith to IND 21 for 10 yards. END OF QUARTER Time First Downs Efficiencies Score Poss RPXT 3 Down 4 Down Green Bay Packers 31 7:22 1 5 0 6 1/3 0/1 Indianapolis Colts 31 7:38 1 3 1 5 0/4 1/1
2020 GREEN BAY PACKERS 97 GAMEBOOK Green Bay Packers vs Indianapolis Colts at Lucas Oil Stadium
Play By Play Overtime 11/22/2020 GB wins toss, elects to Receive, and IND elects to defend the South goal. R.Sanchez kicks 57 yards from IND 35 to GB 8. D.Shepherd to GB 22 for 14 yards (E.Speed, G.Odum). Green Bay Packers at 10:00, (1st play from scrimmage 9:56) 1-10-GB 22 (9:56) (Shotgun) A.Rodgers pass short right to A.Jones to GB 30 for 8 yards (A.Walker, D.Leonard). IND-A.Walker was injured during the play. 2-2-GB 30 (9:20) (Shotgun) A.Rodgers pass short left to M.Valdes-Scantling to GB 30 for no gain (J.Blackmon). FUMBLES (J.Blackmon), RECOVERED by IND-D.Buckner at GB 29. Indianapolis Colts at 9:12 1-10-GB 29 (9:12) J.Taylor up the middle to GB 29 for no gain (D.Savage). 2-10-GB 29 (8:29) J.Taylor up the middle to GB 24 for 5 yards (K.Keke). Timeout #1 by IND at 07:56. 3-5-GB 24 (7:56) J.Taylor right tackle to GB 21 for 3 yards (Z.Smith, C.Kirksey). Timeout #1 by GB at 07:15. 4-2-GB 21 (7:15) R.Blankenship 39 yard field goal is GOOD, Center-L.Rhodes, Holder-R.Sanchez. GB 31 IND 34, 4 plays, 8 yards, 2:02 drive, 2:50 elapsed END OF QUARTER Time First Downs Efficiencies Score Poss RPXT 3 Down 4 Down Green Bay Packers 31 0:48 0 0 0 0 0/0 0/0 Indianapolis Colts 34 2:02 0 0 0 0 0/1 0/0
2020 GREEN BAY PACKERS 98 GAMEBOOK Miscellaneous Statistics Report
Jacksonville Jaguars vs Green Bay Packers 11/15/2020 at Lambeau Field Ten Longest Plays for Jacksonville Jaguars Yards Qtr Play Start Play Description 21 3 1-10-JAX 44 (1:16) J.Luton pass short right to D.Chark Jr. to GB 35 for 21 yards (D.Savage). 20 1 2-4-JAX 11 (6:40) (Shotgun) J.Robinson right tackle pushed ob at JAX 31 for 20 yards (A.Amos). 18 3 2-14-JAX 21 (14:20) (Shotgun) J.Luton pass deep right to C.Conley to JAX 39 for 18 yards (K.Hollman). 17 4 2-10-GB 35 (15:00) (Shotgun) J.Luton pass short right to D.Chark Jr. pushed ob at GB 18 for 17 yards (A.Amos). 13 3 2-7-JAX 48 (4:27) (Shotgun) J.Luton pass short left to K.Cole Sr. to GB 39 for 13 yards (R.Gary). 12 3 3-6-GB 12 (10:34) (Shotgun) J.Luton pass short middle to K.Cole Sr. for 12 yards, TOUCHDOWN. 11 1 1-10-JAX 38 (13:22) (Shotgun) J.Luton pass short right to D.Chark Jr. to JAX 49 for 11 yards (K.Hollman). 11 3 1-20-GB 26 (11:49) J.Robinson left tackle to GB 15 for 11 yards (C.Sullivan). 10 2 2-2-JAX 33 (14:17) (Shotgun) J.Robinson left end pushed ob at JAX 43 for 10 yards (J.Jackson). 10 4 1-10-JAX 7 (8:57) J.Luton pass short right to C.Conley pushed ob at JAX 17 for 10 yards (D.Savage). Ten Longest Plays for Green Bay Packers Yards Qtr Play Start Play Description 78 2 1-10-GB 22 (15:00) (Shotgun) A.Rodgers pass deep right to M.Valdes-Scantling for 78 yards, TOUCHDOWN. 31 3 1-10-GB 20 (2:43) A.Rodgers pass short right to M.Valdes-Scantling to JAX 49 for 31 yards (S.Jones IV). 23 4 3-9-GB 26 (12:01) (Shotgun) A.Rodgers pass deep right to R.Tonyan to GB 49 for 23 yards (D.Thomas). 22 2 3-6-GB 23 (8:34) (Shotgun) A.Rodgers pass deep middle to M.Valdes-Scantling to GB 45 for 22 yards (S.Jones IV). 20 4 2-3-JAX 44 (10:34) A.Jones right end to JAX 24 for 20 yards (M.Jack). 18 2 2-6-JAX 26 (3:50) (Shotgun) A.Rodgers pass short left to D.Adams ran ob at JAX 8 for 18 yards (S.Jones IV). 18 4 1-10-JAX 24 (9:49) (Shotgun) A.Rodgers pass short left to M.Valdes-Scantling pushed ob at JAX 6 for 18 yards (J.Schobert). 14 3 2-6-GB 29 (9:51) (Shotgun) A.Rodgers pass short right to A.Jones pushed ob at GB 43 for 14 yards (J.Schobert). 12 2 3-7-GB 48 (7:04) (Shotgun) A.Rodgers pass short right to J.Williams pushed ob at JAX 40 for 12 yards (J.Schobert; M.Jack). 11 2 2-13-GB 24 (11:52) (Shotgun) A.Rodgers pass short right to A.Jones to GB 35 for 11 yards (J.Schobert, D.Thomas).
Touchdown Scoring Information Offense Defense Special Teams VISITOR Jacksonville Jaguars 1 0 1 HOME Green Bay Packers 3 0 0 Player Scoring Information Club Player TD Rush Rec KO TD Punt Int TD Fum Misc FG XP 2Pt 2Pt Sfty Points TD TD TD TD TD Rush Rec JAX K.Cole Sr. 001010000000 0 12 JAX C.McLaughlin 000000002200 80 GB A.Rodgers 010000000000 60 GB D.Adams 001000000000 60 GB M.Valdes-Scantling 001000000000 60 GB M.Crosby 000000001300 60
Possession Detail First Half Second Half Game Visitor Home Visitor Home Visitor Home Largest Lead 3 7 3 4 3 7 Drives Leading 2 2 0 3 2 5 Time of Possession Leading 3:50 3:52 0:00 2:56 3:50 6:48 Largest Deficit -7 -3 -4 -3 -7 -3 Drives Trailing 3 4 4 1 7 5 Time of Possession Trailing 3:04 14:50 10:37 3:37 13:41 18:27 Times Score Tied Up 0 1 1 Lead Changes 4 2 6
2020 GREEN BAY PACKERS 99 GAMEBOOK Playtime Percentage Percent of playtime per player on offense, defense and special teams Jacksonville Jaguars Green Bay Packers Offense Defense Special Teams Offense Defense Special Teams
T Shatley G 64 100% 4 13% L Patrick G 65 100% 4 13% A Norwell G 64 100% 4 13% E Jenkins G 65 100% 4 13% A Cann G 64 100% 4 13% A Rodgers QB 65 100% J Taylor T 64 100% 4 13% D Bakhtiari T 65 100% J Luton QB 64 100% B Turner T 65 100% C Robinson T 61 95% 4 13% C Linsley C 65 100% D Chark WR 56 88% M Valdes-Scantling WR 60 92% C Conley WR 55 86% 1 3% D Adams WR 53 82% J Robinson RB 53 83% A Jones RB 41 63% K Cole WR 52 81% 11 37% R Tonyan TE 40 62% T Eifert TE 40 62% J Williams RB 31 48% 10 33% J O'Shaughnessy TE 25 39% 7 23% E St. Brown WR 31 48% B Ellefson TE 19 30% 12 40% M Lewis TE 26 40% D Ogunbowale RB 10 16% 22 73% J Sternberger TE 20 31% 5 17% C Johnson WR 7 11% 16 53% M Taylor WR 8 12% 19 63% W Richardson T 3 5% 4 13% T Ervin RB 8 12% 7 23% T Godwin WR 2 3% 5 17% J Winfree WR 7 11% 10 33% C Thompson RB 1 2% C Sullivan CB 64 100% 5 17% D Thomas SS 65 100% 15 50% C Kirksey LB 64 100% 5 17% J Wilson SS 65 100% 2 7% A Amos FS 64 100% 1 3% S Jones CB 65 100% D Savage SS 61 95% 1 3% M Jack LB 65 100% J Jackson CB 60 94% 7 23% C Henderson CB 64 98% K Clark NT 57 89% J Schobert LB 63 97% Z Smith LB 53 83% 1 3% T Bryan DT 50 77% P Smith LB 52 81% 1 3% J Allen DE 46 71% 4 13% K Hollman CB 51 80% 11 37% T Herndon CB 42 65% 8 27% D Lowry DE 39 61% 8 27% D Hamilton NT 41 63% 4 13% R Greene FS 39 61% 8 27% A Gotsis DE 35 54% 8 27% R Gary LB 31 48% 6 20% K Chaisson DE 31 48% T Lancaster NT 22 34% 13 43% D Smoot DE 25 38% K Keke DE 14 22% 10 33% K Correa LB 18 28% 4 13% M Adams DE 14 22% 8 27% D Ekuale DT 13 20% 4 13% K Martin LB 13 20% 11 37% A Lynch LB 13 20% O Burks LB 5 8% 25 83% A Wingard FS 7 11% 26 87% V Scott FS 1 2% 10 33% C Claybrooks CB 6 9% 24 80% B Watson CB 25 83% R Ramsey LB 25 83% J Giles-Harris LB 22 73% T Summers LB 25 83% D Middleton FS 20 67% J Burgess LB 16 53% L Cooke P 16 53% H Black DB 16 53% T Davis TE 16 53% J Scott P 14 47% Q Williams LB 15 50% S Samuels DB 12 40% R Matiscik LS 11 37% H Bradley LS 9 30% C McLaughlin K 4 13% K Russell CB 7 23% B Bartch T 4 13% M Crosby K 4 13%
2020 GREEN BAY PACKERS 100 GAMEBOOK R Wagner G 4 13% Y Nijman T 4 13% J Runyan G 4 13%
2020 GREEN BAY PACKERS 101 GAMEBOOK UPDATED BIOGRAPHIES Startedandplayed57of62snaps,finishingwithacareer-high 196receivingyardsandtwoTDson13receptions(15.1avg.)as hejoinedHutson(Oct.18,1942)astheonlyplayersinfranchise historytoregister13-pluscatches,195-plusreceivingyardsand two-plusreceivingTDsinagame.AccountedforallofGreen Bay’sthird-downconversions,postingsevenreceptionsfor125 yards(17.9avg.)andtwoTDsonthirddown,themostreceiving yardsbyaPackeronthirddownsinceWRRobertBrooks recorded126yardsonfourthird-downcatchesatChicagoon Sept.11,1995.Matchedhiscareerhighwiththreereceptionsof 25-plusyards(atTennesseein2016),postinga45-yardTD catch,a36-yarderanda28-yarder.Finishedthedaywitha career-high102yardsafterthecatch…Vs. Minnesota (Nov. 1): Startedandplayed71of75snaps,postingacareer-highthreeTD receptions(5,1,7yards).TwoofhisTDgrabscameinthefirst half,justthesecondtimeinhiscareer(2016atPhiladelphia)that heregisteredtwoTDcatchesinafirsthalf.BecamethefirstNFL playertohavefiveTDcatchesagainsttheVikingsinaseasonand joinedSharpe(fivevs.TampaBayin1993)andHutson(fivevs. Clevelandin1942,sixvs.Clevelandin1938)astheonlyplayers inteamhistorytohavefive-plusreceivingTDsagainstasingle opponentinaseason.Finishedwithateam-highsevenreceptions for53yards(7.6avg.).HisthreeTDcatchesgavehim51forhis careerashemovedpastWRsJamesLofton(49)andMaxMcGee (50)fortheNo.7spotinteamhistory.Broughthiscareer receptiontotalto474,movingpastCobb(470)fortheNo.6spot infranchiseannals…At San Francisco (Nov. 5):Startedand played50of66snaps,haulingin10passesfor173yards(17.3 avg.)andaTD.Postedthreereceptionsof30-plusyards(season- long49-yarder,36-yardTD,34-yarder)inagameforjustthe secondtimeinhiscareer(Week10atTennesseein2016). 2020 SEASON: Hasstartedalleightgameshehasplayedinand CappedoffGreenBay’sopeningdrivewitha36-yardTDcatch haspostedateam-high68receptionsfor847yards(12.5avg.) overCBEmmanuelMoseley.OnGreenBay’sfirstpossessionof and10TDs…IsthefirstplayerinNFLhistorytopost65-plus thesecondhalf,beatCBJasonVerrettdownthesidelinefora receptions,800-plusreceivingyardsand10-plusreceivingTDsin season-long49-yardcatchtotheSanFrancisco28.Becamejust hisfirsteightgames…RanksNo.1intheleagueinreceptionsper thesecondplayerinNFLhistorytohavethreegamesinaseason game(8.5)andreceivingyardspergame(105.9)andistiedfor with10-plusreceptions,150-plusreceivingyardsandareceiving No.2inreceivingTDs…RanksNo.6intheleagueinreceptions TD(CalvinJohnson,2012)…Vs. Jacksonville (Nov. 15):Started andNo.8inreceivingyardsdespitemissingtwogamesdueto andplayed53of65snaps,missingsometimeinthesecondhalf injury…RanksNo.2intheNFLwiththreegameswithtwo-plus duetoanankleinjurysustainedinthethirdquarter.Ledtheteam TDreceptions…Haspostedtwogamesontheseasonwith13- witheightreceptionsfor66yards(8.3avg.),highlightedbyhis pluscatches,150-plusreceivingyardsandtwo-plusreceiving leaping6-yardTDcatchwithjustovernineminutesremainingin TDs(Weeks1and7),tiedforthemostinNFLhistory(Anquan thefourthquarterthatprovedtobethegame-winner.Itmarked Boldin,2007;DwayneBowe,2010)…Isthefirstplayerinteam hisfourthstraightgamewithseven-plusreceptionsanda historytohavethreegameswith10-pluscatchesand150-plus receivingTDashebecameonlythesecondplayerinfranchise receivingyardsinaseason…RanksNo.1intheNFLinthird- history(WRAntonioFreeman,four-gamestreakin1998-99)to downreceivingyards(289),No.4inthird-downcatches(20)and accomplishthatfeat.Withhiseightcatches,broughthiscareer tiedforNo.2inthird-downTDreceptions(three)…Hasseven totalto492ashemovedpastHutson(488)forNo.5inteam receptionsof30-plusyardsontheseason,tiedforNo.5inthe history.AlsomovedintoatiewithWRGregJennings(53)forthe league…At Minnesota (Sept. 13):Startedandplayed70of78 No.6spotinteamhistoryinTDcatches…At Indianapolis (Nov. snaps,matchingDonHutson’ssingle-gamefranchiserecord 22): Startedandplayed57of60snaps,leadingtheteamwith106 (Nov.22,1942)forreceptionswith14catchesfor156yards yardsandaTDonsevenreceptions(15.1avg.).Postedseven- (11.1avg.)andtwoTDs.BecamejustthefourthNFLplayerinthe plusreceptionsandareceivingTDforthefifthconsecutivegame, last10seasons(WillFuller,AntonioBrown,WesWelker)topost matchingthelongeststreakinNFLhistoryheldbythreeother 14-plusreceptionsfor150-plusyardsandtwo-plusTDsina players(CrisCarter,1999;T.J.Houshmandzadeh,2007;Adam game.Hadninecatchesfor103yards(11.4avg.)andaTDinthe Thielen,2018).Registereda33-yardreceptiononGreenBay’s firsthalfalone,matchinghiscareerhighforreceptionsinahalf openingplayfromscrimmageandaddeda20-yardgrabearlyin (nineinthefirsthalfatMinnesotain2019).Furtherextendedhis thesecondquarter.Scoredfrom5yardsoutonascreenpass franchiserecordwithhis10thgameof10-pluscatchesand midwaythroughthesecondquarter,his10threceivingTDofthe becamethefirstplayerinteamhistorytoregisterthreegames seasonashebecamejustthefourthplayerinteamhistory with13-pluscatches(Hutson,two).Becamethefirstplayerin (Hutson,BillyHowton,Cobb)toregister10-plusreceivingTDsin franchiseannalstorecordthreeconsecutive100-yardgames thefirst10gamesofaseason. againstMinnesota.HisfirstTDcameona24-yardgrablateinthe firsthalf,tappinghisfeetinboundsonthesidelineinfrontofS AnthonyHarris…Vs. Detroit (Sept. 20):Started,butwaslimited tojust38snapsafterdepartingthegameinthethirdquarterdue toahamstringinjury.Postedthreereceptionsfor36yards(12.0 avg.)…At New Orleans (Sept. 27):Inactive(hamstring)…Vs. Atlanta (Oct. 5):Inactive(hamstring)…At Tampa Bay (Oct. 18): Startedandplayed52of63snaps,pacingtheteamwithsix receptionsfor61yards(10.2avg.)…At Houston (Oct. 25):
2020GREENBAYPACKERS 1 REGULAR SEASON COMPARISON: RECEIVING - CHICAGO BEARS DATE OPP W/L GP/GS REC YDS. AVG. TD LG TGTS YAC 9/28/14 GB@CHI W P 2 18 9.0 0 15 3 9 11/9/14 GBvs.CHI WP 1 10 10.0 0 10 2 2 9/13/15 GB@CHI WS 4 59 14.8 0 25 8 19 11/26/15 GBvs.CHI LS 2 14 7.0 0 8 11 7 10/20/16 GBvs.CHI WS 13 132 10.2 2 24 16 29 12/18/16 GB@CHI WS 2 25 12.5 0 19 6 14 9/28/17 GBvs.CHI WS 2 13 6.5 1 8 5 6 11/12/17 GB@CHI WS 5 90 18.0 1 42 8 18 9/9/18 GBvs.CHI WS 5 88 17.6 1 51 8 52 12/16/18 GB@CHI LS 8 119 14.9 0 28 13 44 9/5/19 GB@CHI WS 4 36 9.0 0 11 8 19 12/15/19 GBvs.CHI WS 7 103 14.7 1 34 13 43 TOTALS 10/2 12/10 55 707 12.9 6 51 101 262
DAVANTE ADAMS' NFL REGULAR SEASON RECEIVING STATISTICS
RECEIVING DATE TEAM GP GS NO. YDS. AVG. LG TD 2014 Packers 16 11 38 446 11.7 45 3 2015 Packers 13 12 50 483 9.7 40 1 2016 Packers 16 15 75 997 13.3 66t 12 2017 Packers 14 14 74 885 12.0 55t 10 2018 Packers 15 15 111 1,386 12.5 57 13 2019 Packers 12 12 83 997 12.0 58 5 2020 Packers 8 8 68 847 12.5 49 10 NFL TOTALS 94 87 499 6,041 12.1 66t 54
DAVANTE ADAMS' NFL POSTSEASON RECEIVING STATISTICS
RECEIVING DATE TEAM GP GS NO. YDS. AVG. LG TD 2014 Packers 2 2 8 124 15.5 46t 1 2015 Packers 1 0 4 48 12.0 20 1 2016 Packers 3 3 16 217 13.6 32 2 2019 Packers 2 2 17 298 17.5 65 2 NFL TOTALS 8 7 45 687 15.3 65 6
SINGLE-GAME HIGHS: RUSHING/RECEIVING Receptions 14atMinnesotaVikings,Sep13,2020 All-purpose yards 196atHoustonTexans,Oct25,2020 13atHoustonTexans,Oct25,2020 180vs.PhiladelphiaEagles,Sep26,2019 ...2moreat13. Miscellaneous Tackles 1vs.MinnesotaVikings,Sep15,2019 Receiving Yards 196atHoustonTexans,Oct25,2020 1vs.BuffaloBills,Sep30,2018 180vs.PhiladelphiaEagles,Sep26,2019 ...4moreat1. Longest Receptions 66tvs.SeattleSeahawks,Dec11,2016 Most TDs 3vs.MinnesotaVikings,Nov01,2020 58vs.PhiladelphiaEagles,Sep26,2019 2atHoustonTexans,Oct25,2020 Receiving TDs 3vs.MinnesotaVikings,Nov01,2020 ...9moreat2. 2atHoustonTexans,Oct25,2020 ...9moreat2.
2020GREENBAYPACKERS 2 100-YARD RECEIVING GAMES (20): REGULAR SEASON DATE TEAM NO. YDS. AVG. LG TD 11/30/14 PATRIOTS 6 121 20.2 45 0 10/20/16 BEARS 13 132 10.2 24 2 11/13/16 atTitans 6 156 26.0 46 0 11/28/16 atEagles 5 113 22.6 50 2 12/11/16 SEAHAWKS 4 104 26.0 66t 1 11/19/17 RAVENS 8 126 15.8 33 0 10/07/18 atLions 9 140 15.6 30 1 10/15/18 49ERS 10 132 13.2 38 2 10/28/18 atRams 5 133 26.6 48 0 11/15/18 atSeahawks 10 166 16.6 57 0 12/16/18 atBears 8 119 14.9 28 0 09/15/19 VIKINGS 7 106 15.1 39 0 09/26/19 EAGLES 10 180 18.0 58 0 11/10/19 PANTHERS 7 118 16.9 38 0 12/15/19 BEARS 7 103 14.7 34 1 12/23/19 atVikings 13 116 8.9 18 0 09/13/20 atVikings 14 156 11.1 40 2 10/25/20 atTexans 13 196 15.1 45t 2 11/05/20 at49ers 10 173 17.3 49 1 11/22/20 atColts 7 106 15.1 33 1 100-YARD RECEIVING GAMES (4): POSTSEASON DATE TEAM NO. YDS. AVG. LG TD 01/11/15 COWBOYS 7 117 16.7 46t 1 01/08/17 GIANTS 8 125 15.6 31 1 01/12/20 SEAHAWKS 8 160 20.0 40t 2 01/19/20 at49ers 9 138 15.3 65 0 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RECEIVING RUSHING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings S 14 156 11.1 40 2 0 0 0.0 0 0 W 43-34 09/20 Lions S 3 36 12.0 17 0 0 0 0.0 0 0 W 42-21 09/27 atSaints GAMEINACTIVE/INJURY W 37-30 10/05 Falcons GAMEINACTIVE/INJURY W 30-16 10/18 atBuccaneers S 6 61 10.2 18 0 0 0 0.0 0 0 L 10-38 10/25 atTexans S 13 196 15.1 45t 2 0 0 0.0 0 0 W 35-20 11/01 Vikings S 7 53 7.6 15 3 0 0 0.0 0 0 L 22-28 11/05 at49ers S 10 173 17.3 49 1 0 0 0.0 0 0 W 34-17 11/15 Jaguars S 8 66 8.3 22 1 0 0 0.0 0 0 W 24-20 11/22 atColts S 7 106 15.1 33 1 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 8-8 68 847 12.5 49 10 0 0 0.0 0 0 7-3 +-Overtime
2019 GAME-BY-GAME POSTSEASON STATISTICS (PACKERS) RECEIVING DATE OPPONENT P/S NO. YDS. AVG. LG TD W/L SCORE 01/12 Seahawks S 8 160 20.0 40t 2 W 28-23 01/19 at49ers S 9 138 15.3 65 0 L 20-37 2019 TOTALS 2-2 17 298 17.5 65 2 1-1
2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) KICKOFF RETURNS PUNT RETURNS DATE OPPONENT P/S RET YDS AVG LG TD NO FC YDS AVG LG TD W/L SCORE 09/13 atVikings S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 43-34 09/20 Lions S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 42-21 09/27 atSaints GAMEINACTIVE/INJURY W 37-30 10/05 Falcons GAMEINACTIVE/INJURY W 30-16 10/18 atBuccaneers S 0 0 0.0 0 0 0 0 0 0.0 0 0 L 10-38 10/25 atTexans S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 35-20 11/01 Vikings S 0 0 0.0 0 0 0 0 0 0.0 0 0 L 22-28 11/05 at49ers S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 34-17 11/15 Jaguars S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 24-20 11/22 atColts S 0 0 0.0 0 0 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 8-8 0 0 0.0 0 0 0 0 0 0.0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 3 (sixsolo)andtwotacklesforaloss…Wasinactive(toe)forWeek 1andWeek11…At Minnesota (Sept. 13):Inactive(toe)…Vs. Detroit (Sept. 20):Madehisfirstgameappearanceoftheseason, recordingoneassistedtacklewhileplaying12snapsondefense andeightsnapsonspecialteams…At New Orleans (Sept. 27): Appearedon11defensivesnapsand13specialteamssnaps, recordingoneassistedtackleondefense…Vs. Atlanta (Oct. 5): Playedon10defensivesnapsandeightspecialteamssnaps, makingoneassistedtackleondefense…At Tampa Bay (Oct. 18): Recordedaseason-highfourtackles(threesolo)andatacklefor alosson28defensivesnaps.Alsoplayedeightsnapsonspecial teams.Lateinthethirdquarter,blewpastGAlexCappatomeet RBLeSeanMcCoyinthebackfieldfora3-yardloss…At Houston (Oct. 25):Appearedon23defensiveplays,makingoneassisted tackle. Also appeared on 10 plays on special teams…Vs. Minnesota (Nov. 1):Playedsixsnapsondefenseandsixsnaps onspecialteams…At San Francisco (Nov. 5):Notchedtwosolo tacklesandatackleforalosswhileappearingon26defensive plays.Alsoappearedon10playsonspecialteams.Lateinthe firstquarter,cameunblockedofftheleftedgetodropRBJaMycal Hastyfora1-yardloss…Vs. Jacksonville (Nov. 15):Posteda solotacklewhileappearingon14defensiveplays.Alsosaw actiononeightplaysonspecialteams…At Indianapolis (Nov. 22):Inactive(toe). 2020 SEASON: Hasplayedineightgames,recording11tackles
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 11/12/17 GB@CHI W P 2 0 2 0.0 0 0 0 0 1 0 0 0 9/9/18 GBvs.CHI WP 1 1 0 0.0 0 0 0 0 0 0 0 0 12/16/18 GB@CHI LP 3 3 0 0.5 2 0 2 0 0 0 1 0 9/5/19 GB@CHI WS 4 2 2 0.0 0 0 0 0 0 0 0 0 12/15/19 GBvs.CHI WP 0 0 0 0.0 0 0 0 0 1 0 0 0 TOTALS 4/1 5/1 10 6 4 0.5 2 0 2 0 2 0 1 0
MONTRAVIUS ADAMS' NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2017 Packers 7 0 5 1 4 0 0 0.0 0.0 1 0 000000 00000000 2018 Packers 16 1 26 17 9 6 3 1.5 3.5 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 2019 Packers 14 2 19 14 5 0 0 0.0 0.0 2 0 0 0 0 3 0 1 0 0 0 0 0 0 0 0 2020 Packers 8 0 11 6 5 2 1 0.0 0.0 00 000000 00000000 NFL TOTALS 45 3 61 38 23 8 4 1.5 3.5 3 0 0 0 0 3 1 1 0 0 0 0 0 0 0 0
MONTRAVIUS ADAMS' NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 2 0 0 0 0 0 0 0.0 0.0 1 0 000000 00000000 NFL TOTALS 2 0 0 0 0 0 0 0.0 0.0 1 0 000000 00000000
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 7vs.DetroitLions,Dec30,2018 Forced Fumbles 1atChicagoBears,Dec16,2018 5atLosAngelesChargers,Nov03,2019 Fumble Recoveries 1vs.CarolinaPanthers,Nov10,2019 Sacks 1.0vs.MiamiDolphins,Nov11,2018 Tackles For Loss 2atNewYorkJets,Dec23,2018 0.5atChicagoBears,Dec16,2018 2atChicagoBears,Dec16,2018 Passes Defensed 1vs.CarolinaPanthers,Nov10,2019 1atKansasCityChiefs,Oct27,2019 ...1moreat1.
2020GREENBAYPACKERS 5 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings GAMEINACTIVE/INJURY W 43-34 09/20 Lions P 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints P 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons P 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers P 4 3 1 0.0 0.0 1 0 00 000000 00000000 L 10-38 10/25 atTexans P 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 35-20 11/01 Vikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers P 2 2 0 0.0 0.0 1 1 00 000000 00000000 W 34-17 11/15 Jaguars P 1 1 0 0.0 0.0 0 0 00 000000 00000000 W 24-20 11/22 atColts GAMEINACTIVE/INJURY L 31-34+ 2020 TOTALS 8-0 11 6 5 0.0 0.0 2 1 0 0 000000 00000000 7-3 +-Overtime
2020GREENBAYPACKERS 6 Giants.AccordingtoSportradar,AlexanderandHart(1971)are theonlyPackerstoregisteraninterceptionandsafetyinthesame game,datingbackto1948.With:34secondsleftinthefirsthalf, pickedoffCousinsonadeeppassdowntherightsideintended forWRAdamThielen,givingGBtheballattheMIN41-yardline. Twoplayslater,thePackersscoredona45-yardpassfromQB AaronRodgerstoWRMarquezValdes-Scantlingtotakea22-7 lead.BecamethefifthNFLplayertorecordasack,interception andasafetyinasinglegamesince2000,joiningRockyBoiman (Week4,2003),CalaisCampbell(Week5,2016),JamesHarrison (Week11,2008)andAdaliusThomas(Week2,2006)...Vs. Detroit (Sept. 20):FinishedtiedforNo.2ontheteamwithfour tackles(threesolo)...At New Orleans (Sept. 27):Playedall61 defensivesnaps,recordingthreesolotackles,atackleforaloss andapassdefensed.Earlyinthesecondquarter,tackledRBAlvin Kamaraforalossof2yardstoforceathird-and-10theSaints didn'tconvert,forcingapunt.AccordingtoNFLNextGenStats, heplayed38coveragesnapsandallowedjustonereceptionon twotargetsasthenearestdefender...Vs. Atlanta (Oct. 5):Tiedfor No.4ontheteamwithaseasonhighsixtackles(foursolo). ShadowedWRCalvinRidleyon23ofhis27routesanddidnot allowacatch(NFLNextGenStats)...At Tampa Bay (Oct. 18): Playedin60ofthepossible65defensivesnapsandrecordedtwo solotackles.AccordingtoNFLNextGenStats,heshadowedWR MikeEvanson19ofhis24routes(79%)andwasonlytargeted once(0receptions).StoppedRBRonaldJonesintheflatfora2- yardreceptiontoforceathird-and-sixinthesecondquarter...At Houston (Oct. 25): Playedall68defensivesnapsandregistereda passdefensed,breakingupapassintendedforWRWillFullerto forceathird-and-six...Vs. Minnesota (Nov. 1): Sawactionon49 defensivesnapsandwastiedforNo.3ontheteamwithfive 2020 SEASON:Startedallninegameshehasappearedinandis tackles(allsolo)...At San Francisco (Nov. 5): Playedin18snaps tiedfortheteamleadinbothinterceptions(one)andpasses ondefense,recordingatackle(assisted),andonesnaponspecial defensed(five)...At Minnesota (Sept. 13):Postedfivetackles teamsbeforeaconcussionendedhisnight...Vs. Jacksonville (foursolo,tiedforNo.2ontheteam),atackleforaloss,aQB (Nov. 15): Inactive(concussion/hand)...At Indianapolis (Nov. hit,apassdefensed,aninterceptionandasackforasafety.With 22): Ledtheteamwithtwopassesdefensedwhilealsorecording Minnesotaontheirown4-yardlineearlyinthesecondquarter, fivetackles(threesolo).Earlyinthefourthquarter,brokeupa blitzedofftheleftsideandwentuntouchedtosackQBKirk passintendedforTETreyBurtononthird-and-7toforceafield Cousinsforasafety.BecamethefirstPackersDBwithasafety goal. sinceDougHartinthe1971seasonopenerattheNewYork
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 9/9/18 GBvs.CHI W P 3 3 0 0.0 0 0 0 1 0 0 0 0 12/16/18 GB@CHI LS 4 3 1 0.0 0 0 0 1 0 0 0 0 9/5/19 GB@CHI WS 6 2 4 0.0 0 0 0 2 0 0 0 0 12/15/19 GBvs.CHI WS 8 6 2 0.0 0 1 1 2 0 0 0 0 TOTALS 3/1 4/3 21 14 7 0.0 0 1 1 6 0 0 0 0
JAIRE ALEXANDER'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2018 Packers 13 11 76 61 15 3 27 0.5 3.0 1 1 27 27 0 15 0 0 0 2 2 0 0 2 0 0 2019 Packers 16 16 63 41 22 2 4 0.0 0.0 0 2 37 37 0 23 1 1 0 0 0 0 0 0 0 0 2020 Packers 9 9 31 25 6 2 6 1.0 4.0 1 1 -4 0 0 5 0 0 0 0 0 0 0 0 0 0 NFL TOTALS 38 36 170 127 43 7 37 1.5 7.0 2 4 60 37 0 43 1 1 0 2 2 0 0 2 0 0
JAIRE ALEXANDER'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 2 2 13 10 3 0 0 0.0 0.0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 NFL TOTALS 2 2 13 10 3 0 0 0.0 0.0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0
2020GREENBAYPACKERS 7 SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 12vs.AtlantaFalcons,Dec09,2018 Interceptions 1atMinnesotaVikings,Sep13,2020 10vs.MinnesotaVikings,Sep16,2018 1vs.ChicagoBears,Dec15,2019 Sacks 1.0atMinnesotaVikings,Sep13,2020 ...2moreat1. 0.5vs.MinnesotaVikings,Sep16,2018 Interception Return Yards 37atDallasCowboys,Oct06,2019 Passes Defensed 5atLosAngelesRams,Oct28,2018 27vs.BuffaloBills,Sep30,2018 4vs.MinnesotaVikings,Sep15,2019 Safeties 1atMinnesotaVikings,Sep13,2020 Forced Fumbles 1vs.DenverBroncos,Sep22,2019 Special Teams Tackles 1atWashington,Sep23,2018 Fumble Recoveries 1vs.DenverBroncos,Sep22,2019 1vs.MinnesotaVikings,Sep16,2018 Tackles For Loss 1atNewOrleansSaints,Sep27,2020 Special Teams Fumble Recoveries 2vs.AtlantaFalcons,Dec09,2018 1atMinnesotaVikings,Sep13,2020 ...5moreat1. 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings S 5 4 1 1.0 4.0 1 4 1 1 -4 -4 0 1 0 0 0 0 0 0 0 0 0 0 W 43-34 09/20 Lions S 4 3 1 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints S 3 3 0 0.0 0.0 1 2 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 37-30 10/05 Falcons S 6 4 2 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers S 2 2 0 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans S 0 0 0 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 35-20 11/01 Vikings S 5 5 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers S 1 1 0 0.0 0.0 0 0 00 000000 00000000 W 34-17 11/15 Jaguars GAMEINACTIVE/INJURY W 24-20 11/22 atColts S 5 3 2 0.0 0.0 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 L 31-34+ 2020 TOTALS 9-9 31 25 6 1.0 4.0 2 6 1 1 -4 -4 0 5 0 0 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 8 Atlanta (Oct. 5): Registeredfourtackles(allsolo),aQBhitanda passdefensedwhileplayingall70defensivesnaps.WithGBup 14pointswithunderfourminutestoplayinthegame,brokeupa passintheendzonetoWRCalvinRidleyonfourthand10...At Tampa Bay (Oct. 18): Played every defensive snap (65), recordingthreetackles(allassisted)...At Houston (Oct. 25): Saw actiononeverydefensivesnap(68)forthefifthtimethisseason andtiedfortheteamleadwithfivesolotacklesaspartofasix- tackledaywhilealsorecordingasack,atackleforaloss,aQBhit andafumblerecovery.Onthefirstplayofthefourthquarter, sackedQBDeshaunWatsonforalossof12yardsonthird-and- threetoforceafieldgoal.Withundertwominutestoplay, recoveredafumbleattheGB32-yardlinethatwasforcedbyS HenryBlack.WasthefirstPackersDBwithasackandafumble recoveryinagamesinceSHaHaClinton-DixatSeattleinWeek1 ofthe2014season...Vs. Minnesota (Nov. 1): Playedall52 defensivesnapsandledtheteamintackles(eight)andsolo tackles(six),whilealsoregisteringatackleforaloss.StoppedRB DalvinCookforalossof2yardsonthird-and-1toforceapunt withundersevenminutestoplayinthegame.GreenBayscored ontheensuingpossessiontopullwithinsixpoints...At San Francisco: Sawactionon46defensiveplays(No.2ontheteam) andonespecialteamsplay.Postedfivetacklesondefense,with allfivebeingsolotacklestoleadtheteam...Vs. Jacksonville (Nov. 15): Recordedtwotackles(bothsolo),apassdefensedand 2020 SEASON:Startedall10gamesandisNo.3ontheteam interceptedQBJakeLutonwithjustundertwominutestoplayin with44tackles(team-high33solo),threetacklesforaloss,a thesecondquarter,returningit23yardstotheJAX26-yardline. sack, a fumble recovery, two QB hits and two passes TheensuingdriveresultedinaFGtogiveGBa17-10leadheaded defensed...At Minnesota (Sept. 13):Postedtwotackles(one intohalftime...At Indianapolis (Nov. 22): TiedforNo.3onthe solo)andjoinedLBChristianKirkseyastheonlyPackerstoplay teamwithseventackles(foursolo)whilealsorecordingapass all52defensivesnaps...Vs. Detroit (Sept. 20):Sawactionon54 defensedandatackleforalosswhenhebroughtdownRB ofapossible59defensivesnapsandrecordedtwotackles(one JonathanTaylorforalossof2yardsonthird-and-2toforceafield solo)...At New Orleans (Sept. 27): Playedall61snapsand goalonfourthdownwithjustover11minutestoplayinthe finishedNo.4ontheteamwithfivetackles(foursolo)...Vs. game.
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 9/5/19 GB@CHI W S 5 3 2 0.0 0 1 0 1 0 0 0 0 12/15/19 GBvs.CHI WS 3 3 0 0.0 0 0 1 0 0 0 0 0 TOTALS 2/0 2/2 8 6 2 0.0 0 1 1 1 0 0 0 0
ADRIAN AMOS' NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2015 Bears 16 16 108 78 30 2 8 1.0 7.0 1 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 2016 Bears 15 14 60 50 10 3 8 0.0 0.0 0 0 0 0 0 5 1 1 21 3 3 0 0 0 0 0 2017 Bears 13 10 66 59 7 6 11 0.0 0.0 0 1 90 90t 1 3 2 1 4 2 2 0 0 0 0 0 2018 Bears 16 16 71 57 14 2 4 1.0 2.0 1 2 27 26 0 9 0 1 15 1 1 0 0 0 0 0 2019 Packers 16 16 87 64 23 6 8 1.0 4.0 1 2 12 9 0 8 0 0 0 3 3 0 0 0 0 0 2020 Packers 10 10 44 33 11 3 16 1.0 12.0 2 1 23 23 0 3 0 1 0 0 0 0 0 0 0 0 NFL TOTALS 86 82 436 341 95 22 55 4.0 25.0 5 6 152 90t 1 30 3 4 40 9 9 0 0 0 0 0
ADRIAN AMOS' NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2018 Bears 1 1 6 5 1 0 0 0.0 0.0 0 1 0 0 0 2 0 0 0 0 0 0 0 0 0 0 2019 Packers 2 2 6 3 3 0 0 0.0 0.0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 NFL TOTALS 3 3 12 8 4 0 0 0.0 0.0 0 1 0 0 0 3 0 0 0 0 0 0 0 0 0 0
2020GREENBAYPACKERS 9 SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 11atMinnesotaVikings,Dec31,2017 Tackles For Loss 2vs.MinnesotaVikings,Sep15,2019 11vs.DetroitLions,Oct02,2016 2atMinnesotaVikings,Dec31,2017 ...1moreat11. ...1moreat2. Sacks 1.0atHoustonTexans,Oct25,2020 Interceptions 1vs.JacksonvilleJaguars,Nov15,2020 1.0vs.Washington,Dec08,2019 1vs.Washington,Dec08,2019 ...2moreat1.0. ...4moreat1. Passes Defensed 3atBuffaloBills,Nov04,2018 Interception Return Yards 90atBaltimoreRavens,Oct15,2017 2vs.Washington,Dec08,2019 26vs.MinnesotaVikings,Nov18,2018 ...2moreat2. Special Teams Tackles 2atChicagoBears,Sep05,2019 Forced Fumbles 1atPhiladelphiaEagles,Nov26,2017 1vs.MinnesotaVikings,Sep15,2019 1atNewOrleansSaints,Oct29,2017 ...6moreat1. ...1moreat1. Fumble Recoveries 1atHoustonTexans,Oct25,2020 1vs.DetroitLions,Nov11,2018 ...2moreat1. 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings S 3 2 1 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions S 2 1 1 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints S 5 4 1 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons S 4 4 0 0.0 0.0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 30-16 10/18 atBuccaneers S 3 0 3 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans S 6 5 1 1.0 12.0 1 12 1 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 W 35-20 11/01 Vikings S 7 6 1 0.0 0.0 1 2 00 000000 00000000 L 22-28 11/05 at49ers S 5 5 0 0.0 0.0 0 0 00 000000 00000000 W 34-17 11/15 Jaguars S 2 2 0 0.0 0.0 0 0 0 1 23 23 0 1 0 0 0 0 0 0 0 0 0 0 W 24-20 11/22 atColts S 7 4 3 0.0 0.0 1 2 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 L 31-34+ 2020 TOTALS 10-10 44 33 11 1.0 12.0 3 16 2 1 23 23 0 3 0 1 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 10 andfourTDswithnoINTsfora127.5rating…Vs. Detroit (Sept. 20):StartedatLTandplayed68of73snaps,restingthefinal serieswiththePackersleading,42-21.HelpedclearholesforRB AaronJones’career-high168rushingyardsandtwoTDson18 carries(9.3avg.)asJonesfinishedwithacareer-best236yards fromscrimmage,thethirdmostinagameinfranchisehistory. Partofanoffensethatrackedup259yardsrushingon35 attempts(7.4avg.),thetopyardagetotalbyGreenBaysinceDec. 28,2003,vs.Denver(262yardson34carries).Alsowaspartofa linethatallowedjustonesackofRodgersontheafternoon…At New Orleans (Sept. 27):StartedatLTandplayedall62snapsas thelineallowedjustonesackontheeveningandprotected Rodgersasheconnectedon21of32passesfor283yardsand threeTDsfora124.9rating…Vs. Atlanta (Oct. 5):StartedatLT andplayedall63snaps,helpingprotectRodgersashewas sackedjustonceontheeveningandcompleted27of33passes for327yardsandfourTDswithnoINTsfora147.5rating…At Tampa Bay (Oct. 18):StartedatLTandplayedthefirst40 offensivesnapsbeforedepartingthegameduetoachestinjury he sustained on Green Bay’s opening offensive play from scrimmageinthethirdquarter…At Houston (Oct. 25):Was inactiveduetoachestinjury,snappingastreakof48consecutive regular-season games played dating back to 2017…Vs. Minnesota (Nov. 1):Inactive(chest)…At San Francisco (Nov. 2020 SEASON: Hasstartedallsevengameshehasplayedinat 5):Inactive(chest)…Vs. Jacksonville (Nov. 15):Returnedto LT…Partofalinethathasallowedonesackorzerosacksina actionaftermissingthreegames,startingatLTandplayingall65 league-bestninegames,thefirstNFLteamtodosointhefirst10 snaps.Partofalinethatallowedonlyonesackonthedayas gamesoftheseasonsince2008(threeteams)…Hashelpedthe Rodgersthrewfor325yardsandtwoTDswithoneINTon24- PackersrankNo.3inscoring(30.8ppg)andsacksallowed(11), of-34passing(108.1rating)…At Indianapolis (Nov. 22): Started tiedforNo.3ingiveaways(nine),No.7intotaloffense(392.9 atLTandplayedall60snaps,helpingtoprotectRodgersashe ypg),No.6inpassingoffense(277.0ypg),No.3inyardsper wassackedjustonceandconnectedon27of38passesfor311 play(6.25),No.4inthird-downpercentage(47.9)andNo.1in yardsandthreeTDswithoneINT(110.7rating). timeofpossession(32:27)…At Minnesota (Sept. 13):Startedat LTandplayedall78snaps,helpingthePackersregistertheirfirst zero-sackgameagainsttheVikingssinceOct.24,2010,andtheir firstgameinfranchisehistorywith40-pluspoints,500-plus yards,30-plusfirstdownsandnoturnovers.BlockedforQB AaronRodgersasheconnectedon32of44passesfor364yards
DAVID BAKHTIARI'S NFL REGULAR SEASON STATISTICS
DATE TEAM GP GS 2013 Packers 16 16 2014 Packers 16 16 2015 Packers 14 14 2016 Packers 16 16 2017 Packers 12 12 2018 Packers 16 16 2019 Packers 16 16 2020 Packers 7 7 NFL TOTALS 113 113
DAVID BAKHTIARI'S NFL POSTSEASON STATISTICS
DATE TEAM GP GS 2013 Packers 1 1 2014 Packers 2 2 2015 Packers 1 1 2016 Packers 3 3 2019 Packers 2 2 NFL TOTALS 9 9
2020GREENBAYPACKERS 11 serieswiththePackersleading,42-21.HandedtheballofftoRB AJDillonthreetimesandthenhadtwokneel-downstorunout theclock…At New Orleans (Sept. 27):ServedastheNo.2QB, butdidnotseeanyaction…Vs. Atlanta (Oct. 5):Cameinfora kneel-downonthefinalsnapofthegame…At Tampa Bay (Oct. 18):TookoverforGreenBay’sfinalserieswiththePackers trailing,38-10,andhandedtheballofftwice…At Houston (Oct. 25):Cameinforkneel-downsonthefinaltwosnapsofthe game…Vs. Minnesota (Nov. 1):ServedastheNo.2QB,butdid notseeanyaction…At San Francisco (Nov. 5):Playedthefinal fouroffensivesnaps,handingtheballoffthreetimesandtakinga kneeonthefinalplay…Vs. Jacksonville (Nov. 15):Servedasthe No.2QB,butdidnotseeanyaction…At Indianapolis (Nov. 22): ServedastheNo.2QB,butdidnotseeanyaction. 2020 SEASON: Hasplayedinsixgames,takingoveratQBforthe finalseriesinWeeks1,2,4,6,7and9,buthasnothadany passingattempts…At Minnesota (Sept. 13):TookoveratQBfor thefinaltwosnapsofthegame(kneel-downs)asthePackersran outtheclock…Vs. Detroit (Sept. 20):CameinatQBforthefinal
TIM BOYLE'S NFL REGULAR SEASON PASSING STATISTICS
DATE TEAM GP GS ATT. CMP. PCT. YDS AVG. TD INT. LG SK LST RATE 2019 Packers 3 0 4 3 75.0 15 3.8 0 0 7 0 0 80.2 2020 Packers 6 0 0 0 0.0 0 0.0 0 0 0 1 11 0.0 TOTALS 9 0 4 3 75.0 15 3.8 0 0 7 1 11 80.2
TIM BOYLE'S NFL REGULAR SEASON RUSHING STATISTICS
DATE TEAM NO. YDS. AVG. LG TD 2019 Packers 5 -7 -1.4 0 0 2020 Packers 8 -6 -0.8 0 0 TOTALS 13 -13 -1.0 0 0
TIM BOYLE'S NFL REGULAR SEASON PASSING/RUSHING STATISTICS
PASSING RUSHING DATE TEAM GP GS ATT. CMP. PCT. YDS AVG. TD INT. LG SK LST RATE NO. YDS. AVG. LG TD 2019 Packers 3 0 4 3 75.0 15 3.8 0 0 7 0 0 80.2 5 -7 -1.4 0 0 2020 Packers 6 0 0 0 0.0 0 0.0 0 0 0 1 11 0.0 8 -6 -0.8 0 0 TOTALS 9 0 4 3 75.0 15 3.8 0 0 7 1 11 80.2 13 -13 -1.0 0 0
SINGLE-GAME HIGHS: QUARTERBACK Pass Attempts 4atSanFrancisco49ers,Nov24,2019 Long Passes 7atSanFrancisco49ers,Nov24,2019 Pass Completions 3atSanFrancisco49ers,Nov24,2019 5atSanFrancisco49ers,Nov24,2019 Yards Passing 15atSanFrancisco49ers,Nov24,2019 Rush Attempts 3vs.OaklandRaiders,Oct20,2019 2atHoustonTexans,Oct25,2020 ...3moreat2.
2020GREENBAYPACKERS 12 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) PASSING RUSHING DATE OPPONENT P/S ATT CMP YDS PCT Y/A Y/C TD INT LG SK/YD RATE ATT YDS LG TD W/L SCORE 09/13 atVikings P 0 0 0 0.0 0.0 0.0 0 0 0 0/0 0.0 2 -2 -1 0 W 43-34 09/20 Lions P 0 0 0 0.0 0.0 0.0 0 0 0 0/0 0.0 2 -1 0 0 W 42-21 09/27 atSaints DIDNOTPLAY(NON-INJURY) W 37-30 10/05 Falcons P 0 0 0 0.0 0.0 0.0 0 0 0 0/0 0.0 1 -1 -1 0 W 30-16 10/18 atBuccaneers P 0 0 0 0.0 0.0 0.0 0 0 0 1/11 0.0 0 0 0 0 L 10-38 10/25 atTexans P 0 0 0 0.0 0.0 0.0 0 0 0 0/0 0.0 2 -1 0 0 W 35-20 11/01 Vikings DIDNOTPLAY(NON-INJURY) L 22-28 11/05 at49ers P 0 0 0 0.0 0.0 0.0 0 0 0 0/0 0.0 1 -1 -1 0 W 34-17 11/15 Jaguars DIDNOTPLAY(NON-INJURY) W 24-20 11/22 atColts DIDNOTPLAY(NON-INJURY) L 31-34+ 2020 TOTALS 6-0 0 0 0 0.0 0.0 0.0 0 0 0 1/11 0.0 8 -6 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 13 Crosby’stwofieldgoals/fourextrapoints…At New Orleans (Sept. 27):SnappedasCrosbykickedthreefieldgoalsandfour extrapointsandScottpuntedonce…Vs. Atlanta (Oct. 5): SnappedforCrosby’s48-yardfieldgoalandthreeextrapoints andforScott’stwopunts(40.5-yardgrossaverage,30.5-yardnet average)…At Tampa Bay (Oct. 18):Handledallsnappingduties asCrosbykickeda39-yardfieldgoalandanextrapointandScott puntedseventimes(46.4-yardgrossaverage,42.1-yardnet average)withtwopuntsinsidethe20…At Houston (Oct. 25): SnappedforCrosby’sfiveextrapointsandScott’sfivepunts attempts (41.4-yard gross average, 37.6-yard net average), includingaseason-longpuntof62yards…Vs. Minnesota (Nov. 1):HandledsnappingdutiesasCrosbykickedtwoextrapoints andScottdownedhislonepuntoftheday,a38-yarder,on Minnesota’s6-yardline…At San Francisco (Nov. 5):Snappedfor Scott’sthreepunts(52.3-yardgrossaverage,40.3-yardnet average)andCrosby’sfourextrapointsandtwofieldgoals, includingaseason-long53-yardkick…Vs. Jacksonville (Nov. 2020 SEASON:Hashandledsnappingdutiesinall10games…At 15):SnappedforScott’sfivepuntsandCrosby’s39-yardfield Minnesota (Sept. 13):HandledsnappingdutiesforKMason goalandthreeextrapoints…At Indianapolis (Nov. 22):Handled Crosby’stwofieldgoals(31,43)andfiveextrapointsalongwith allsnappingdutiesasCrosbykickeda26-yardfieldgoalandfour PJKScott’slonepunt(40yards,grossandnet)…Vs. Detroit extrapointsandScottpuntedthreetimes(39.0-yardgross (Sept. 20):SnappedforScottasheplacedallthreeofhispunts average,36.0-yardnetaverage). insidethe20(42.7-yardgrossandnetaverage).Alsosnappedfor
HUNTER BRADLEY'S NFL REGULAR SEASON STATISTICS
DATE TEAM GP 2018 Packers 16 2019 Packers 16 2020 Packers 10 NFL TOTALS 42
HUNTER BRADLEY'S NFL POSTSEASON STATISTICS
DATE TEAM GP 2019 Packers 2 NFL TOTALS 2
2020GREENBAYPACKERS 14 2020 SEASON:Hasappearedinfourgames,makingthreespecial teamstackles…SignedwithGreenBayonOct.24afterpreviously spendingoneweekonAtlanta’spracticesquad…Spenttraining campwiththeNewYorkJetsbeforebeingwaivedonSept. 9…Vs. Minnesota (Nov. 1):MadehisPackersdebut,appearing on11specialteamssnapsandmakingonetackle…At San Francisco (Nov. 5):Sawactionon13specialteamsplays…Vs. Jacksonville (Nov. 15):Tiedhiscareerhighwithateam-leading twospecialteamstacklesin16snapsofwork…At Indianapolis (Nov. 22):Appearedon11specialteamsplays.
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 12/24/17 CLV@CHI L S 9 7 2 1.0 3 0 3 0 1 0 0 0 TOTALS 0/1 1/1 9 7 2 1.0 3 0 3 0 1 0 0 0
JAMES BURGESS' NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2017 Browns 14 9 70 44 26 12 42 4.0 23.0 7 0 0 0 0 3 1 0 0 5 5 0 0 0 0 0 2018 Browns 3 2 7 5 2 1 2 0.0 0.0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 2019 Jets 10 10 90 68 22 8 12 0.5 5.0 1 1 2 2 0 6 1 1 -4 0 0 0 0 0 0 0 2020 Packers 4 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 3 3 0 0 0 0 0 NFL TOTALS 31 21 167 117 50 21 56 4.5 28.0 8 1 2 2 0 9 2 1 -4 9 9 0 0 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 15vs.JacksonvilleJaguars,Nov19,2017 Tackles For Loss 3atChicagoBears,Dec24,2017 12vs.MiamiDolphins,Dec08,2019 3vs.JacksonvilleJaguars,Nov19,2017 Sacks 1.0atChicagoBears,Dec24,2017 Interceptions 1atBuffaloBills,Dec29,2019 1.0vs.JacksonvilleJaguars,Nov19,2017 Interception Return Yards 2atBuffaloBills,Dec29,2019 ...2moreat1.0. Safeties 1atMiamiDolphins,Nov03,2019 Passes Defensed 2vs.MiamiDolphins,Dec08,2019 Special Teams Tackles 2vs.JacksonvilleJaguars,Nov15,2020 1atBuffaloBills,Dec29,2019 2vs.CincinnatiBengals,Oct01,2017 ...6moreat1. Forced Fumbles 1vs.MiamiDolphins,Dec08,2019 1atIndianapolisColts,Sep24,2017 Fumble Recoveries 1vs.OaklandRaiders,Nov24,2019
2020GREENBAYPACKERS 15 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (FALCONS/PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 Seahawks NOTONROSTER L 25-38 09/20 atCowboys NOTONROSTER L 39-40 09/27 Bears NOTONROSTER L 26-30 10/05 atPackers NOTONROSTER L 16-30 10/11 Panthers PRACTICESQUAD L 16-23 10/25 atTexans GAMEINACTIVE W 35-20 11/01 Vikings P 0 0 0 0.0 0.0 0 0 00 000000 0 1 1 0 0 0 0 0 L 22-28 11/05 at49ers P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 34-17 11/15 Jaguars P 0 0 0 0.0 0.0 0 0 00 000000 0 2 2 0 0 0 0 0 W 24-20 11/22 atColts P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 31-34+ 2020 TOTALS 4-0 0 0 0 0.0 0.0 0 0 00 000000 0 3 3 0 0 0 0 0 3-7 +-Overtime
2020GREENBAYPACKERS 16 2020 SEASON:Hasappearedinall10games,totaling10tackles (sevensolo),atackleforaloss,aforcedfumble,ateam-leading sixspecialteamstacklesandaforcedfumbleonspecial teams…At Minnesota (Sept. 13):Appearedonthreedefensive snapsand18playsonspecialteams…Vs. Detroit (Sept. 20): Appearedon23playsonspecialteams…At New Orleans (Sept. 27):Played13snapsondefenseand24snapsonspecialteams, recordingtwosolotackles,twospecialteamstacklesandthefirst forcedfumbleofhiscareer.Onakickoffmidwaythroughthefirst quarter,punchedtheballoutfromSaintsKRDeonteHarrisatthe NO23,afumblethatwasrecoveredbyNewOrleans…Vs. Atlanta (Oct. 5):Playedtwosnapsondefenseand18snapsonspecial teams…At Tampa Bay (Oct. 18):Recordedonesolotackleon14 defensivesnapsandonespecialteamstackleon25specialteams snaps…At Houston (Oct. 25):Madetwotackles(onesolo)and forcedafumblewhileplayingfivedefensivesnaps.Alsoplayed 25snapsonspecialteams.Lateinthethirdquarter,jarredthe ballloosewhilebringingdownRBDukeJohnson,afumblethat Houstonrecovered…Vs. Minnesota (Nov. 1):Appearedonnine playsondefenseand17playsonspecialteams…At San Francisco (Nov. 5):Tiedfortheteamleadandsetacareerhigh bypostingfivetackles(threesolo)andatackleforalosson34 defensivesnaps.Alsorecordedaspecialteamstackleon18 specialteamssnaps.Earlyinthethirdquarter,scrapedofftheleft edge to drop RB JaMycal Hasty for a 1-yard loss…Vs. Jacksonville (Nov. 15):Sawactiononfiveplaysondefenseand 25playsonspecialteams…At Indianapolis (Nov. 22):Ledthe teamwithtwospecialteamstackleson26snapsofwork.
OREN BURKS' NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2018 Packers 14 4 16 13 3 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 8 6 2 0 0 0 0 2019 Packers 12 0 8 4 4 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 5 4 1 0 0 0 0 2020 Packers 10 0 10 7 3 1 1 0.0 0.0 0 0 0 0 0 0 1 0 0 6 5 1 1 0 0 0 NFL TOTALS 36 4 34 24 10 1 1 0.0 0.0 0 0 0 0 0 0 1 0 0 19 15 4 1 0 0 0
OREN BURKS' NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 2 0 3 0 3 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 3 2 1 0 0 0 0 NFL TOTALS 2 0 3 0 3 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 3 2 1 0 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 5atSanFrancisco49ers,Nov05,2020 Special Teams Tackles 2atIndianapolisColts,Nov22,2020 4atDetroitLions,Oct07,2018 2atNewOrleansSaints,Sep27,2020 Forced Fumbles 1atHoustonTexans,Oct25,2020 ...3moreat2. Tackles For Loss 1atSanFrancisco49ers,Nov05,2020 Special Teams Forced Fumbles 1atNewOrleansSaints,Sep27,2020
2020GREENBAYPACKERS 17 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints P 2 2 0 0.0 0.0 0 0 00 000000 0 2 2 0 1 0 0 0 W 37-30 10/05 Falcons P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers P 1 1 0 0.0 0.0 0 0 00 000000 0 1 1 0 0 0 0 0 L 10-38 10/25 atTexans P 2 1 1 0.0 0.0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 W 35-20 11/01 Vikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers P 5 3 2 0.0 0.0 1 1 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 W 34-17 11/15 Jaguars P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 24-20 11/22 atColts P 0 0 0 0.0 0.0 0 0 00 000000 0 2 1 1 0 0 0 0 L 31-34+ 2020 TOTALS 10-0 10 7 3 0.0 0.0 1 1 0 0 0 0 0 0 1 0 0 6 5 1 1 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 18 2020 SEASON:Hasstartedallsevengameshehasplayedin, recording22tackles(16solo),asack,atackleforalossandtwo QBhits...Sufferedagroininjuryintheseasonopenerandmissed Weeks2-4...At Minnesota (Sept. 13):Recordedtwotackles(one solo)in15defensivesnapsbeforesufferingagroininjurythat endedhisdaylateinthesecondquarter...Vs. Detroit (Sept. 20): Inactive (groin)...At New Orleans (Sept. 27): Inactive (groin)...Vs. Atlanta (Oct. 5): Inactive(groin)...At Tampa Bay (Oct. 18): Returnedfrominjurytostart,andregisteredfour tackles(twosolo)whileplaying41defensivesnapsandthree playsonspecialteams...At Houston (Oct. 25): Ledthedefensive linewith43defensivesnaps,recordingonesolotackle...Vs. Minnesota (Nov. 1): Sawactionon46of52defensiveplaysand finishedtiedforNo.3ontheteamwithfourtackles(allsolo)...At San Francisco (Nov. 5): Startedandplayedon31defensiveplays (No.2amongPackerDL)andonespecialteamsplay...Vs. Jacksonville (Nov. 15): Ledthedefensivelinewith57snaps played, registering five tackles (three solo)...At Indianapolis (Nov. 22): Postedaseason-bestsixtackles(fivesolo),twoQB hits,atackleforalossandsackedQBPhilipRiversforalossof8 yardstoforceathird-and-19thattheColtsdidnotconvertinthe thirdquarter.
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 10/20/16 GBvs.CHI W P 4 3 1 0.0 0 0 1 0 0 0 0 0 9/28/17 GBvs.CHI WS 3 1 2 0.0 0 0 0 0 0 0 0 0 11/12/17 GB@CHI WS 3 1 2 0.0 0 0 1 0 0 0 0 0 9/9/18 GBvs.CHI WS 3 2 1 0.0 0 0 0 0 1 0 0 1 9/5/19 GB@CHI WS 8 3 5 0.5 0 0 1 0 0 0 0 0 12/15/19 GBvs.CHI WS 6 6 0 2.0 9 0 3 0 2 0 0 0 TOTALS 6/0 6/5 27 16 11 2.5 9 0 6 0 3 0 0 1
KENNY CLARK'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2016 Packers 16 2 33 14 19 1 1 0.0 0.0 2 0 0 0 0 2 0 2 2 0 0 0 0 0 0 0 2017 Packers 15 15 78 39 39 6 24 4.5 26.5 6 0 0 0 0 1 2 0 0 0 0 0 0 0 0 0 2018 Packers 13 13 73 46 27 11 48 6.0 43.0 9 0 0 0 0 3 1 2 0 0 0 0 0 0 0 0 2019 Packers 16 16 89 52 37 11 34 6.0 36.5 28 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 2020 Packers 7 7 22 16 6 1 8 1.0 8.0 2 0 000000 00000000 NFL TOTALS 67 53 295 167 128 30 115 17.5 114.0 47 0 0 0 0 6 4 4 2 0 0 0 0 0 0 0
KENNY CLARK'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2016 Packers 3 0 9 5 4 1 2 0.0 0.0 00 000000 00000000 2019 Packers 2 2 7 5 2 1 2 1.0 2.0 3 0 000000 00000000 NFL TOTALS 5 2 16 10 6 2 4 1.0 2.0 3 0 000000 00000000
2020GREENBAYPACKERS 19 SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 10atWashington,Sep23,2018 Forced Fumbles 1vs.MinnesotaVikings,Sep15,2019 10atMinnesotaVikings,Oct15,2017 1vs.BuffaloBills,Sep30,2018 Sacks 2.0vs.ChicagoBears,Dec15,2019 ...2moreat1. 2.0atLosAngelesRams,Oct28,2018 Fumble Recoveries 1vs.BuffaloBills,Sep30,2018 ...1moreat2.0. 1vs.ChicagoBears,Sep09,2018 Passes Defensed 1vs.ArizonaCardinals,Dec02,2018 ...2moreat1. 1atWashington,Sep23,2018 Tackles For Loss 4atLosAngelesRams,Oct28,2018 ...4moreat1. 3vs.ChicagoBears,Dec15,2019 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings S 2 1 1 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions GAMEINACTIVE/INJURY W 42-21 09/27 atSaints GAMEINACTIVE/INJURY W 37-30 10/05 Falcons GAMEINACTIVE/INJURY W 30-16 10/18 atBuccaneers S 4 2 2 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans S 1 1 0 0.0 0.0 0 0 00 000000 00000000 W 35-20 11/01 Vikings S 4 4 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers S 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 34-17 11/15 Jaguars S 5 3 2 0.0 0.0 0 0 00 000000 00000000 W 24-20 11/22 atColts S 6 5 1 1.0 8.0 1 8 2 0 000000 00000000 L 31-34+ 2020 TOTALS 7-7 22 16 6 1.0 8.0 1 8 2 0 000000 00000000 7-3 +-Overtime
2020GREENBAYPACKERS 20 2020 SEASON:Hasplayedinall10gamesandhasconvertedall 13field-goalattemptsand35of36extra-pointattempts…Has recordedtouchbackson33of45kickoffs(73.3pct.)…Oneof onlytwokickersintheNFL(JasonMyers)tomakealloftheirFG attemptsthisseason(min.10attempts)…At Minnesota (Sept. 13):Connectedonbothofhisfield-goalattempts(31,43)andall fiveofhisextra-pointtries.His11pointstiedDetroitKMatt PraterforfirstamongallNFLkickersinWeek1.Posted touchbacksonsixofhiseightkickoffs…Vs. Detroit (Sept. 20): Wastrueontwofield-goalattempts(43,35)andfourextrapoints whilerecordingtouchbacksonsevenofeightkickoffs…At New Orleans (Sept. 27):Convertedallthreefield-goalattempts(52, 33,49)andallfourextra-pointattemptstogoalongwithfive touchbacksoneightkickoffs.BecamethefirstPackersince1950 toscore10-pluspointsineachofthefirstthreegamesofthe season…Vs. Atlanta (Oct. 5):Madehislonefieldgoalattempt,a 48-yarderinthefourthquarter,andthreeofhisfourextra-point attempts.Alsorecordedfourtouchbacksonsixkickoffs…At Tampa Bay (Oct. 18):Kickeda39-yardfieldgoalandanextra pointwhilerecordingtwotouchbacksonthreekickoffs…At Houston (Oct. 25):Wastrueonallfiveextra-pointattemptswhile recordingtouchbacksonallsixkickoffs…Vs. Minnesota (Nov. 1):Convertedbothofhisextrapointattemptsbutdidnothandle kickoffdutiesashebattledinjuriestohiscalfandback…At San Francisco (Nov. 5):Convertedallfourextra-pointattemptsand bothfieldgoals,includingaseason-long53-yardermidway throughthefourthquarter…Vs. Jacksonville (Nov. 15):Was perfectontheday,convertinga39-yardfieldgoalattemptand threeextrapointsdespitewindyconditionsatLambeauField…At Indianapolis (Nov. 22):Madeallfourofhisextrapointattempts andkickeda26-yardfieldgoalwiththreesecondsleftin regulationtosendthegametoovertime.Handledkickoffduties forthefirsttimesinceWeek7atHouston,notchingthree touchbacksonsixkickoffs.
REGULAR SEASON COMPARISON: KICKING - CHICAGO BEARS DATE OPP W/L GP/GS FGA FGM PCT LONG XPA XPM PTS 1-19 20-29 30-39 40-49 50+ KO TB 10/7/07 GBvs.CHI L P 2 2 100% 37 2 2 8 0-0 0-0 1-1 0-0 0-0 5 0 11/16/08 GBvs.CHI WP 3 3 100% 53 4 4 13 0-0 0-0 0-0 0-0 1-1 8 0 12/22/08 GB@CHI LP 1 3 33.3% 28 2 2 5 0-0 0-0 0-0 0-1 0-0 5 0 9/13/09 GBvs.CHI WP 2 3 66.7% 52 1 1 7 0-0 0-0 0-0 0-1 0-0 5 1 12/13/09 GB@CHI WP 2 3 66.7% 33 1 1 7 0-0 0-0 1-1 0-0 0-0 5 0 9/27/10 GB@CHI LP 1 2 50% 38 2 2 5 0-0 0-0 1-1 0-0 0-0 4 0 1/2/11 GBvs.CHI WP 1 1 100% 23 1 1 4 0-0 1-1 0-0 0-0 0-0 3 1 9/25/11 GB@CHI WP 2 2 100% 37 3 3 9 0-0 0-0 1-1 0-0 0-0 6 3 9/13/12 GBvs.CHI WP 3 3 100% 54 2 2 11 0-0 0-0 0-0 0-0 1-1 5 3 12/16/12 GB@CHI WP 0 2 0% 0 3 3 3 0-0 0-0 0-0 0-1 0-0 4 2 11/4/13 GBvs.CHI LP 2 2 100% 30 2 2 8 0-0 0-0 1-1 0-0 0-0 5 0 12/29/13 GB@CHI WP 2 2 100% 33 3 3 9 0-0 0-0 1-1 0-0 0-0 7 0 9/28/14 GB@CHI WP 1 2 50% 53 5 5 8 0-0 0-0 0-1 0-0 0-0 7 5 11/9/14 GBvs.CHI WP 2 2 100% 52 7 7 13 0-0 0-0 0-0 0-0 1-1 10 0 9/13/15 GB@CHI WP 1 1 100% 37 4 4 7 0-0 0-0 1-1 0-0 0-0 6 3 11/26/15 GBvs.CHI LP 2 2 100% 50 1 1 7 0-0 0-0 0-0 0-0 1-1 3 2 10/20/16 GBvs.CHI WP 2 3 66.7% 40 3 2 8 0-0 0-0 1-1 0-0 0-0 6 4 12/18/16 GB@CHI WP 3 3 100% 34 3 3 12 0-0 0-0 1-1 0-0 0-0 6 2 11/12/17 GB@CHI WP 3 4 75% 50 2 2 11 0-0 0-0 0-0 0-0 1-1 6 0 9/9/18 GBvs.CHI WP 1 1 100% 42 3 3 6 0-0 0-0 0-0 1-1 0-0 5 4 12/16/18 GB@CHI LP 3 3 100% 45 0 0 0 0-0 0-0 0-0 1-1 0-0 5 1 9/5/19 GB@CHI WP 1 1 100% 39 1 1 4 0-0 0-0 1-1 0-0 0-0 3 3 12/23/07 GB@CHI LP 0 0 0% 0 1 1 1 0-0 0-0 0-0 0-0 0-0 2 1 12/25/11 GBvs.CHI WP 0 0 0% 0 5 5 5 0-0 0-0 0-0 0-0 0-0 6 1 9/28/17 GBvs.CHI WP 0 0 0% 0 5 5 5 0-0 0-0 0-0 0-0 0-0 6 4 12/15/19 GBvs.CHI WP 0 0 0% 0 3 3 3 0-0 0-0 0-0 0-0 0-0 4 2 TOTALS 19/7 26/0 40 50 125% 54 69 68 179 0-0 1-1 10-11 2-5 5-5 137 42
2020GREENBAYPACKERS 21 POSTSEASON COMPARISON: KICKING - CHICAGO BEARS DATE OPP W/L GP/GS FGA FGM PCT LONG XPA XPM PTS 1-19 20-29 30-39 40-49 50+ KO TB 1/23/11 GB@CHI W P 0 0 0% 0 3 3 3 0-0 0-0 0-0 0-0 0-0 4 0 TOTALS 1/0 1/0 0 0 0% 0 3 3 3 0-0 0-0 0-0 0-0 0-0 4 0
MASON CROSBY'S NFL REGULAR SEASON KICKING STATISTICS
DATE TEAM GP FGM FGA PCT. LG XP XPA PCT. BLK PTS 2007 Packers 16 31 39 79.5 53 48 48 100.0 1 141 2008 Packers 16 27 34 79.4 53 46 46 100.0 2 127 2009 Packers 16 27 36 75.0 52 48 49 98.0 0 129 2010 Packers 16 22 28 78.6 56 46 46 100.0 2 112 2011 Packers 16 24 28 85.7 58 68 69 98.6 0 140 2012 Packers 16 21 33 63.6 54 50 50 100.0 0 113 2013 Packers 16 33 37 89.2 57 42 42 100.0 0 141 2014 Packers 16 27 33 81.8 55 53 55 96.4 3 134 2015 Packers 16 24 28 85.7 56 36 36 100.0 1 108 2016 Packers 16 26 30 86.7 53 44 47 93.6 1 122 2017 Packers 16 15 19 78.9 50 33 35 94.3 1 78 2018 Packers 16 30 37 81.1 53 34 36 94.4 0 124 2019 Packers 16 22 24 91.7 54 40 41 97.6 0 106 2020 Packers 10 13 13 100.0 53 35 36 97.2 0 74 NFL TOTALS 218 342 419 81.6 58 623 636 98.0 11 1,649
MASON CROSBY'S NFL POSTSEASON KICKING STATISTICS
DATE TEAM GP FGM FGA PCT. LG XP XPA PCT. BLK PTS 2007 Packers 2 2 2 100.0 37 8 8 100.0 0 14 2009 Packers 1 1 2 50.0 20 6 6 100.0 0 9 2010 Packers 4 3 4 75.0 43 16 16 100.0 0 25 2011 Packers 1 2 2 100.0 47 2 2 100.0 0 8 2012 Packers 2 2 2 100.0 31 7 7 100.0 0 13 2013 Packers 1 2 2 100.0 34 2 2 100.0 0 8 2014 Packers 2 7 7 100.0 48 3 3 100.0 0 24 2015 Packers 2 4 4 100.0 43 5 5 100.0 0 17 2016 Packers 3 3 4 75.0 56 10 10 100.0 0 19 2019 Packers 2 0 0 0.0 0 6 6 100.0 0 6 NFL TOTALS 20 26 29 89.7 56 65 65 100.0 0 143
MASON CROSBY'S NFL REGULAR SEASON FIELD-GOAL ACCURACY STATISTICS
DATE TEAM 1-19 PCT. 20-29 PCT. 30-39 PCT. 40-49 PCT. 50+ PCT. 2007 Packers 1-1 100.0 8-8 100.0 10-11 90.9 9-14 64.3 3-5 60.0 2008 Packers 1-1 100.0 8-8 100.0 10-13 76.9 5-6 83.3 3-6 50.0 2009 Packers 1-1 100.0 13-13 100.0 7-9 77.8 4-7 57.1 2-6 33.3 2010 Packers 1-1 100.0 7-8 87.5 4-5 80.0 8-10 80.0 2-4 50.0 2011 Packers 1-1 100.0 4-5 80.0 14-14 100.0 3-5 60.0 2-3 66.7 2012 Packers 0-0 0.0 5-5 100.0 5-7 71.4 9-12 75.0 2-9 22.2 2013 Packers 1-1 100.0 13-13 100.0 8-8 100.0 6-8 75.0 5-7 71.4 2014 Packers 0-0 0.0 7-7 100.0 11-12 91.7 5-7 71.4 4-7 57.1 2015 Packers 1-1 100.0 7-7 100.0 4-4 100.0 8-11 72.7 4-5 80.0 2016 Packers 1-1 100.0 6-6 100.0 13-15 86.7 5-6 83.3 1-2 50.0 2017 Packers 0-0 0.0 8-8 100.0 2-4 50.0 4-4 100.0 1-3 33.3 2018 Packers 0-0 0.0 4-4 100.0 10-11 90.9 11-15 73.3 5-7 71.4 2019 Packers 1-1 100.0 2-2 100.0 11-11 100.0 7-8 87.5 1-2 50.0 2020 Packers 1-1 100.0 1-1 100.0 5-5 100.0 4-4 100.0 2-2 100.0 NFL TOTALS 10-10 100.0 93-95 97.9 114-129 88.4 88-117 75.2 37-68 54.4
2020GREENBAYPACKERS 22 MASON CROSBY'S NFL POSTSEASON FIELD-GOAL ACCURACY STATISTICS
DATE TEAM 1-19 PCT. 20-29 PCT. 30-39 PCT. 40-49 PCT. 50+ PCT. 2007 Packers 0-0 0.0 0-0 0.0 2-2 100.0 0-0 0.0 0-0 0.0 2009 Packers 0-0 0.0 1-1 100.0 0-0 0.0 0-0 0.0 0-1 0.0 2010 Packers 0-0 0.0 1-1 100.0 1-1 100.0 1-1 100.0 0-1 0.0 2011 Packers 0-0 0.0 0-0 0.0 1-1 100.0 1-1 100.0 0-0 0.0 2012 Packers 0-0 0.0 1-1 100.0 1-1 100.0 0-0 0.0 0-0 0.0 2013 Packers 0-0 0.0 1-1 100.0 1-1 100.0 0-0 0.0 0-0 0.0 2014 Packers 2-2 100.0 0-0 0.0 1-1 100.0 4-4 100.0 0-0 0.0 2015 Packers 0-0 0.0 2-2 100.0 1-1 100.0 1-1 100.0 0-0 0.0 2016 Packers 0-0 0.0 0-0 0.0 1-1 100.0 0-1 0.0 2-2 100.0 2019 Packers 0-0 0.0 0-0 0.0 0-0 0.0 0-0 0.0 0-0 0.0 NFL TOTALS 2-2 100.0 6-6 100.0 9-9 100.0 7-8 87.5 2-4 50.0
SINGLE-GAME HIGHS: KICKER Field Goals Made 5vs.MinnesotaVikings,Sep16,2018 PAT Attempts 7vs.ChicagoBears,Nov09,2014 5atMinnesotaVikings,Nov22,2015 7vs.TennesseeTitans,Dec23,2012 ...1moreat5. ...1moreat7. Field Goal Attempts 6vs.MinnesotaVikings,Sep16,2018 Points 17vs.MinnesotaVikings,Sep16,2018 5atDetroitLions,Oct07,2018 16atMinnesotaVikings,Nov22,2015 ...5moreat5. ...2moreat16. Longest Field Goals Made 58atMinnesotaVikings,Oct23,2011 Special Teams Tackles 2atDallasCowboys,Nov29,2007 57atDallasCowboys,Dec15,2013 1atDallasCowboys,Oct06,2019 ...1moreat57. ...23moreat1. PATs Made 7vs.ChicagoBears,Nov09,2014 7vs.TennesseeTitans,Dec23,2012 ...1moreat7. 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) FIELD GOALS EXTRA POINTS DATE OPPONENT FGM FGA PCT LG XP XPA PCT BLK PTS W/L SCORE 09/13 atVikings P 2 2 100.0 43 5 5 100.0 0 11 W 43-34 09/20 Lions P 2 2 100.0 43 4 4 100.0 0 10 W 42-21 09/27 atSaints P 3 3 100.0 52 4 4 100.0 0 13 W 37-30 10/05 Falcons P 1 1 100.0 48 3 4 75.0 0 6 W 30-16 10/18 atBuccaneers P 1 1 100.0 39 1 1 100.0 0 4 L 10-38 10/25 atTexans P 0 0 0.0 0 5 5 100.0 0 5 W 35-20 11/01 Vikings P 0 0 0.0 0 2 2 100.0 0 2 L 22-28 11/05 at49ers P 2 2 100.0 53 4 4 100.0 0 10 W 34-17 11/15 Jaguars P 1 1 100.0 39 3 3 100.0 0 6 W 24-20 11/22 atColts P 1 1 100.0 26 4 4 100.0 0 7 L 31-34+ 2020 TOTALS 10 13 13 100.0 53 35 36 97.2 0 74 7-3 +-Overtime
2020GREENBAYPACKERS 23 2020 SEASON: Playedintwogamesandhadonereceptionfor12 yards..PlacedoninjuredreserveonOct.13…At Minnesota (Sept. 13):Startedandplayed24snapsinhisNFLdebutasthe Packersopenedthegamewithtwotightends.Becamejustthe secondrookieGreenBayTEsincethe1970AFL-NFLmergerto startintheseasonopener(RichardRodgers,2014).Helped springWRAllenLazardfora19-yardrunlateinthefirstquarter, takingoutCBMikeHughesandSAnthonyHarriswithablock. Postedhisfirstcareercatchmidwaythroughthesecondquarter whenhehauledina12-yarderfromQBAaronRodgers…Vs. Detroit (Sept. 20):Inactive(ankle/shin)…At New Orleans (Sept. 27):Inactive(ankle)…Vs. Atlanta (Oct. 5):Playedsevensnaps onoffenseandoneonspecialteams,butdepartedlateinthe fourthquarterwithasignificantkneeinjury.
JOSIAH DEGUARA'S NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2020 Packers 2 1 1 12 12.0 12 0 0 0 0.0 0 0 NFL TOTALS 2 1 1 12 12.0 12 0 0 0 0.0 0 0
JOSIAH DEGUARA'S NFL REGULAR SEASON RETURN STATISTICS
KICKOFF RETURNS PUNT RETURNS DATE TEAM RET. YDS. AVG. LG TD NO. FC YDS. AVG. LG TD 2020 Packers 0 0 0.0 0 0 0 0 0 0.0 0 0 NFL TOTALS 0 0 0.0 0 0 0 0 0 0.0 0 0
SINGLE-GAME HIGHS: RUSHING/RECEIVING Receptions 1atMinnesotaVikings,Sep13,2020 Longest Receptions 12atMinnesotaVikings,Sep13,2020 Receiving Yards 12atMinnesotaVikings,Sep13,2020 All-purpose yards 12atMinnesotaVikings,Sep13,2020 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RECEIVING RUSHING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings S 1 12 12.0 12 0 0 0 0.0 0 0 W 43-34 09/20 Lions GAMEINACTIVE/INJURY W 42-21 09/27 atSaints GAMEINACTIVE/INJURY W 37-30 10/05 Falcons P 0 0 0.0 0 0 0 0 0.0 0 0 W 30-16 10/18 atBuccaneers INJUREDRESERVE L 10-38 10/25 atTexans INJUREDRESERVE W 35-20 11/01 Vikings INJUREDRESERVE L 22-28 11/05 at49ers INJUREDRESERVE W 34-17 11/15 Jaguars INJUREDRESERVE W 24-20 11/22 atColts INJUREDRESERVE L 31-34+ 2020 TOTALS 2-1 1 12 12.0 12 0 0 0 0.0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 24 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) KICKOFF RETURNS PUNT RETURNS DATE OPPONENT P/S RET YDS AVG LG TD NO FC YDS AVG LG TD W/L SCORE 09/13 atVikings S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 43-34 09/20 Lions GAMEINACTIVE/INJURY W 42-21 09/27 atSaints GAMEINACTIVE/INJURY W 37-30 10/05 Falcons P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 30-16 10/18 atBuccaneers INJUREDRESERVE L 10-38 10/25 atTexans INJUREDRESERVE W 35-20 11/01 Vikings INJUREDRESERVE L 22-28 11/05 at49ers INJUREDRESERVE W 34-17 11/15 Jaguars INJUREDRESERVE W 24-20 11/22 atColts INJUREDRESERVE L 31-34+ 2020 TOTALS 2-1 0 0 0.0 0 0 0 0 0 0.0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 25 PlacedoninjuredreserveonSept.7,2020...Re-signedbyGreen Wolverines’6-yardlineandsetupaBuffaloTD…Postedtwo BayonJan.21,2020…Spenthisentirerookieseasonin2019on receptionsfor38yards(19.0avg.)vs.Utah(Nov.26)inhislone thePackers’practicesquad…WasreleasedbyGreenBayonAug. start…Totaled59receptionsfor885yards(15.0avg.)and10 31 and signed to the Packers’ practice squad on Sept. TDsintwoseasonsplayingatEastCentral(Miss.)Community 1…Originallysignedwiththeteamasanundraftedfreeagenton College…Posted38receptionsfor607yards(16.0avg.)and May3,2019…Awidereceiverincollege,heplayedin26games eightTDsasasophomorein2015,earninghimfirst-teamSouth withtwostartsatColoradofrom2016-18andtotaled20 all-statehonorsfromtheMississippiAssociationofCommunity receptions for 335 yards (16.8 avg.) and two andJuniorCollegesandfirst-teamhonorsontheNationalJunior touchdowns…BeganhiscollegiatecareeratEastCentral(Miss.) CollegeAthleticAssociationAll-Region23Team…Hauledinfive Community College, where he played for two seasons receptionsfor132yards(26.4avg.)andaTDinawinvs. (2014-15)…Appearedinall12gameswithonestartasaredshirt Coahoma(Sept.3)…Talliedeightcatchesfor88yards(11.0avg.) seniorin2018fortheBuffaloes,posting12receptionsfor161 andtwoTDsthefollowingweekatMississippiGulfCoast(Sept. yards(13.4avg.)andfivespecialteamstackles…Earnedthe 10)…Recordedsixreceptionsfor106yards(17.7avg.)andtwo TDsvs.Hinds(Oct.1)…Asafreshmanin2014,posted21 DerekSingletonAward,anaccoladegivenbytheColorado receptionsfor278yards(13.2avg.)andtwoTDs…Graduated coachingstafftotheplayerwhoshowsthemostspirit,dedication fromColoradowithadegreeinsociologyandaminorinethnic andenthusiasm…Registeredseasonhighswithfivereceptions studies…Earned an associate degree from East Central in for82yards(16.4avg.)atArizona(Nov.2)…Talliedtwocatches December2015…AttendedDollarwayHighSchoolinPineBluff, for10yards(5.0avg.)vs.Utah(Nov.17)inhislone Ark.,wherehewasanall-stateperformerinfootball,basketball start…Hauledinaseason-long26-yardreceptionatCalifornia andtrack…Infootball,wasnamedthedefensiveplayerofthe (Nov.24)intheseasonfinale…Redshirtedin2017andwas yearintheSoutheastArkansasregionin2013afterpostingeight awardedtheFredCasottiAwardforthemostimprovedoffensive INTswithtworeturnedforTDsand23passesdefensedasa backduringspringpracticesbythecoaches…Playedinall14 CB…OnoffenseasaWR,hauledin30receptionsfor650yards gameswithonestartasajuniorin2016,totalingeightreceptions (21.7avg.)and12TDs…Helpedtheteamfinishasa4Astate for174yards(21.8avg.)andtwoTDsandatackleonspecial semifinalistwitha13-1record…Alsoplacedsecondinthestate teams...ScoredoneachofhisfirsttworeceptionsasaBuffalo,a inthehighjumpasasenior…Twinbrother,Kamaree,played career-long69-yardTDinthesecondquarteranda19-yardTDin linebacker at Arkansas-Pine Bluff…Has a daughter, thethirdquartervs.IdahoState(Sept.10)…Caughta16-yard A’Kyre…Namepronouncedkay-be-onN-toe…LivesinPineBluff, passatMichigan(Sept.17)thatmovedColoradotothe Ark.…GivennameKabionJaquellEnto;borninPineBluff,Ark.
2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings INJUREDRESERVE W 43-34 09/20 Lions INJUREDRESERVE W 42-21 09/27 atSaints INJUREDRESERVE W 37-30 10/05 Falcons INJUREDRESERVE W 30-16 10/18 atBuccaneers INJUREDRESERVE L 10-38 10/25 atTexans INJUREDRESERVE W 35-20 11/01 Vikings INJUREDRESERVE L 22-28 11/05 at49ers INJUREDRESERVE W 34-17 11/15 Jaguars INJUREDRESERVE W 24-20 11/22 atColts INJUREDRESERVE L 31-34+ 2020 TOTALS 0 0 0 0.0 0.0 0 0 00 000000 00000000 7-3 +-Overtime
2020GREENBAYPACKERS 26 carries(12.7avg.),highlightedbyacareer-long21-yardrunearly thefourthquartertotheMinnesota46.Alsohada6-yard reception,akickoffreturnfor18yardsandapuntreturnforzero yards…Vs. Detroit (Sept. 20):Recordeda4-yardcatchandtwo kickoffreturnsfor34yards(17.0avg.)beforedepartingthegame inthefourthquarter(concussionevaluation)…At New Orleans (Sept. 27):Hada5-yardcarry,tworeceptionsfor8yards(4.0 avg.)andtwokickoffreturnsfor30yards(15.0avg.)…Vs. Atlanta (Oct. 5):Postedan8-yardreception,an11-yardpunt return and two kickoff returns for 54 yards (27.0 avg.), highlighted by a season-long 34-yard return in the third quarter…At Tampa Bay (Oct. 18):Inactive(wrist)…At Houston (Oct. 25):Inactive(wrist)…Vs. Minnesota (Nov. 1):Posteda7- yardreceptionandreturnedonepuntfor9yards…At San Francisco (Nov. 5): Posted a career-best 72 yards from scrimmage,haulinginfourpassesforacareer-high48yards (12.0avg.)witheightcarriesfor24yards(3.0avg.).Withjust overfiveminutesremaininginthethirdquarter,pickedup24 yardsonascreenpassfromRodgers,thelongestreceptionofhis career…Vs. Jacksonville (Nov. 15):Posteda3-yardreception andreturnedonekickofffor5yards,butdepartedthegamedue toinjury(ribs)inthesecondquarteranddidnotreturn…At Indianapolis (Nov. 22): Inactive(ribs). 2020 SEASON: Hasappearedinsevengamesandhas67rushing yardson12carries(5.6avg.)and11receptionsfor84yards(7.6 avg.)…Hasreturnedfourpuntsfor20yards(5.0avg.)withseven faircatchesandeightkickoffsfor141yards(17.6avg.)…Has beeninactiveforthreecontestsduetoinjury…At Minnesota (Sept. 13):Postedacareer-high38rushingyardsonjustthree
REGULAR SEASON COMPARISON: RECEIVING - CHICAGO BEARS DATE OPP W/L GP/GS REC YDS. AVG. TD LG TGTS YAC 9/11/16 HSTvs.CHI W P 1 5 5.0 0 5 2 1 TOTALS 1/0 1/0 1 5 5.0 0 5 2 1
REGULAR SEASON COMPARISON: RUSHING - CHICAGO BEARS DATE OPP W/L GP/GS CAR YDS. AVG. TD LG 9/11/16 HSTvs.CHI W P 1 3 3.0 0 3 TOTALS 1/0 1/0 1 3 3.0 0 3
REGULAR SEASON COMPARISON: KICK RETURNS - CHICAGO BEARS DATE OPP W/L GP/GS NO. YDS. AVG. LG TD 9/11/16 HSTvs.CHI W P 3 73 24.3 28 0 12/15/19 GBvs.CHI WP 2 71 35.5 45 0 TOTALS 2/0 2/0 5 144 28.8 45 0
REGULAR SEASON COMPARISON: PUNT RETURNS - CHICAGO BEARS DATE OPP W/L GP/GS NO. YDS. AVG. LG TD 9/11/16 HSTvs.CHI W P 3 29 9.7 13 0 12/15/19 GBvs.CHI WP 1 12 12.0 12 0 TOTALS 2/0 2/0 4 41 10.3 13 0
2020GREENBAYPACKERS 27 TYLER ERVIN'S NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RUSHING RECEIVING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2016 Texans 12 0 1 3 3.0 3 0 3 18 6.0 9 0 2017 Texans 4 0 4 12 3.0 6 0 8 38 4.8 7 0 2018 Texans 9 0 0 0 0.0 0 0 3 35 11.7 19 0 2019 Jaguars 6 0 0 0 0.0 0 0 0 0 0.0 0 0 2019 Packers 4 0 1 10 10.0 10 0 2 11 5.5 6 0 2019 TOTAL 10 0 1 10 10.0 10 0 2 11 5.5 6 0 2020 Packers 7 0 13 67 5.2 21 0 11 84 7.6 24 0 NFL TOTALS 42 0 19 92 4.8 21 0 27 186 6.9 24 0
TYLER ERVIN'S NFL POSTSEASON RUSHING/RECEIVING STATISTICS
RUSHING RECEIVING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2016 Texans 2 0 0 0 0.0 0 0 0 0 0.0 0 0 2019 Packers 2 0 2 25 12.5 18 0 1 7 7.0 7 0 NFL TOTALS 4 0 2 25 12.5 18 0 1 7 7.0 7 0
TYLER ERVIN'S NFL REGULAR SEASON RETURN STATISTICS
KICKOFF RETURNS PUNT RETURNS DATE TEAM RET. YDS. AVG. LG TD NO. FC YDS. AVG. LG TD 2016 Texans 14 263 18.8 33 0 27 23 261 9.7 57 0 2017 Texans 5 93 18.6 24 0 8 4 60 7.5 21 0 2018 Texans 10 253 25.3 36 0 21 7 175 8.3 27 0 2019 Jaguars 5 107 21.4 25 0 5 0 9 1.8 6 0 2019 Packers 6 160 26.7 45 0 11 10 106 9.6 18 0 2019 TOTAL 11 267 24.3 45 0 16 10 115 7.2 18 0 2020 Packers 8 141 17.6 34 0 4 7 20 5.0 11 0 NFL TOTALS 48 1,017 21.2 45 0 76 51 631 8.3 57 0
TYLER ERVIN'S NFL POSTSEASON RETURN STATISTICS
KICKOFF RETURNS PUNT RETURNS DATE TEAM RET. YDS. AVG. LG TD NO. FC YDS. AVG. LG TD 2016 Texans 1 14 14.0 14 0 4 2 23 5.8 16 0 2019 Packers 3 41 13.7 23 0 1 3 6 6.0 6 0 NFL TOTALS 4 55 13.8 23 0 5 5 29 5.8 16 0
SINGLE-GAME HIGHS: RUSHING/RECEIVING Rush Attempts 8atSanFrancisco49ers,Nov05,2020 Kickoff Return Yards 156atNewEnglandPatriots,Sep09,2018 3atMinnesotaVikings,Sep13,2020 89atDetroitLions,Dec29,2019 ...1moreat3. Longest Kickoff Return 45vs.ChicagoBears,Dec15,2019 Rushing Yards 38atMinnesotaVikings,Sep13,2020 36atNewEnglandPatriots,Sep09,2018 24atSanFrancisco49ers,Nov05,2020 Fair Catches 5atNewEnglandPatriots,Sep22,2016 Longest Runs 21atMinnesotaVikings,Sep13,2020 4atMinnesotaVikings,Dec23,2019 12atMinnesotaVikings,Sep13,2020 ...2moreat4. Receptions 4atSanFrancisco49ers,Nov05,2020 Punt Return Yards 57atJacksonvilleJaguars,Nov13,2016 4vs.JacksonvilleJaguars,Sep10,2017 51vs.Washington,Dec08,2019 Receiving Yards 48atSanFrancisco49ers,Nov05,2020 Longest Punt Return 57atJacksonvilleJaguars,Nov13,2016 19atJacksonvilleJaguars,Oct21,2018 27vs.NewYorkGiants,Sep23,2018 Longest Receptions 24atSanFrancisco49ers,Nov05,2020 Punt Returns 4atMinnesotaVikings,Dec23,2019 19atJacksonvilleJaguars,Oct21,2018 4vs.Washington,Dec08,2019 All-purpose yards 188atNewEnglandPatriots,Sep09,2018 ...4moreat4. 121atDetroitLions,Dec29,2019 Special Teams Tackles 1atNewEnglandPatriots,Sep24,2017 Kickoff Returns 5atNewEnglandPatriots,Sep09,2018 1atJacksonvilleJaguars,Nov13,2016 4atDetroitLions,Dec29,2019 ...3moreat1. Miscellaneous Tackles 1atMinnesotaVikings,Dec23,2019
2020GREENBAYPACKERS 28 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RUSHING RECEIVING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings P 3 38 12.7 21 0 1 6 6.0 6 0 W 43-34 09/20 Lions P 0 0 0.0 0 0 1 4 4.0 4 0 W 42-21 09/27 atSaints P 1 5 5.0 5 0 2 8 4.0 5 0 W 37-30 10/05 Falcons P 0 0 0.0 0 0 1 8 8.0 8 0 W 30-16 10/18 atBuccaneers GAMEINACTIVE/INJURY L 10-38 10/25 atTexans GAMEINACTIVE/INJURY W 35-20 11/01 Vikings P 0 0 0.0 0 0 1 7 7.0 7 0 L 22-28 11/05 at49ers P 8 24 3.0 8 0 4 48 12.0 24 0 W 34-17 11/15 Jaguars P 1 0 0.0 0 0 1 3 3.0 3 0 W 24-20 11/22 atColts GAMEINACTIVE/INJURY L 31-34+ 2020 TOTALS 7-0 13 67 5.2 21 0 11 84 7.6 24 0 7-3 +-Overtime
2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) KICKOFF RETURNS PUNT RETURNS DATE OPPONENT P/S RET YDS AVG LG TD NO FC YDS AVG LG TD W/L SCORE 09/13 atVikings P 1 18 18.0 18 0 1 1 0 0.0 0 0 W 43-34 09/20 Lions P 2 34 17.0 19 0 1 2 0 0.0 0 0 W 42-21 09/27 atSaints P 2 30 15.0 17 0 0 3 0 0.0 0 0 W 37-30 10/05 Falcons P 2 54 27.0 34 0 1 1 11 11.0 11 0 W 30-16 10/18 atBuccaneers GAMEINACTIVE/INJURY L 10-38 10/25 atTexans GAMEINACTIVE/INJURY W 35-20 11/01 Vikings P 0 0 0.0 0 0 1 0 9 9.0 9 0 L 22-28 11/05 at49ers P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 34-17 11/15 Jaguars P 1 5 5.0 5 0 0 0 0 0.0 0 0 W 24-20 11/22 atColts GAMEINACTIVE/INJURY L 31-34+ 2020 TOTALS 7-0 8 141 17.6 34 0 4 7 20 5.0 11 0 7-3 +-Overtime
2020GREENBAYPACKERS 29 2020 SEASON:Hasplayedineightcontests,seeingtimeon defenseandspecialteams...At Minnesota (Sept. 13):Playedin hisfirstNFLgame,seeingactionondefense(sixsnaps)and specialteams(twosnaps)...Vs. Detroit (Sept. 20):Sawactionfor twosnapsondefense...At New Orleans (Sept. 27): Dueto injuries,sawincreasedactionondefense,playingin16snaps whilealsoseeingactionononeplayonspecialteams.Recorded firstcareersolotackleondefense...Vs. Atlanta (Oct. 5): Played onaseason-high24defensivesnaps...At Tampa Bay (Oct. 18): Sawactionon16defensiveplays,registeringacareer-bestthree tackles(twosolo)...At Houston (Oct. 25): Playedsevensnapson defenseandeightonspecialteams...Vs. Minnesota (Nov. 1): Sawactiononfivespecialteamsplaysbutdidnotrecorda statistic...At San Francisco (Nov. 5): Played14defensivesnaps and five on special teams, posting an assisted tackle on defense...Vs. Jacksonville (Nov. 15): Inactive (healthy scratch)...At Indianapolis (Nov. 22): Inactive(healthyscratch).
JONATHAN GARVIN'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2020 Packers 8 0 5 2 3 0 0 0.0 0.0 00 000000 00000000 NFL TOTALS 8 0 5 2 3 0 0 0.0 0.0 00 000000 00000000
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 3atTampaBayBuccaneers,Oct18,2020 1atSanFrancisco49ers,Nov05,2020 ...1moreat1. 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints P 1 1 0 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers P 3 1 2 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 35-20 11/01 Vikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers P 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 34-17 11/15 Jaguars INACTIVE W 24-20 11/22 atColts INACTIVE L 31-34+ 2020 TOTALS 8-0 5 2 3 0.0 0.0 0 0 00 000000 00000000 7-3 +-Overtime
2020GREENBAYPACKERS 30 theteamleadwithtwoQBhits.Inthethirdquarter,pressuredQB MattStaffordonaplaythatresultedinaninterceptionreturned7 yardsforaTD.SackedStaffordinthefourthquartertoforcea third-and-30theLionsdidnotconvertandDetroitpuntedon fourthdown.Withjustoverthreeminutestoplayinthegame, splitasackofStaffordwithLBPrestonSmithtoforceafourth- and-16theLionsdidnotconvert...At New Orleans (Sept. 27): Sufferedanankleinjuryduringthegamethatlimitedhimto18 snapsondefenseandtwoonspecialteams,recordingonetackle ondefense...Vs. Atlanta (Oct. 5): Inactive(ankle)...At Tampa Bay (Oct. 18): Returnedfrominjuryandplayed17snapsondefense, recordingtwotackles(onesolo)andaQBhit,andfoursnapson specialteams...At Houston (Oct. 25): Sawactionon44defensive snapsandthreespecialteamsplays...Vs. Minnesota (Nov. 1): Played28of52defensivesnapsaswellasoneplayonspecial teams...At San Francisco (Nov. 5): Registeredtwotackles(one solo)on24defensivesnapswhilealsoappearingintwoplayson specialteams.Earlyinthefourthquarter,broughtdownWR RichieJamesaftera9-yardgainonthird-and-10attheGB5-yard lineandthenteamedwithLBTySummerstostopQBNick Mullensfornogainonfourth-and-1...Vs. Jacksonville (Nov. 15): Sawthefieldfor31defensivesnaps,recordingtwotackles(both solo),atackleforaloss,aQBhitandasackwhilealsoplaying 2020 SEASON:Hasseenactioninninegameswithonestart, sixsnapsonspecialteams.Withjustoveraminuteandahalfto registering16tackles(ninesolo),sevenQBhits(No.2onthe playinthegameandGBupbyfourandJAXattheGB36-yard team),2.5sacks(No.2ontheteam)andtwotacklesfora line,sackedQBJakeLutonforalossof6yardstoforceathird- loss...MissedWeek4withanankleinjury...At Minnesota (Sept. and-16onadrivethatsawtheJaguarsturntheballoveron 13):Postedtwotackles(onesolo)andtwoQBhitswhileplaying downstwoplayslater...At Indianapolis (Nov. 22): Playedon35 32snapsondefenseandoneonspecialteams.HitQBKirk defensivesnaps,finishingwiththreetackles(twosolo),aQBhit Cousinslateinthesecondquarterandwithjustunder10minutes andapassdefensed.Inthesecondquarter,hitQBPhilipRivers togointhefourthquarter,withbothplaysresultingin rightafterhethrewapassthatwastippedbyDLBillyWinnand incompletions...Vs. Detroit (Sept. 20):Played33snapson pickedoffbyLBChristianKirksey,givingthePackerstheballat defenseandoneonspecialteams,recordingfourtackles(two theIND29-yardline. solo),ateam-high1.5sacks,atackleforalossandwastiedfor
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 9/5/19 GB@CHI W P 0 0 0 0.0 0 0 0 0 1 0 0 0 12/15/19 GBvs.CHI WP 3 3 0 1.0 6 0 1 0 1 0 0 0 TOTALS 2/0 2/0 3 3 0 1.0 6 0 1 0 2 0 0 0
RASHAN GARY'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 16 0 30 14 16 3 16 2.0 13.0 7 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 2020 Packers 9 1 16 9 7 2 16 2.5 18.5 7 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 NFL TOTALS 25 1 46 23 23 5 32 4.5 31.5 14 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0
RASHAN GARY'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 2 0 2 0 2 0 0 0.0 0.0 00 000000 00000000 NFL TOTALS 2 0 2 0 2 0 0 0.0 0.0 00 000000 00000000
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 6vs.DenverBroncos,Sep22,2019 Fumble Recoveries 1vs.DenverBroncos,Sep22,2019 4vs.DetroitLions,Sep20,2020 Tackles For Loss 1vs.JacksonvilleJaguars,Nov15,2020 ...2moreat4. 1vs.DetroitLions,Sep20,2020 Sacks 1.5vs.DetroitLions,Sep20,2020 ...3moreat1. 1.0vs.JacksonvilleJaguars,Nov15,2020 ...2moreat1.0. Passes Defensed 1atIndianapolisColts,Nov22,2020
2020GREENBAYPACKERS 31 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings P 2 1 1 0.0 0.0 0 0 2 0 000000 00000000 W 43-34 09/20 Lions P 4 2 2 1.5 12.5 1 10 2 0 000000 00000000 W 42-21 09/27 atSaints S 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons GAMEINACTIVE/INJURY W 30-16 10/18 atBuccaneers P 2 1 1 0.0 0.0 0 0 1 0 000000 00000000 L 10-38 10/25 atTexans P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 35-20 11/01 Vikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers P 2 1 1 0.0 0.0 0 0 00 000000 00000000 W 34-17 11/15 Jaguars P 2 2 0 1.0 6.0 1 6 1 0 000000 00000000 W 24-20 11/22 atColts P 3 2 1 0.0 0.0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 L 31-34+ 2020 TOTALS 9-1 16 9 7 2.5 18.5 2 16 7 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 32 (oblique)…At Minnesota (Sept. 13):Inactive(quadricep)…Vs. Detroit (Sept. 20):Playedon21snapsondefenseandfour snapsonspecialteamsinhisseasondebut,makingtwotackles (bothsolo)ondefense…At New Orleans (Sept. 27):Sawaction onsixplaysondefenseand12playsonspecialteams,making oneassistedtackleondefense…Vs. Atlanta (Oct. 5):Played50 snapsandregisteredseventackles(foursolo),asack,atacklefor alossandaquarterbackhit.Alsoplayed12snapsonspecial teamsandmadeatackle.With1:55remaininginthesecond quarter,randownQBMattRyanforan11-yardsack…At Tampa Bay (Oct. 18):Recordedtwosolotackleswhileplaying24snaps ondefense.Alsoplayed17snapsonspecialteams…At Houston (Oct. 25):Played34snapsondefense,comingupwithseven totaltackles(fivesolo)whilesettingacareerhighwithtwo passesdefensedbeforeexitingthegamewithanobliqueinjury. Alsorecordedonetackleonsevenspecialteamssnaps…Vs. Minnesota (Nov. 1):Inactive(oblique)…At San Francisco (Nov. 5):Postedonesolotackle,onepassdefensedandhisfirstcareer interceptionwhileplaying27defensivesnaps.Alsorecordedone specialteamstackleon11snaps.Earlyinthesecondquarter, interceptedapassfromQBNickMullensthatwasoriginally tippedatthelineofscrimmagebyLBPrestonSmith,returningit 17yardstotheSanFrancisco38…Vs. Jacksonville (Nov. 15): Recordedthreetackles(allsolo)whilealsopostingapass defensedforthethirdconsecutivegame.Onthird-and-10latein thefourthquarter,brokeupQBJakeLuton’spassforTETyler EiferttoforceapuntandpreservethePackers’lead…At Indianapolis (Nov. 22):Establishedanewcareerhighwitheight 2020 SEASON:Hasplayedineightgamesandhasposted31 tackles(sevensolo),recordinghisfirstcareerforcedfumblein42 tackles(24solo),onesack,onetackleforaloss,onequarterback snapsofactionondefense.OnIndianapolis’firstpossessionof hit,oneforcedfumble,fourpassesdefensedandoneinterception thegame,punchedtheballoutfromTEMoAlie-Coxtonegatea returned for 17 yards…Also has three tackles on special 9-yardgainandforceaturnoveronthird-and-six.Alsoplayed teams…Was inactive in Week 1 (quadricep) and Week 8 ninesnapsonspecialteams.
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 9/5/19 GB@CHI W S 6 4 2 0.0 0 0 0 1 0 0 0 0 TOTALS 1/0 1/1 6 4 2 0.0 0 0 0 1 0 0 0 0
RAVEN GREENE'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2018 Packers 8 0 3 2 1 1 12 1.0 12.0 1 0 0 0 0 1 0 0 0 2 2 0 1 0 0 0 2019 Packers 2 1 7 4 3 0 0 0.0 0.0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 2020 Packers 8 0 31 24 7 1 11 1.0 11.0 1 1 17 17 0 4 1 0 0 3 1 2 0 0 0 0 NFL TOTALS 18 1 41 30 11 2 23 2.0 23.0 2 1 17 17 0 6 1 0 0 5 3 2 1 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 8atIndianapolisColts,Nov22,2020 Interceptions 1atSanFrancisco49ers,Nov05,2020 7atHoustonTexans,Oct25,2020 Interception Return Yards 17atSanFrancisco49ers,Nov05,2020 ...1moreat7. Special Teams Tackles 1atSanFrancisco49ers,Nov05,2020 Sacks 1.0vs.AtlantaFalcons,Oct05,2020 1atHoustonTexans,Oct25,2020 1.0vs.MiamiDolphins,Nov11,2018 ...3moreat1. Passes Defensed 2atHoustonTexans,Oct25,2020 Special Teams Forced Fumbles 1vs.SanFrancisco49ers,Oct15,2018 1vs.JacksonvilleJaguars,Nov15,2020 ...3moreat1. Forced Fumbles 1atIndianapolisColts,Nov22,2020 Tackles For Loss 1vs.AtlantaFalcons,Oct05,2020 1vs.MiamiDolphins,Nov11,2018
2020GREENBAYPACKERS 33 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings GAMEINACTIVE/INJURY W 43-34 09/20 Lions P 2 2 0 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints P 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons P 7 4 3 1.0 11.0 1 11 1 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 W 30-16 10/18 atBuccaneers P 2 2 0 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans P 7 5 2 0.0 0.0 0 0 0 0 0 0 0 2 0 0 0 1 0 1 0 0 0 0 W 35-20 11/01 Vikings GAMEINACTIVE/INJURY L 22-28 11/05 at49ers P 1 1 0 0.0 0.0 0 0 0 1 17 17 0 1 0 0 0 1 0 1 0 0 0 0 W 34-17 11/15 Jaguars P 3 3 0 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 24-20 11/22 atColts P 8 7 1 0.0 0.0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 L 31-34+ 2020 TOTALS 8-0 31 24 7 1.0 11.0 1 11 1 1 17 17 0 4 1 0 0 3 1 2 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 34 onecontest(quadricep)…At Minnesota (Sept. 13):Appearedon 10playsonspecialteams,notchingthefirstassistedspecial teamstackleofhisNFLcareeronkickoffcoverageattheendof thethirdquarter...Vs. Detroit (Sept. 20):Playedonfiveplayson defenseand12onspecialteams…At New Orleans (Sept. 27): Sawactiononninesnapsonspecialteams…Vs. Atlanta (Oct. 5): Played12snapsondefense,recordinghisfirstcareertackleand twopassesdefensed.Lateinthefourthquarter,hitWROlamide Zaccheausasthepassarrivedtoforceanincompletionand recordhisfirstcareerpassdefensed.Onthegame’sfinalplay, punchedtheballoutofWRChristianBlake’shandstoforce anotherincompletion…At Tampa Bay (Oct. 18):Sawactionon fivedefensiveplays,makingasolotackle.Alsoappearedon13 playsonspecialteams…At Houston (Oct. 25):Appearedon18 playsonspecialteams…Vs. Minnesota (Nov. 1):Appearedon 11snapsonspecialteams…At San Francisco (Nov. 5):Notched acareer-hightwotackles(onesolo)in26snapsofworkon defenseaftersteppinginforinjuredCBJaireAlexander.Also appearedon16playsonspecialteams…Vs. Jacksonville (Nov. 15): Madehisfirstcareerstart,postingacareer-highfourtackles 2020 SEASON:Hasplayedinninegameswithonestartandhas (allsolo)andapassdefensedwhileplaying51defensivesnaps. registered eight tackles (seven solo) and three passes Alsosawactionon11playsonspecialteams…At Indianapolis defensed…Hasalsomadeonespecialteamstackle…Inactivefor (Nov. 22):Inactive(quadricep).
KA'DAR HOLLMAN'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 4 0 0 0 0 0 0 0.0 0.0 00 000000 00000000 2020 Packers 9 1 8 7 1 0 0 0.0 0.0 0 0 0 0 0 3 0 0 0 1 0 1 0 0 0 0 NFL TOTALS 13 1 8 7 1 0 0 0.0 0.0 0 0 0 0 0 3 0 0 0 1 0 1 0 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 4vs.JacksonvilleJaguars,Nov15,2020 Special Teams Tackles 1atMinnesotaVikings,Sep13,2020 2atSanFrancisco49ers,Nov05,2020 Passes Defensed 2vs.AtlantaFalcons,Oct05,2020 1vs.JacksonvilleJaguars,Nov15,2020 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings P 0 0 0 0.0 0.0 0 0 00 000000 0 1 0 1 0 0 0 0 W 43-34 09/20 Lions P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons P 1 1 0 0.0 0.0 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 W 30-16 10/18 atBuccaneers P 1 1 0 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 35-20 11/01 Vikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers P 2 1 1 0.0 0.0 0 0 00 000000 00000000 W 34-17 11/15 Jaguars S 4 4 0 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 24-20 11/22 atColts GAMEINACTIVE/INJURY L 31-34+ 2020 TOTALS 9-1 8 7 1 0.0 0.0 0 0 0 0 0 0 0 3 0 0 0 1 0 1 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 35 14playsonspecialteams,butdidnotrecordastatistic...Vs. Detroit (Sept. 20):Playedfivesnapsondefenseand19on specialteams,recordingonepassdefensedandreturningone puntfor6yards.Itwashisthirdcareerpuntreturnandfirstsince 2018...At New Orleans (Sept. 27): Sawactionon16snapson specialteams...Vs. Atlanta (Oct. 5): Playedinaseasonhigh28 snapsondefense,recordingtwosolotackles,andsawactionon 11specialteamsplays...At Tampa Bay (Oct. 18): Wasoneoftwo players(AdrianAmos)toplayall65defensivesnaps,finishing tiedforNo.2ontheteamwithsixtackles(fivesolo).Alsosaw actionon10playsonspecialteams.Slashedintothebackfield andstoppedRBLeSeanMcCoyforagainof1yardonthird- and-2toforceapuntinthefirstquarter...At Houston (Oct. 25): Playedonall68defensivesnapsaswellasninespecialteams plays,finishingwithfoursolotacklesandatackleforaloss.In thefirstquarter,stoppedRBDavidJohnsonforalossof1-yard onthird-and-1toforceapunt...Vs. Minnesota (Nov. 1):Finished tiedforthethird-mosttacklesontheteamwithfive(four solo)...At San Francisco (Nov. 5): Ledtheteamwith56defensive snapsplayedwhilealsoseeingactiononsevenspecialteams plays.FinishedtiedforNo.3onthedefensewithfourtackles(all solo)...Vs. Jacksonville (Nov. 15): StartedinplaceofinjuredCB KevinKingforthefifthstraightweekandplayedon60snapson 2020 SEASON:Playedinall10games(fivestarts),recording24 defense,registeringthreetackles(twosolo)...At Indianapolis tackles(21solo),atackleforalossandtwopassesdefensed...At (Nov. 22): Played15specialteamssnaps,recordinganassisted Minnesota (Sept. 13):Sawactionontwoplaysondefenseand tackleonapunt.
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 9/9/18 GBvs.CHI W S 3 3 0 0.0 0 0 1 1 0 0 0 0 12/16/18 GB@CHI LS 5 4 1 0.0 0 0 0 0 0 0 0 0 TOTALS 1/1 2/2 8 7 1 0.0 0 0 1 1 0 0 0 0
JOSH JACKSON'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2018 Packers 16 10 59 37 22 1 1 0.0 0.0 0 0 0 0 0 13 0 0 0 4 4 0 0 1 0 0 2019 Packers 14 0 4 2 2 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 5 5 0 0 0 0 0 2020 Packers 10 5 24 21 3 1 1 0.0 0.0 0 0 0 0 0 2 0 0 0 1 0 1 0 0 0 0 NFL TOTALS 40 15 87 60 27 2 2 0.0 0.0 0 0 0 0 0 15 0 0 0 10 9 1 0 1 0 0
JOSH JACKSON'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 1 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 NFL TOTALS 1 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 9atMinnesotaVikings,Nov25,2018 Special Teams Tackles 2atSanFrancisco49ers,Nov24,2019 7vs.BuffaloBills,Sep30,2018 1atIndianapolisColts,Nov22,2020 Passes Defensed 2vs.AtlantaFalcons,Dec09,2018 ...7moreat1. 2atNewEnglandPatriots,Nov04,2018 Special Teams Fumble Recoveries 1atChicagoBears,Dec16,2018 ...2moreat2. Tackles For Loss 1atHoustonTexans,Oct25,2020 1vs.ChicagoBears,Sep09,2018
2020GREENBAYPACKERS 36 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions P 0 0 0 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 42-21 09/27 atSaints P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons P 2 2 0 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers S 6 5 1 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans S 4 4 0 0.0 0.0 1 1 00 000000 00000000 W 35-20 11/01 Vikings S 5 4 1 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers S 4 4 0 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 34-17 11/15 Jaguars S 3 2 1 0.0 0.0 0 0 00 000000 00000000 W 24-20 11/22 atColts P 0 0 0 0.0 0.0 0 0 00 000000 0 1 0 1 0 0 0 0 L 31-34+ 2020 TOTALS 10-5 24 21 3 0.0 0.0 1 1 0 0 0 0 0 2 0 0 0 1 0 1 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 37 andfourTDswithnoINTsfora127.5rating…Vs.Detroit(Sept. 20):StartedatLGandplayedall73snaps,helpingclearholesfor RBAaronJones’career-high168rushingyardsandtwoTDson 18carries(9.3avg.)asJonesfinishedwithacareer-best236 yardsfromscrimmage,thethirdmostinagameinfranchise history.Partofanoffensethatrackedup259yardsrushingon35 attempts(7.4avg.),thetopyardagetotalbyGreenBaysinceDec. 28,2003,vs.Denver(262yardson34carries).Alsowaspartofa linethatallowedjustonesackofRodgersontheafternoon…At NewOrleans(Sept.27):StartedatLGandplayedall62snapsas thelineallowedjustonesackontheeveningandprotected Rodgersasheconnectedon21of32passesfor283yardsand threeTDsfora124.9ratingVs.Atlanta(Oct.5):StartedatLGand playedall63snaps,helpingprotectRodgersashewassacked justonceontheeveningandcompleted27of33passesfor327 yardsandfourTDswithnoINTsfora147.5rating…AtTampa Bay(Oct.18):StartedatLGandplayedall63snaps…AtHouston (Oct.25):StartedatLGandplayed60of62snaps(notonthe fieldfortwokneel-downs).Waspartofalinethatdidnotallowa sackasRodgersconnectedon23of34passesfor283yardsand fourTDswithnoINTs(132.4rating)…Vs.Minnesota(Nov.1): StartedatLGandplayedall75snaps,partofalinethatallowed justonesackasRodgerscompleted27of41passesfor291 yardsandthreeTDswithnoINTs(110.9rating)…AtSan 2020 SEASON: Hasstartedall10games,openingnineatLGand Francisco(Nov.5):StartedatLGandplayedall64snaps,taking oneatRT…Hasseenactionatfourdifferentspotsonthelinethis overatLTinthesecondhalfwithBillyTurnermovingtoRTin season(LT,LG,C,RT)…Partofalinethathasallowedonesack placeofaninjuredRickWagner(knee).PlayedCforthefinalfour orzerosacksinaleague-bestninegames,thefirstNFLteamto snapsofthegame,hisfirstNFLactionattheposition.Partofa dosointhefirst10gamesoftheseasonsince2008(three linethatallowedjustonesackasRodgersconnectedon25of31 teams)…HashelpedthePackersrankNo.3inscoring(30.8ppg) passesfor305yardsandfourTDswithnoINTsfora147.2 andsacksallowed(11),tiedforNo.3ingiveaways(nine),No.7 rating…Vs.Jacksonville(Nov.15):StartedatLGandplayedall intotaloffense(392.9ypg),No.6inpassingoffense(277.0ypg), 65snaps,partofalinethatallowedonlyonesackonthedayas No.3inyardsperplay(6.25),No.4inthird-downpercentage Rodgersthrewfor325yardsandtwoTDswithoneINTon24- (47.9)andNo.1intimeofpossession(32:27)…AtMinnesota of-34passing(108.1rating)…AtIndianapolis(Nov.22):Played (Sept.13):StartedatRTforthefirsttimeinhiscareer,appearing all60snaps,startingatLGandplayingthefirst10snapsofthe onthefirst32snapsofthegametherebeforemovingbacktoLG gametherebeforemovingtoCduetoaninjurytoCCoreyLinsley afteraninjurytoLucasPatrick(shoulder).Playedthefinal46 (back).Playedthefinal50snapsofthegameatcenter,themost snapsofthegameatLG,helpingthePackersregistertheirfirst significantactionofhisNFLcareerattheposition,andhelpedto zero-sackgameagainsttheVikingssinceOct.24,2010,andtheir protectRodgersashewassackedjustonceandconnectedon27 firstgameinfranchisehistorywith40-pluspoints,500-plus of38passesfor311yardsandthreeTDswithoneINT(110.7 yards,30-plusfirstdownsandnoturnovers.BlockedforQB rating). AaronRodgersasheconnectedon32of44passesfor364yards
ELGTON JENKINS' NFL REGULAR SEASON STATISTICS
DATE TEAM GP GS 2019 Packers 16 14 2020 Packers 10 10 NFL TOTALS 26 24
ELGTON JENKINS' NFL POSTSEASON STATISTICS
DATE TEAM GP GS 2019 Packers 2 2 NFL TOTALS 2 2
2020GREENBAYPACKERS 38 catches(17.0avg.),givinghimacareer-high236yardsfrom scrimmage,thethirdmostinagameinteamhistorybehindonly BillyHowton(257onOct.21,1956)andDonHutson(237on Nov.21,1943).Becamethefirstplayerinfranchisehistoryto havetwogameswith225-plusyardsfromscrimmage(226at KansasCityonOct.27,2019).Ontheopeningplayfrom scrimmageinthesecondhalf,tookitupthemiddlefora75-yard TDrunthatwasthelongestbyaPackersinceGreen’s90-yardTD runvs.DallasonOct.24,2004.Becamethefirstplayerinteam historytopost150-plusrushingyards,two-plusrushingTDs,65- plusreceivingyardsandareceivingTDinagame.Wasjustthe fifthNFLplayersincethe1970AFL-NFLmergertohitthose marksinasinglegame(DelvinWilliams,1976;FrancoHarris, 1979;PriestHolmes,2002;ChrisJohnson,2009)…At New Orleans (Sept. 27):Ledtheteamwith69rushingyardsandaTD on16carries(4.3avg.),givinghimarushingTDineachofthe firstthreegames,thefirstGreenBayRBtodosinceBrent Fullwoodin1989.Addedtworeceptionsfor17yards(8.5 avg.)…Vs. Atlanta (Oct. 5):Postedateam-high71rushingyards on15carries(4.7avg.)andaddedfivereceptionsfor40yards (8.0avg.)andaTD.Scoredona6-yardreceptioninthefirst quarter,givinghimatleastoneTDineachofthefirstfourgames. BecamejustthefifthPackersince1950toscoreaTDineachof thefirstfourgamesoftheseason(BillyHowton,1952;Donny Anderson,1971;BillSchroeder,2001;JordyNelson,2016).On GreenBay’sopeningdrive,hada23-yardrunupthemiddletothe Atlanta6andthenhauledina6-yardTDpassfromQBAaron Rodgerstwoplayslater…At Tampa Bay (Oct. 18):Rushedfor15 yardsandaTDon10carries(1.5avg.)andaddedthree receptionsfor26yards(8.7avg.).Scoredona1-yardrunlatein 2020 SEASON: Hasstartedallsevengameshehasappearedin thefirstquarter,givinghimaTDineverygamethisseasonashe andhasposted534rushingyardsandsixTDson113carries becamethefirstplayerinteamhistorytoscoreaTDineachof (4.7 avg.)…Is tied for No. 9 in the league in rushing thefirstfivegamessinceHowtonin1952…At Houston (Oct. 25): TDs…AmongRBswith100-plusrushingattempts,ranksNo.5in Inactive(calf)…Vs. Minnesota (Nov. 1):Inactive(calf)…At San theleagueinyardspercarry…AlsoistiedforNo.2ontheteam Francisco (Nov. 5):Returnedaftermissingtwogamesdueto with32receptionsfor261yards(8.2avg.)andtwoTDs,giving injury,startingandappearingon40snaps.Postedateam-high himeighttotalTDsontheseason…AmongRBswith125-plus 58rushingyardson15carries(3.9avg.)withfivereceptionsfor touches,ranksNo.3intheNFLinyardspertouch(5.5 21yards(4.2avg.)…Vs. Jacksonville (Nov. 15):Startedandled avg.)…Wasinactivefortwogames(calf)…At Minnesota (Sept. theteamwith46rushingyardson13carries(3.5avg.)along 13):Posted66rushingyardsandaTDon16carries(4.1avg.) withfivereceptionsfor49yards(9.8avg.)…At Indianapolis alongwithfourreceptionsfor10yards(2.5avg.).Scoredfrom5 (Nov. 22): Pacedtheteamwith41yardsrushingandaTDon10 yardsoutwith3:19remaininginthegame,givinghimatleast carries(4.1avg.)alongwithfourreceptionsfor30yards(7.5 onerushingTDineachofhislastfourgamesagainstMinnesota avg.).Scoredonarunupthemiddlefrom2yardsoutwithjust ashematchedthelongeststreakagainsttheVikingsinteam under10minutesremaininginthesecondquarter. history(PaulHornung,ElijahPitts,EddieLacy)…Vs. Detroit (Sept. 20):Finishedwithacareer-high168yardsandtwoTDson 18carries(9.3avg.)andadded68yardsandaTDonfour
REGULAR SEASON COMPARISON: RECEIVING - CHICAGO BEARS DATE OPP W/L GP/GS REC YDS. AVG. TD LG TGTS YAC 11/12/17 GB@CHI W S 1 0 0.0 0 0 1 2 9/5/19 GB@CHI WS 1 0 0.0 0 0 1 1 TOTALS 2/0 2/2 2 0 0.0 0 0 2 3
REGULAR SEASON COMPARISON: RUSHING - CHICAGO BEARS DATE OPP W/L GP/GS CAR YDS. AVG. TD LG 9/28/17 GBvs.CHI W P 13 49 3.8 1 11 11/12/17 GB@CHI WS 3 12 4.0 0 6 12/16/18 GB@CHI LS 4 8 2.0 0 3 9/5/19 GB@CHI WS 13 39 3.0 0 9 12/15/19 GBvs.CHI WS 13 51 3.9 2 21t TOTALS 4/1 5/4 46 159 3.5 3 21T
2020GREENBAYPACKERS 39 AARON JONES' NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RUSHING RECEIVING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2017 Packers 12 4 81 448 5.5 46t 4 9 22 2.4 9 0 2018 Packers 12 8 133 728 5.5 67 8 26 206 7.9 24t 1 2019 Packers 16 16 236 1,084 4.6 56t 16 49 474 9.7 67t 3 2020 Packers 8 8 113 534 4.7 75t 6 32 261 8.2 30 2 NFL TOTALS 48 36 563 2,794 5.0 75t 34 116 963 8.3 67t 6
AARON JONES' NFL POSTSEASON RUSHING/RECEIVING STATISTICS
RUSHING RECEIVING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2019 Packers 2 2 33 118 3.6 23 3 6 31 5.2 9t 1 NFL TOTALS 2 2 33 118 3.6 23 3 6 31 5.2 9t 1
SINGLE-GAME HIGHS: RUSHING/RECEIVING Rush Attempts 25atDetroitLions,Dec29,2019 Longest Receptions 67tatKansasCityChiefs,Oct27,2019 23atMinnesotaVikings,Dec23,2019 50atKansasCityChiefs,Oct27,2019 ...1moreat23. Receiving TDs 2atKansasCityChiefs,Oct27,2019 Rushing Yards 168vs.DetroitLions,Sep20,2020 1vs.AtlantaFalcons,Oct05,2020 154atMinnesotaVikings,Dec23,2019 ...3moreat1. Longest Runs 75tvs.DetroitLions,Sep20,2020 All-purpose yards 236vs.DetroitLions,Sep20,2020 67vs.MiamiDolphins,Nov11,2018 226atKansasCityChiefs,Oct27,2019 Rushing TDs 4atDallasCowboys,Oct06,2019 Miscellaneous Tackles 1atMinnesotaVikings,Dec23,2019 3vs.CarolinaPanthers,Nov10,2019 Most TDs 4atDallasCowboys,Oct06,2019 Receptions 7atKansasCityChiefs,Oct27,2019 3vs.DetroitLions,Sep20,2020 7atDallasCowboys,Oct06,2019 ...1moreat3. Receiving Yards 159atKansasCityChiefs,Oct27,2019 75atDallasCowboys,Oct06,2019 100-YARD RECEIVING GAMES (1): REGULAR SEASON DATE TEAM NO. YDS. AVG. LG TD 10/27/19 atChiefs 7 159 22.7 67t 2 100-YARD RUSHING GAMES (9): REGULAR SEASON DATE TEAM ATT. YDS. AVG. LG TD 10/08/17 atCowboys 19 125 6.6 22 1 10/22/17 SAINTS 17 131 7.7 46t 1 11/11/18 DOLPHINS 15 145 9.7 67 2 09/15/19 VIKINGS 23 116 5.0 15 1 10/06/19 atCowboys 19 107 5.6 18t 4 12/08/19 WASHINGTON 16 134 8.4 42 1 12/23/19 atVikings 23 154 6.7 56t 2 12/29/19 atLions 25 100 4.0 14 0 09/20/20 LIONS 18 168 9.3 75t 2 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RUSHING RECEIVING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings S 16 66 4.1 15 1 4 10 2.5 6 0 W 43-34 09/20 Lions S 18 168 9.3 75t 2 4 68 17.0 30 1 W 42-21 09/27 atSaints S 16 69 4.3 19 1 2 17 8.5 12 0 W 37-30 10/05 Falcons S 15 71 4.7 23 0 5 40 8.0 23 1 W 30-16 10/18 atBuccaneers S 10 15 1.5 7 1 3 26 8.7 20 0 L 10-38 10/25 atTexans GAMEINACTIVE/INJURY W 35-20 11/01 Vikings GAMEINACTIVE/INJURY L 22-28 11/05 at49ers S 15 58 3.9 11 0 5 21 4.2 15 0 W 34-17 11/15 Jaguars S 13 46 3.5 20 0 5 49 9.8 14 0 W 24-20 11/22 atColts S 10 41 4.1 15 1 4 30 7.5 14 0 L 31-34+ 2020 TOTALS 8-8 113 534 4.7 75t 6 32 261 8.2 30 2 7-3 +-Overtime
2020GREENBAYPACKERS 40 GOdayAboushiearlyinthethirdquartertoagainstopPeterson fornogain…At New Orleans (Sept. 27):Playedon28snapson defenseandsevenonspecialteams,recordingtwotackles(both solo),onetackleforaloss,onepassdefensed,oneforcedfumble andateam-leadingtwosacks.Earlyinthesecondquarter,rana stuntwithLBRashanGarytobeatGAndrusPeatandstrip-sack QBDrewBrees,thefirstsackandfirstforcedfumbleofhisNFL career.Lateinthesecondquarter,gotpastPeatforasecondtime todropBreesfora7-yardsackonfirstdown.Fourplayslater, gotahanduptodeflectapassfromBreesoverthemiddleand recordthefirstpassdefensedofhiscareer…Vs. Atlanta (Oct. 5): Startedandappearedon35defensivesnaps,makingthree tackles(allsolo).Alsoplayedthreesnapsonspecialteams…At Tampa Bay (Oct. 18):Startedandrecordedacareer-highsix tackles(allassisted)whileappearingon37defensiveplays.Also appearedoneightplaysonspecialteams…At Houston (Oct. 25): Recordedoneassistedtacklewhileappearingon30defensive snaps.Alsoplayedeightsnapsonspecialteams…Vs. Minnesota 2020 SEASON:Hasplayedinall10gameswithsevenstarts, (Nov. 1):Startedandplayed16snapsondefenseandfivesnaps recording17tackles(ninesolo),twosacks,onetackleforaloss, onspecialteams…At San Francisco (Nov. 5):Startedand three quarterback hits, one forced fumble and one pass appearedon33defensivesnaps,recordinganassistedtackleand defensed…At Minnesota (Sept. 13):MadehisfirstNFLstart, a QB hit. Also played five snaps on special teams…Vs. appearingon29snapsondefenseandthreesnapsonspecial Jacksonville (Nov. 15):Startedandplayed14defensivesnaps teams…Vs. Detroit (Sept. 20): Startedandplayedon35 and10specialteamssnaps…At Indianapolis (Nov. 22):Made defensivesnapsandthreespecialteamssnaps,makingtwo twotackles(bothsolo)whileappearingon31defensivesnaps. tackles(bothsolo).Lateinthefirstquarter,shedTTyrell Alsoplayedninesnapsonspecialteams. Crosby’sblocktodropRBAdrianPetersonfornogain.Stoodup
KINGSLEY KEKE'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 14 0 11 7 4 0 0 0.0 0.0 1 0 000000 00000000 2020 Packers 10 7 17 9 8 1 7 2.0 13.0 3 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 NFL TOTALS 24 7 28 16 12 1 7 2.0 13.0 4 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0
KINGSLEY KEKE'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 2 0 3 3 0 1 1 0.0 0.0 00 000000 00000000 NFL TOTALS 2 0 3 3 0 1 1 0.0 0.0 00 000000 00000000
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 6atTampaBayBuccaneers,Oct18,2020 Forced Fumbles 1atNewOrleansSaints,Sep27,2020 4atLosAngelesChargers,Nov03,2019 Tackles For Loss 1atNewOrleansSaints,Sep27,2020 Sacks 2.0atNewOrleansSaints,Sep27,2020 Passes Defensed 1atNewOrleansSaints,Sep27,2020 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings S 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions S 2 2 0 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints P 2 2 0 2.0 13.0 1 7 2 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 W 37-30 10/05 Falcons S 3 3 0 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers S 6 0 6 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans P 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 35-20 11/01 Vikings S 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers S 1 0 1 0.0 0.0 0 0 1 0 000000 00000000 W 34-17 11/15 Jaguars S 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 24-20 11/22 atColts P 2 2 0 0.0 0.0 0 0 00 000000 00000000 L 31-34+ 2020 TOTALS 10-7 17 9 8 2.0 13.0 1 7 3 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 41 2020 SEASON:Startedfivegamesandmissedfiveduetoinjury (quadricep)...Registered 23 tackles (17 solo)...At Minnesota (Sept. 13):TiedforNo.2ontheteamwithfoursolotacklesas partofafive-tackleperformanceandplayedin51of52defensive snaps,thethirdmostonthedefenseandagamehighforthe secondary...Vs. Detroit (Sept. 20):Played53snapsandtiedfor No.2ontheteamwithfourtackles(threesolo)...At New Orleans (Sept. 27):Sawactiononall61defensivesnaps,registeringfour tackles(threesolo)...Vs. Atlanta (Oct. 5): Sawactionon30plays andregisteredthreetackles(twosolo)beforeaquadricepinjury endedhisdayafterhalftime...At Tampa Bay (Oct. 18): Inactive (quadricep)...At Houston (Oct. 25): Inactive (quadricep)...Vs. Minnesota (Nov. 1):Inactive(quadricep)...At San Francisco (Nov. 5): Inactive (quadricep)...Vs. Jacksonville (Nov. 15): Inactive(quadricep)...At Indianapolis (Nov. 22): Playedonall84 defensivesnaps,finishingtiedforNo.3ontheteamwitha season-highseventackles(fivesolo).
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 9/28/17 GBvs.CHI W S 2 2 0 0.0 0 0 0 0 0 0 0 0 11/12/17 GB@CHI WP 2 2 0 0.0 0 0 0 2 0 0 0 0 9/9/18 GBvs.CHI WS 3 3 0 0.0 0 0 1 0 0 0 0 0 9/5/19 GB@CHI WP 5 5 0 1.0 2 0 1 1 0 0 0 0 12/15/19 GBvs.CHI WS 2 2 0 0.0 0 0 0 0 0 0 0 0 TOTALS 5/0 5/3 14 14 0 1.0 2 0 2 3 0 0 0 0
KEVIN KING'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2017 Packers 9 5 31 23 8 1 4 0.0 0.0 0 0 0 0 0 8 0 0 0 1 1 0 0 0 0 0 2018 Packers 6 6 22 16 6 1 2 0.0 0.0 0 1 0 0 0 3 0 1 0 1 1 0 0 0 0 0 2019 Packers 15 14 59 45 14 4 4 1.0 2.0 0 5 54 39 0 17 1 0 0 0 0 0 0 0 0 0 2020 Packers 5 5 23 17 6 0 0 0.0 0.0 00 000000 00000000 NFL TOTALS 35 30 135 101 34 6 10 1.0 2.0 0 6 54 39 0 28 1 1 0 2 2 0 0 0 0 0
KEVIN KING'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 2 2 7 5 2 0 0 0.0 0.0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 NFL TOTALS 2 2 7 5 2 0 0 0.0 0.0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0
2020GREENBAYPACKERS 42 SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 8vs.DenverBroncos,Sep22,2019 Tackles For Loss 1atMinnesotaVikings,Dec23,2019 8atDetroitLions,Oct07,2018 1vs.CarolinaPanthers,Nov10,2019 Sacks 1.0atChicagoBears,Sep05,2019 ...4moreat1. Passes Defensed 4vs.PhiladelphiaEagles,Sep26,2019 Interceptions 1atMinnesotaVikings,Dec23,2019 3vs.CarolinaPanthers,Nov10,2019 1atNewYorkGiants,Dec01,2019 Forced Fumbles 1atDallasCowboys,Oct06,2019 ...4moreat1. Fumble Recoveries 1vs.SanFrancisco49ers,Oct15,2018 Interception Return Yards 39atMinnesotaVikings,Dec23,2019 15atDallasCowboys,Oct06,2019 Special Teams Tackles 1vs.SanFrancisco49ers,Oct15,2018 1vs.ChicagoBears,Sep28,2017 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings S 5 4 1 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions S 4 3 1 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints S 4 3 1 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons S 3 2 1 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers GAMEINACTIVE/INJURY L 10-38 10/25 atTexans GAMEINACTIVE/INJURY W 35-20 11/01 Vikings GAMEINACTIVE/INJURY L 22-28 11/05 at49ers GAMEINACTIVE/INJURY W 34-17 11/15 Jaguars GAMEINACTIVE/INJURY W 24-20 11/22 atColts S 7 5 2 0.0 0.0 0 0 00 000000 00000000 L 31-34+ 2020 TOTALS 5-5 23 17 6 0.0 0.0 0 0 00 000000 00000000 7-3 +-Overtime
2020GREENBAYPACKERS 43 defensed…WasplacedoninjuredreserveonOct.3…Activated frominjuredreserve;designatedforreturnonNov.14…At Minnesota (Sept. 13):LoggedhisfirststartinaGreenBay uniform,leadingthePackerswith12tackles(sixsolo)while appearingonall52defensiveplays.Alsoappearedonthreeplays onspecialteams…Vs. Detroit (Sept. 20):Startedandplayedall 59defensivesnapsandfivesnapsonspecialteams,finishing withateam-high12tackles(10solo).Markedhisthirdcareer gamewithatleast10solotacklesandfirstsincenotching10solo tacklesatPittsburgh(Jan.1,2017)…At New Orleans (Sept. 27): Startedandplayedon17defensivesnaps,recordingthreetackles (allsolo)beforeexitingwithashoulderinjurysustainedmidway throughthesecondquarter.Alsoplayedtwosnapsonspecial teams…Vs. Jacksonville (Nov. 15):Returnedtoactionafter missingfivegames,startingandleadingtheteamwithseven tackles(foursolo)whileplayingall64defensivesnaps.Alsogot inonfivesnapsonspecialteams…At Indianapolis (Nov. 22): Startedandloggedateam-leading11tackles(sixsolo)andhis firstinterceptionsinceOct.21,2018.Midwaythroughthesecond quarter,pickedoffQBPhillipRiversattheIND37,apassthat 2020 SEASON:Hasstartedallfivegameshehasappearedin, wastippedatthelinebyDLBillyWinn,andregisteredan8-yard recording45tackles(29solo),oneinterceptionandonepass return.
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 12/24/17 CLV@CHI L S 8 6 2 0.0 0 0 1 0 0 0 0 0 TOTALS 0/1 1/1 8 6 2 0.0 0 0 1 0 0 0 0 0
CHRISTIAN KIRKSEY'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2014 Browns 16 8 75 41 34 5 15 2.0 7.0 4 0 0 0 0 2 1 0 0 6 6 0 0 0 0 0 2015 Browns 16 5 53 34 19 5 20 3.5 13.0 5 0 0 0 0 1 1 1 0 10 6 4 0 0 0 0 2016 Browns 16 16 143 93 50 11 36 2.5 16.0 7 0 0 0 0 3 0 0 0 5 3 2 0 0 0 0 2017 Browns 16 16 138 86 52 6 19 3.5 13.5 6 0 0 0 0 5 2 1 0 0 0 0 0 0 0 0 2018 Browns 7 7 43 29 14 1 3 0.0 0.0 0 2 17 13 0 5 0 1 8 0 0 0 0 0 0 0 2019 Browns 2 2 11 6 5 2 3 0.0 0.0 00 000000 00000000 2020 Packers 5 5 45 29 16 0 0 0.0 0.0 0 1 8 8 0 1 0 0 0 0 0 0 0 0 0 0 NFL TOTALS 78 59 508 318 190 30 96 11.5 49.5 22 3 25 13 0 17 4 3 8 21 15 6 0 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 17vs.TennesseeTitans,Oct22,2017 Tackles For Loss 3atPittsburghSteelers,Jan01,2017 16vs.NewEnglandPatriots,Oct09,2016 2vs.TennesseeTitans,Sep08,2019 Sacks 1.0vs.JacksonvilleJaguars,Nov19,2017 ...1moreat2. 1.0atDetroitLions,Nov12,2017 Interceptions 1atIndianapolisColts,Nov22,2020 ...8moreat1.0. 1atTampaBayBuccaneers,Oct21,2018 Passes Defensed 2vs.LosAngelesChargers,Oct14,2018 ...1moreat1. 1atIndianapolisColts,Nov22,2020 Interception Return Yards 13atTampaBayBuccaneers,Oct21,2018 ...14moreat1. 8atIndianapolisColts,Nov22,2020 Forced Fumbles 1vs.JacksonvilleJaguars,Nov19,2017 Special Teams Tackles 3vs.OaklandRaiders,Sep27,2015 1vs.TennesseeTitans,Oct22,2017 2vs.BaltimoreRavens,Nov30,2015 ...2moreat1. ...2moreat2. Fumble Recoveries 1atTampaBayBuccaneers,Oct21,2018 1atIndianapolisColts,Sep24,2017 ...1moreat1.
2020GREENBAYPACKERS 44 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings S 12 6 6 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions S 12 10 2 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints S 3 3 0 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons INJUREDRESERVE W 30-16 10/18 atBuccaneers INJUREDRESERVE L 10-38 10/25 atTexans INJUREDRESERVE W 35-20 11/01 Vikings INJUREDRESERVE L 22-28 11/05 at49ers INJUREDRESERVE W 34-17 11/15 Jaguars S 7 4 3 0.0 0.0 0 0 00 000000 00000000 W 24-20 11/22 atColts S 11 6 5 0.0 0.0 0 0 0 1 8 8 0 1 0 0 0 0 0 0 0 0 0 0 L 31-34+ 2020 TOTALS 5-5 45 29 16 0.0 0.0 0 0 0 1 8 8 0 1 0 0 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 45 recording16tackles(fivesolo)andonepassdefensed…Was inactiveforonecontest(shoulder)…At Minnesota (Sept. 13): Played23snapsondefenseand10snapsonspecialteams…Vs. Detroit (Sept. 20):Madehisfirststartoftheseason,seeing actionon33playsondefenseand11playsonspecialteams…At New Orleans (Sept. 27):Startedandrecordedtwotackles(both assisted)whileappearingon29defensivesnapsand13snapson specialteams…Vs. Atlanta (Oct. 5):Startedandregisteredfour tackles(onesolo)whileplaying35defensivesnaps.Alsoplayed sevensnapsonspecialteams…At Tampa Bay (Oct. 18): Appearedonnineplaysondefenseandfiveplaysonspecial teamsbeforeexitingwithashoulderinjury…At Houston (Oct. 25):Inactive(shoulder)…Vs. Minnesota (Nov. 1):Postedfour tackles(twosolo)on27defensivesnaps.Alsoplayedseven snapsonspecialteams…At San Francisco (Nov. 5):Recorded twotackles(onesolo)whileappearingon22defensivesnaps. Alsogotinon11playsonspecialteams…Vs. Jacksonville (Nov. 15):Recordedtwoassistedtackleswhileplaying22playson defense.Alsogotinon13specialteamssnaps…At Indianapolis (Nov. 22):Postedtwotackles(onesolo)andapassdefensed whileappearingon38plays.Alsogotinon13specialteams 2020 SEASON:Hasplayedinninegameswiththreestarts, plays.
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 12/16/18 GB@CHI L S 10 6 4 0.0 0 0 0 0 0 0 0 0 12/15/19 GBvs.CHI WP 4 4 0 0.0 0 0 0 0 0 0 0 0 TOTALS 1/1 2/1 14 10 4 0.0 0 0 0 0 0 0 0 0
TYLER LANCASTER'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2018 Packers 12 5 33 21 12 2 4 0.0 0.0 2 0 000000 00000000 2019 Packers 16 10 36 19 17 4 9 1.5 9.0 1 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 2020 Packers 9 3 16 5 11 0 0 0.0 0.0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 NFL TOTALS 37 18 85 45 40 6 13 1.5 9.0 3 0 0 0 0 1 1 1 0 0 0 0 0 0 0 0
TYLER LANCASTER'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 2 2 7 4 3 0 0 0.0 0.0 00 000000 00000000 NFL TOTALS 2 2 7 4 3 0 0 0.0 0.0 00 000000 00000000
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 10atChicagoBears,Dec16,2018 Forced Fumbles 1atKansasCityChiefs,Oct27,2019 8vs.DenverBroncos,Sep22,2019 Fumble Recoveries 1atKansasCityChiefs,Oct27,2019 Sacks 1.0vs.CarolinaPanthers,Nov10,2019 Tackles For Loss 1vs.Washington,Dec08,2019 0.5atLosAngelesChargers,Nov03,2019 1vs.CarolinaPanthers,Nov10,2019 Passes Defensed 1atIndianapolisColts,Nov22,2020 ...4moreat1.
2020GREENBAYPACKERS 46 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions S 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints S 2 0 2 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons S 4 1 3 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans GAMEINACTIVE/INJURY W 35-20 11/01 Vikings P 4 2 2 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers P 2 1 1 0.0 0.0 0 0 00 000000 00000000 W 34-17 11/15 Jaguars P 2 0 2 0.0 0.0 0 0 00 000000 00000000 W 24-20 11/22 atColts P 2 1 1 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 L 31-34+ 2020 TOTALS 9-3 16 5 11 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 47 yards(15.8avg.)andaTD.Earlyinthefourthquarter,caughta passdownthemiddlefor38yardsdowntotheMinnesota5on third-and-7.Twoplayslater,caughta4-yardTDpassfromQB AaronRodgerswithCBMikeHughesintightcoverage.Addeda 19-yardpickuponanend-aroundrunlateinthefirstquarter downtotheMinnesota25…Vs. Detroit (Sept. 20):Startedand played61of73snaps,postingthreereceptionsfor45yards (15.0avg.),highlightedbya25-yardgainonacrossingroutein thethirdquarter…At New Orleans (Sept. 27):Startedandplayed 59of62snaps,postingacareer-highsixreceptionsforacareer- best146yards(24.3avg.)andaTD.His146receivingyards werethemostbyaPackerthatenteredtheleagueasanundrafted playerintheCommonDraftEra(since1966).Earlyinthesecond quarter,gotbehindCBMarshonLattimoretomakeadivingcatch attheNewOrleans2foracareer-long48-yardcatch.Twoplays later,scoredona5-yardTDreception.Ontheopeningdriveof thethirdquarteronathird-and-10,foundanopeningdownthe seamforacareer-long72-yardcatchtotheNewOrleans3, gettingpastCBP.J.Williamstomakethecatchnearthe30 beforetakingitdowntothe3…At Indianapolis (Nov. 22): Returnedtoactionaftermissingsixcontestsduetoinjury, appearingon36snapsandcatchingtwopassesfor18yards(9.0 avg.). 2020 SEASON: Hasappearedinfourgameswiththreestartsand hasregistered15receptionsfor272yards(18.1avg.)andtwo TDs…RanksNo.7intheNFLinyardspercatchamongplayers with15-plusreceptions…Has152yardsonfivecatches(30.4 avg.)onthirddown,withallfivereceptionspickingupfirst downs…Alsohastwocarriesfor17yards(8.5avg.)…Was placedoninjuredreserve(core)onOct.3andwassidelinedfor sixgames(Week4,Weeks6-10)…At Minnesota (Sept. 13): Startedandplayed68of78snaps,haulinginfourpassesfor63
REGULAR SEASON COMPARISON: RECEIVING - CHICAGO BEARS DATE OPP W/L GP/GS REC YDS. AVG. TD LG TGTS YAC 12/15/19 GBvs.CHI W P 2 14 7.0 0 10 3 4 TOTALS 1/0 1/0 2 14 7.0 0 10 3 4
ALLEN LAZARD'S NFL REGULAR SEASON RECEIVING STATISTICS
RECEIVING DATE TEAM GP GS NO. YDS. AVG. LG TD 2018 Packers 1 0 1 7 7.0 7 0 2019 Packers 16 3 35 477 13.6 43 3 2020 Packers 4 3 15 272 18.1 72 2 NFL TOTALS 21 6 51 756 14.8 72 5
ALLEN LAZARD'S NFL POSTSEASON RECEIVING STATISTICS
RECEIVING DATE TEAM GP GS NO. YDS. AVG. LG TD 2019 Packers 2 2 3 36 12.0 19 0 NFL TOTALS 2 2 3 36 12.0 19 0
2020GREENBAYPACKERS 48 SINGLE-GAME HIGHS: RUSHING/RECEIVING Rush Attempts 1atNewOrleansSaints,Sep27,2020 Longest Receptions 72atNewOrleansSaints,Sep27,2020 1atMinnesotaVikings,Sep13,2020 48atNewOrleansSaints,Sep27,2020 ...1moreat1. Receiving TDs 1atNewOrleansSaints,Sep27,2020 Rushing Yards 21atSanFrancisco49ers,Nov24,2019 1atMinnesotaVikings,Sep13,2020 19atMinnesotaVikings,Sep13,2020 ...3moreat1. Longest Runs 21atSanFrancisco49ers,Nov24,2019 All-purpose yards 144atNewOrleansSaints,Sep27,2020 19atMinnesotaVikings,Sep13,2020 103atNewYorkGiants,Dec01,2019 Receptions 6atNewOrleansSaints,Sep27,2020 Special Teams Tackles 2atNewYorkGiants,Dec01,2019 5atMinnesotaVikings,Dec23,2019 1vs.CarolinaPanthers,Nov10,2019 ...1moreat5. ...3moreat1. Receiving Yards 146atNewOrleansSaints,Sep27,2020 Most TDs 1atNewOrleansSaints,Sep27,2020 103atNewYorkGiants,Dec01,2019 1atMinnesotaVikings,Sep13,2020 ...3moreat1. 100-YARD RECEIVING GAMES (2): REGULAR SEASON DATE TEAM NO. YDS. AVG. LG TD 12/01/19 atGiants 3 103 34.3 43 1 09/27/20 atSaints 6 146 24.3 72 1 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RECEIVING RUSHING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings S 4 63 15.8 38 1 1 19 19.0 19 0 W 43-34 09/20 Lions S 3 45 15.0 25 0 0 0 0.0 0 0 W 42-21 09/27 atSaints S 6 146 24.3 72 1 1 -2 -2.0 -2 0 W 37-30 10/05 Falcons INJUREDRESERVE W 30-16 10/18 atBuccaneers INJUREDRESERVE L 10-38 10/25 atTexans INJUREDRESERVE W 35-20 11/01 Vikings INJUREDRESERVE L 22-28 11/05 at49ers INJUREDRESERVE W 34-17 11/15 Jaguars INJUREDRESERVE W 24-20 11/22 atColts P 2 18 9.0 10 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 4-3 15 272 18.1 72 2 2 17 8.5 19 0 7-3 +-Overtime
2020GREENBAYPACKERS 49 2020 SEASON: Hasstartedallninegameshehasappearedinand hasfivecatchesfor40yards(8.0avg.)andtwoTDs…At Minnesota (Sept. 13):Startedandplayed32snaps,helpingclear holesforthePackerstorushfor158yardson32carries(4.9 avg.)…Vs. Detroit (Sept. 20):Startedandplayed33snaps, helpingthePackersrackup259rushingyardson35carries(7.4 avg.),thetopyardagetotalforGreenBaysinceDec.28,2003,vs. Denver(262yardson34carries).Addeda4-yardreception…At New Orleans (Sept. 27):Startedandplayed20snaps,haulingin an18-yardTDpasslateinthethirdquarter,hislongestreceiving TDsincea30-yardervs.BaltimoreonSept.24,2017,whenhe waswiththeJaguars.Scoredonawheelroute,makingaleaping graboverSMalcolmJenkinsfortheTD…Vs. Atlanta (Oct. 5): Inactive(knee),snappingastreakof51consecutiveregular- seasongamesplayed…At Tampa Bay (Oct. 18):Startedand played21snaps…At Houston (Oct. 25):Startedandplayed31 snaps,haulingina9-yardreception…Vs. Minnesota (Nov. 1): Startedandappearedon20snaps…At San Francisco (Nov. 5): Startedandplayed32snaps,haulingina1-yardTDcatch midwaythroughthesecondquarter…Vs. Jacksonville (Nov. 15):Startedandappearedon26snaps…At Indianapolis (Nov. 22): Startedandplayed19snaps,postingan8-yardgrabearlyin thefirstquarter.
REGULAR SEASON COMPARISON: RECEIVING - CHICAGO BEARS DATE OPP W/L GP/GS REC YDS. AVG. TD LG TGTS YAC 12/7/08 JAX@CHI L S 4 43 10.8 0 27 0 0 10/7/12 JAXvs.CHI LS 5 24 4.8 0 14 7 10 10/16/16 JAX@CHI WS 0 0 0 0 0 1 0 9/5/19 GB@CHI WS 2 14 7.0 0 9 3 8 12/15/19 GBvs.CHI WS 1 6 6.0 0 6 1 6 TOTALS 3/2 5/5 12 87 7.3 0 27 12 24
MARCEDES LEWIS' NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2006 Jaguars 15 3 13 126 9.7 31 1 0 0 0.0 0 0 2007 Jaguars 16 16 37 391 10.6 25 2 0 0 0.0 0 0 2008 Jaguars 16 16 41 489 11.9 30t 2 0 0 0.0 0 0 2009 Jaguars 15 15 32 518 16.2 47 2 0 0 0.0 0 0 2010 Jaguars 16 16 58 700 12.1 42t 10 0 0 0.0 0 0 2011 Jaguars 15 15 39 460 11.8 62 0 0 0 0.0 0 0 2012 Jaguars 16 15 52 540 10.4 26 4 0 0 0.0 0 0 2013 Jaguars 11 11 25 359 14.4 41 4 0 0 0.0 0 0 2014 Jaguars 8 8 18 206 11.4 63t 2 0 0 0.0 0 0 2015 Jaguars 16 16 16 226 14.1 45 0 0 0 0.0 0 0 2016 Jaguars 10 10 20 169 8.5 37 1 0 0 0.0 0 0 2017 Jaguars 16 16 24 318 13.3 37 5 0 0 0.0 0 0 2018 Packers 16 4 3 39 13.0 30 0 0 0 0.0 0 0 2019 Packers 16 11 15 156 10.4 25 1 0 0 0.0 0 0 2020 Packers 9 9 5 40 8.0 18t 2 0 0 0.0 0 0 NFL TOTALS 211 181 398 4,737 11.9 63t 36 0 0 0.0 0 0
2020GREENBAYPACKERS 50 MARCEDES LEWIS' NFL POSTSEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2007 Jaguars 2 2 6 90 15.0 34 0 0 0 0.0 0 0 2017 Jaguars 3 3 4 21 5.3 16 1 0 0 0.0 0 0 2019 Packers 2 2 2 14 7.0 11 0 0 0 0.0 0 0 NFL TOTALS 7 7 12 125 10.4 34 1 0 0 0.0 0 0
SINGLE-GAME HIGHS: RUSHING/RECEIVING Receptions 7atTennesseeTitans,Dec30,2012 All-purpose yards 103atTennesseeTitans,Dec30,2012 7atClevelandBrowns,Nov20,2011 77vs.TampaBayBuccaneers,Dec11,2011 Receiving Yards 103atTennesseeTitans,Dec30,2012 Miscellaneous Tackles 1vs.PhiladelphiaEagles,Sep26,2019 77vs.TampaBayBuccaneers,Dec11,2011 1vs.TennesseeTitans,Dec22,2013 Longest Receptions 63tatWashington,Sep14,2014 ...10moreat1. 62vs.TampaBayBuccaneers,Dec11,2011 Most TDs 3vs.BaltimoreRavens,Sep24,2017 Receiving TDs 3vs.BaltimoreRavens,Sep24,2017 2atHoustonTexans,Nov18,2012 2atHoustonTexans,Nov18,2012 ...3moreat2. ...3moreat2. 100-YARD RECEIVING GAMES (1): REGULAR SEASON DATE TEAM NO. YDS. AVG. LG TD 12/30/12 atTitans 7 103 14.7 25 0 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RECEIVING RUSHING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings S 0 0 0.0 0 0 0 0 0.0 0 0 W 43-34 09/20 Lions S 1 4 4.0 4 0 0 0 0.0 0 0 W 42-21 09/27 atSaints S 1 18 18.0 18t 1 0 0 0.0 0 0 W 37-30 10/05 Falcons GAMEINACTIVE/INJURY W 30-16 10/18 atBuccaneers S 0 0 0.0 0 0 0 0 0.0 0 0 L 10-38 10/25 atTexans S 1 9 9.0 9 0 0 0 0.0 0 0 W 35-20 11/01 Vikings S 0 0 0.0 0 0 0 0 0.0 0 0 L 22-28 11/05 at49ers S 1 1 1.0 1t 1 0 0 0.0 0 0 W 34-17 11/15 Jaguars S 0 0 0.0 0 0 0 0 0.0 0 0 W 24-20 11/22 atColts S 1 8 8.0 8 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 9-9 5 40 8.0 18t 2 0 0 0.0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 51 fourTDswithnoINTsfora127.5rating…Vs. Detroit (Sept. 20): StartedatCandplayed65of73snaps,missingthefinaleight playsduetoinjury(hand).HelpedclearholesforRBAaronJones’ career-high168rushingyardsandtwoTDson18carries(9.3 avg.)asJonesfinishedwithacareer-best236yardsfrom scrimmage,thethirdmostinagameinfranchisehistory.Partof anoffensethatrackedup259yardsrushingon35attempts(7.4 avg.),thetopyardagetotalbyGreenBaysinceDec.28,2003,vs. Denver(262yardson34carries).Alsowaspartofalinethat allowedjustonesackofRodgersontheafternoon…At New Orleans (Sept. 27):StartedatCandplayedall62snapsasthe lineallowedjustonesackontheeveningandprotectedRodgers asheconnectedon21of32passesfor283yardsandthreeTDs fora124.9rating…Vs. Atlanta (Oct. 5):StartedatCandplayed all63snaps,helpingprotectRodgersashewassackedjustonce ontheeveningandcompleted27of33passesfor327yardsand fourTDswithnoINTsfora147.5rating…At Tampa Bay (Oct. 18):Startedandplayedall63snaps…At Houston (Oct. 25): StartedatCandplayedall62snaps,partofalinethatdidnot allowasackasRodgersconnectedon23of34passesfor283 yardsandfourTDswithnoINTs(132.4rating)…Vs. Minnesota (Nov. 1):StartedatCandplayedall75snaps,partofalinethat allowedjustonesackasRodgerscompleted27of41passesfor 291yardsandthreeTDswithnoINTs(110.9rating)…At San Francisco (Nov. 5):StartedatCandplayed62of66snaps, comingoutforthefinaltwodriveswiththePackersholdingabig lead.PartofalinethatallowedjustonesackasRodgers connectedon25of31passesfor305yardsandfourTDswithno 2020 SEASON: Hasstartedall10gamesatCandhasbeenpartof INTsfora147.2rating…Vs. Jacksonville (Nov. 15):StartedatC alinethathasallowedonesackorzerosacksinaleague-best andplayedall65snaps,partofalinethatallowedonlyonesack ninegames,thefirstNFLteamtodosointhefirst10gamesof onthedayasRodgersthrewfor325yardsandtwoTDswithone theseasonsince2008(threeteams)…HashelpedthePackers INTon24-of-34passing(108.1rating)…At Indianapolis (Nov. rankNo.3inscoring(30.8ppg)andsacksallowed(11),tiedfor 22): StartedatC,butdepartedthegameafterjust10snapsdue No.3ingiveaways(nine),No.7intotaloffense(392.9ypg),No. toabackinjuryanddidnotreturn. 6inpassingoffense(277.0ypg),No.3inyardsperplay(6.25), No.4inthird-downpercentage(47.9)andNo.1intimeof possession(32:27)…At Minnesota (Sept. 13):StartedatCand playedall78snaps,helpingthePackersregistertheirfirstzero- sackgameagainsttheVikingssinceOct.24,2010,andtheirfirst gameinfranchisehistorywith40-pluspoints,500-plusyards, 30-plusfirstdownsandnoturnovers.BlockedforQBAaron Rodgersasheconnectedon32of44passesfor364yardsand
COREY LINSLEY'S NFL REGULAR SEASON STATISTICS
DATE TEAM GP GS 2014 Packers 16 16 2015 Packers 13 13 2016 Packers 9 9 2017 Packers 16 16 2018 Packers 16 16 2019 Packers 16 16 2020 Packers 10 10 NFL TOTALS 96 96
COREY LINSLEY'S NFL POSTSEASON STATISTICS
DATE TEAM GP GS 2014 Packers 2 2 2015 Packers 2 2 2016 Packers 3 3 2019 Packers 2 2 NFL TOTALS 9 9
2020GREENBAYPACKERS 52 2020 SEASON: Hasbeeninactive(thirdQB)forall10 games…Wasplacedonreserve/COVID-19onNov.6andwas activatedonNov.10.
2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) PASSING RUSHING DATE OPPONENT P/S ATT CMP YDS PCT Y/A Y/C TD INT LG SK/YD RATE ATT YDS LG TD W/L SCORE 09/13 atVikings INACTIVE W 43-34 09/20 Lions INACTIVE W 42-21 09/27 atSaints INACTIVE W 37-30 10/05 Falcons INACTIVE W 30-16 10/18 atBuccaneers INACTIVE L 10-38 10/25 atTexans INACTIVE W 35-20 11/01 Vikings INACTIVE L 22-28 11/05 at49ers INACTIVE W 34-17 11/15 Jaguars INACTIVE W 24-20 11/22 atColts INACTIVE L 31-34+ 2020 TOTALS 0-0 0 0 0 0.0 0.0 0.0 0 0 0 0/0 0.0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 53 andwasplacedoninjuredreserveonNov.13…At Minnesota (Sept. 13): MadehisNFLdebut,appearingononeplayon offenseand14onspecialteams…Vs. Detroit (Sept. 20): Appearedon11playsonoffenseandsevenonspecialteams…At New Orleans (Sept. 27):Playedtwosnapsonoffenseand15on specialteams…Vs. Atlanta (Oct. 5):Playedsixsnapsonoffense and15onspecialteams…At Tampa Bay (Oct. 18):Playedfive snapsonoffenseand20onspecialteams,postingatacklewhen heupendedWRCyrilGraysonattheTampaBay18onafirst- quarterkickoffreturn…At Houston (Oct. 25):Playedninesnaps onoffenseandpostedatackleonspecialteamsin16snapsof action…Vs. Minnesota (Nov. 1):Appearedon11playson specialteams…At San Francisco (Nov. 5):Played11snapson offenseand14onspecialteams,postingthefirsttouchesofhis careeronoffensewiththreecarriesfor6yards(2.0avg.),withall threeattemptscominglateinthefourthquarter.Alsoregistereda career-hightwotacklesonspecialteams. 2020 SEASON: Playedineightgames,seeingtimeonoffenseand specialteams,andrushedfor6yardsonthreecarries(2.0 avg.)…Also registered four tackles on special teams…Was elevatedfromthepracticesquadthedaybeforetheWeek1-2 contestsandthenwassignedtothe53-manrosteronSept. 26…SustainedasignificantkneeinjuryinpracticeonNov.12
JOHN LOVETT'S NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2020 Packers 8 0 0 0 0.0 0 0 3 6 2.0 4 0 NFL TOTALS 8 0 0 0 0.0 0 0 3 6 2.0 4 0
JOHN LOVETT'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2020 Packers 8 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 4 3 1 0 0 0 0 NFL TOTALS 8 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 4 3 1 0 0 0 0
SINGLE-GAME HIGHS: RUSHING/RECEIVING Rush Attempts 3atSanFrancisco49ers,Nov05,2020 Kickoff Returns 1atSanFrancisco49ers,Nov05,2020 Rushing Yards 6atSanFrancisco49ers,Nov05,2020 Kickoff Return Yards 5atSanFrancisco49ers,Nov05,2020 Longest Runs 4atSanFrancisco49ers,Nov05,2020 Longest Kickoff Return 5atSanFrancisco49ers,Nov05,2020 2atSanFrancisco49ers,Nov05,2020 Special Teams Tackles 2atSanFrancisco49ers,Nov05,2020 All-purpose yards 11atSanFrancisco49ers,Nov05,2020 1atHoustonTexans,Oct25,2020 ...1moreat1.
2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers P 0 0 0 0.0 0.0 0 0 00 000000 0 1 1 0 0 0 0 0 L 10-38 10/25 atTexans P 0 0 0 0.0 0.0 0 0 00 000000 0 1 0 1 0 0 0 0 W 35-20 11/01 Vikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers P 0 0 0 0.0 0.0 0 0 00 000000 0 2 2 0 0 0 0 0 W 34-17 11/15 Jaguars INJUREDRESERVE W 24-20 11/22 atColts INJUREDRESERVE L 31-34+ 2020 TOTALS 8-0 0 0 0 0.0 0.0 0 0 00 000000 0 4 3 1 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 54 solo),asack,atackleforaloss,apassdefensedandaQBhit...At Minnesota (Sept. 13):Sawactionon39defensivesnapswhile alsoappearingoneightplaysonspecialteams...Vs. Detroit (Sept. 20): Played44snapsandregisteredtwotackles(onesolo) whilealsoplaying11snapsonspecialteams...At New Orleans (Sept. 27): Sawactionon32defensivesnapsandrecordedone solo tackle while also appearing on seven special teams plays...Vs. Atlanta (Oct. 5): Played43defensivesnapsand registeredatackle.Alsosawactiononfiveplaysonspecial teams...At Tampa Bay (Oct. 18): Sawactionon43defensive plays,leadingthedefensivelineforthefifthstraightweek,and tiedforNo.4ontheteamwithfivetackles(allassisted)...At Houston (Oct. 25): Played29defensivesnaps,registeringtwo tackles(onesolo),and10snapsonspecialteams.Midway throughthesecondquarter,stuffedRBDavidJohnsonforno gainontheHouston2-yardline...Vs. Minnesota (Nov. 1): Posted threesolotackles,asack,atackleforalossandaQBhiton37 defensivesnaps.TookdownQBKurtCousinsinthesecond quarterforalossof9yards...At San Francisco (Nov. 5): Played on25defensivesnapsandnineonspecialteams.Finishedwith twotackles(bothsolo)ondefense...Vs. Jacksonville (Nov. 15): Playedthesecond-mostsnaps(39)onthedefensivelineand registeredapassdefensed...At Indianapolis (Nov. 22): Playedon 44defensivesnaps(No.2ontheDL)andrecordedatackle (solo). 2020 SEASON:Startedall10contests,recording16tackles(eight
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 12/18/16 GB@CHI W P 2 0 2 0.0 0 0 0 0 0 0 0 0 9/28/17 GBvs.CHI WS 1 0 1 0.0 0 0 0 0 0 0 0 0 11/12/17 GB@CHI WS 1 0 1 0.0 0 0 0 0 0 0 0 0 9/9/18 GBvs.CHI WP 1 1 0 0.0 0 0 1 0 0 0 0 0 12/16/18 GB@CHI LS 5 2 3 0.0 0 0 0 0 0 0 1 1 9/5/19 GB@CHI WS 4 1 3 0.0 0 0 0 0 1 0 0 0 12/15/19 GBvs.CHI WS 1 0 1 0.0 0 1 0 1 0 0 0 0 TOTALS 6/1 7/5 15 4 11 0.0 0 1 1 1 1 0 1 1
DEAN LOWRY'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2016 Packers 15 0 14 8 6 3 20 2.0 19.0 2 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 2017 Packers 16 11 34 22 12 5 28 2.0 21.0 5 0 0 0 0 2 0 1 62 0 0 0 0 0 0 0 2018 Packers 16 8 57 39 18 6 27 3.0 23.0 4 0 0 0 0 4 1 1 0 0 0 0 0 0 0 0 2019 Packers 16 16 62 33 29 5 2 0.0 0.0 9 1 7 7 0 2 0 1 0 0 0 0 0 0 0 0 2020 Packers 10 10 16 8 8 1 9 1.0 9.0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 NFL TOTALS 73 45 183 110 73 20 86 8.0 72.0 21 1 7 7 0 10 1 3 62 0 0 0 0 0 0 0
DEAN LOWRY'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2016 Packers 3 0 2 1 1 0 0 0.0 0.0 00 000000 00000000 2019 Packers 2 2 5 2 3 0 0 0.0 0.0 00 000000 00000000 NFL TOTALS 5 2 7 3 4 0 0 0.0 0.0 00 000000 00000000
2020GREENBAYPACKERS 55 SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 9vs.DenverBroncos,Sep22,2019 Fumble Recoveries 1vs.MinnesotaVikings,Sep15,2019 7atMinnesotaVikings,Dec23,2019 1atChicagoBears,Dec16,2018 Sacks 1.0vs.MinnesotaVikings,Nov01,2020 ...1moreat1. 1.0vs.ArizonaCardinals,Dec02,2018 Tackles For Loss 3vs.DenverBroncos,Sep22,2019 ...5moreat1.0. 2atMinnesotaVikings,Nov25,2018 Passes Defensed 2vs.DetroitLions,Dec30,2018 ...1moreat2. 1vs.JacksonvilleJaguars,Nov15,2020 Interceptions 1vs.ChicagoBears,Dec15,2019 ...7moreat1. Interception Return Yards 7vs.ChicagoBears,Dec15,2019 Forced Fumbles 1atChicagoBears,Dec16,2018 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings S 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions S 2 1 1 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints S 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons S 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers S 5 0 5 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans S 2 1 1 0.0 0.0 0 0 00 000000 00000000 W 35-20 11/01 Vikings S 3 3 0 1.0 9.0 1 9 1 0 000000 00000000 L 22-28 11/05 at49ers S 2 2 0 0.0 0.0 0 0 00 000000 00000000 W 34-17 11/15 Jaguars S 0 0 0 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 24-20 11/22 atColts S 1 1 0 0.0 0.0 0 0 00 000000 00000000 L 31-34+ 2020 TOTALS 10-10 16 8 8 1.0 9.0 1 9 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 56 2020 SEASON:Hasplayedinfourgameswiththreestarts, recording13tackles(10solo)andonetackleforaloss…Spent thefirstsixweeksoftheseasononinjuredreservebefore returningtothe53-manrosteronOct.24…Placedonthe reserve/COVIDlistonNov.3…Activatedfromreserve/COVIDlist onNov.9…At Houston (Oct. 25):Startedandplayed29 defensivesnapsinhisNFLdebut,makingsixtackles(allsolo) andatackleforaloss.OnHouston’sfirstdriveofthesecondhalf, pushedTEDarrenFellsintothebackfieldandmetRBDavid Johnsonfora1-yardloss,markingthefirsttackleofhisNFL career.Alsoplayedninesnapsonspecialteams…Vs. Minnesota (Nov. 1):Startedandrecordedthreetackles(onesolo)while appearingon42defensiveplays.Alsoappearedonthreeplayson specialteams…Vs. Jacksonville (Nov. 15):Played13snapson defenseand11snapsonspecialteams…At Indianapolis (Nov. 22):Startedandmadefourtackles(threesolo)whileplaying22 defensivesnaps.Alsogotinon14playsonspecialteams.
KAMAL MARTIN'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2020 Packers 4 3 13 10 3 1 0 0.0 0.0 00 000000 00000000 NFL TOTALS 4 3 13 10 3 1 0 0.0 0.0 00 000000 00000000
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 6atHoustonTexans,Oct25,2020 Tackles For Loss 1atHoustonTexans,Oct25,2020 4atIndianapolisColts,Nov22,2020 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings INJUREDRESERVE W 43-34 09/20 Lions INJUREDRESERVE W 42-21 09/27 atSaints INJUREDRESERVE W 37-30 10/05 Falcons INJUREDRESERVE W 30-16 10/18 atBuccaneers INJUREDRESERVE L 10-38 10/25 atTexans S 6 6 0 0.0 0.0 1 0 00 000000 00000000 W 35-20 11/01 Vikings S 3 1 2 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers RESERVE/COVID-19 W 34-17 11/15 Jaguars P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 24-20 11/22 atColts S 4 3 1 0.0 0.0 0 0 00 000000 00000000 L 31-34+ 2020 TOTALS 4-3 13 10 3 0.0 0.0 1 0 00 000000 00000000 7-3 +-Overtime
2020GREENBAYPACKERS 57 2020 SEASON: SignedwithGreenBayonSept.7andwas inactiveforfourofthefirstfivegames.Sufferedahamstring injuryinhisPackersdebutandwasplacedoninjuredreserveon Oct.20...At Minnesota (Sept. 13):Inactive(healthyscratch)...Vs. Detroit (Sept. 20):Inactive(healthyscratch)...At New Orleans (Sept. 27): Inactive(healthyscratch)...Vs. Atlanta (Oct. 5): Inactive(healthyscratch)...At Tampa Bay (Oct. 18): Sawhisfirst actionasaPacker,buthisdaywasendedaftertwoplayson specialteamsduetoahamstringinjury.
PARRY NICKERSON'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2018 Jets 16 2 19 16 3 1 7 0.0 0.0 0 0 0 0 0 1 0 0 0 2 2 0 0 0 0 0 2019 Jaguars 4 1 3 2 1 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 3 2 1 0 0 0 0 2020 Packers 1 0 0 0 0 0 0 0.0 0.0 00 000000 00000000 NFL TOTALS 21 3 22 18 4 1 7 0.0 0.0 0 0 0 0 0 1 0 0 0 5 4 1 0 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 6vs.MinnesotaVikings,Oct21,2018 Tackles For Loss 1vs.MinnesotaVikings,Oct21,2018 6vs.DenverBroncos,Oct07,2018 Special Teams Tackles 2atAtlantaFalcons,Dec22,2019 Passes Defensed 1vs.IndianapolisColts,Oct14,2018 1atOaklandRaiders,Dec15,2019 ...2moreat1. 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings INACTIVE W 43-34 09/20 Lions INACTIVE W 42-21 09/27 atSaints INACTIVE W 37-30 10/05 Falcons INACTIVE W 30-16 10/18 atBuccaneers P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans INJUREDRESERVE W 35-20 11/01 Vikings INJUREDRESERVE L 22-28 11/05 at49ers INJUREDRESERVE W 34-17 11/15 Jaguars INJUREDRESERVE W 24-20 11/22 atColts INJUREDRESERVE L 31-34+ 2020 TOTALS 1-0 0 0 0 0.0 0.0 0 0 00 000000 00000000 7-3 +-Overtime
2020GREENBAYPACKERS 58 firstNFLactionfromscrimmage,takingoveratLTforDavid BakhtiariforthefinalfiveplaysofthegamewiththePackers leading,42-21.Alsoappearedonsixplaysonspecialteams…At New Orleans (Sept. 27): Played seven snaps on special teams…Vs. Atlanta (Oct. 5):Appearedonfiveplaysonspecial teams…At Tampa Bay (Oct. 18):Playedtwosnapsonspecial teams…At Houston (Oct. 25):Appearedonfiveplaysonspecial teams…Vs. Minnesota (Nov. 1):Playedtwosnapsonspecial teams…At San Francisco (Nov. 5):PlayedLTforthefinalfour snapsofthegamewiththePackersholdingabiglead.Also playedsixsnapsonspecialteams…Vs. Jacksonville (Nov. 15): Appearedonfourplaysonspecialteams…At Indianapolis (Nov. 22): Playedfivesnapsonspecialteams. 2020 SEASON: Hasappearedinall10games,seeinglimited actiononoffenseandspecialteams…At Minnesota (Sept. 13): MadehisNFLdebut,appearingonsevenplaysonspecialteams (fieldgoalsandextrapoints)…Vs. Detroit (Sept. 20):Sawhis
YOSH NIJMAN'S NFL REGULAR SEASON STATISTICS
DATE TEAM GP GS 2020 Packers 10 0 NFL TOTALS 10 0
2020GREENBAYPACKERS 59 RBAaronJones’career-high168rushingyardsandtwoTDson 18carries(9.3avg.)asJonesfinishedwithacareer-best236 yardsfromscrimmage,thethirdmostinagameinfranchise history.Partofanoffensethatrackedup259yardsrushingon35 attempts(7.4avg.),thetopyardagetotalbyGreenBaysinceDec. 28,2003,vs.Denver(262yardson34carries).Alsowaspartofa linethatallowedjustonesackofRodgersontheafternoon…At New Orleans (Sept. 27):StartedatRGandplayedall62snapsas thelineallowedjustonesackontheeveningasthePackers becamethefirstteaminNFLhistorytoscore35-pluspointswith noturnoversineachofthefirstthreegamesoftheseason. ProtectedRodgersasheconnectedon21of32passesfor283 yardsandthreeTDsfora124.9rating…Vs. Atlanta (Oct. 5): StartedatRGandplayedall63snaps,helpingprotectRodgersas hewassackedjustonceontheeveningandcompleted27of33 passesfor327yardsandfourTDswithnoINTsfora147.5 rating…At Tampa Bay (Oct. 18):StartedatRGandplayedall63 snaps…At Houston (Oct. 25):StartedatRGandplayedall62 snaps,partofalinethatdidnotallowasackasRodgers connectedon23of34passesfor283yardsandfourTDswithno INTs(132.4rating)…Vs. Minnesota (Nov. 1):StartedatRGand playedall75snaps,partofalinethatallowedjustonesackas 2020 SEASON: Hasstartedall10games,openingnineatRGand Rodgerscompleted27of41passesfor291yardsandthreeTDs oneatLG…Partofalinethathasallowedonesackorzerosacks withnoINTs(110.9rating)…At San Francisco (Nov. 5):Started inaleague-bestninegames,thefirstNFLteamtodosointhe atRGandplayedall66snaps,helpingtoprotectRodgersashe first10gamesoftheseasonsince2008(threeteams)…Has wassackedjustonceontheeveningandasheconnectedon25 helpedthePackersrankNo.3inscoring(30.8ppg)andsacks of31passesfor305yardsandfourTDswithnoINTsfora147.2 allowed(11),tiedforNo.3ingiveaways(nine),No.7intotal rating…Vs. Jacksonville (Nov. 15):StartedatRGandplayedall offense(392.9ypg),No.6inpassingoffense(277.0ypg),No.3 65snaps,partofalinethatallowedonlyonesackonthedayas inyardsperplay(6.25),No.4inthird-downpercentage(47.9) Rodgersthrewfor325yardsandtwoTDswithoneINTon24- andNo.1intimeofpossession(32:27)…At Minnesota (Sept. of-34passing(108.1rating)…At Indianapolis (Nov. 22): Started 13): StartedatLG,appearingonthefirst32snapsofthegame atRGandplayedall60snaps,helpingtoprotectRodgersashe beforedepartinginthesecondquarterduetoashoulderinjury, wassackedjustonceandconnectedon27of38passesfor311 anddidnotreturn.Helpedtheoffenserackup271totalyardsin yardsandthreeTDswithoneINT(110.7rating). thefirsthalf…Vs. Detroit (Sept. 20):StartedatRGandplayedall 73snapswiththefirst65snapsatRGandthefinaleightatCin placeofaninjuredCoreyLinsley(hand).Helpedclearholesfor
LUCAS PATRICK'S NFL REGULAR SEASON STATISTICS
DATE TEAM GP GS 2017 Packers 12 2 2018 Packers 14 4 2019 Packers 14 0 2020 Packers 10 10 NFL TOTALS 50 16
LUCAS PATRICK'S NFL POSTSEASON STATISTICS
DATE TEAM GP GS 2019 Packers 2 0 NFL TOTALS 2 0
2020GREENBAYPACKERS 60 2020 SEASON:Hasplayedinsixgames,recordingfourspecial teamstacklesandappearingondefense…WasinactiveforWeeks 1-3(groin)andWeek8(healthyscratch)…Vs. Atlanta (Oct. 5): MadehisNFLdebut,playingeightdefensivesnapsandseven snapsonspecialteams…At Tampa Bay (Oct. 18):Appearedon 10playsondefenseand15playsonspecialteams…At Houston (Oct. 25):Playedsevensnapsonspecialteams…Vs. Minnesota (Nov. 1):Inactive(healthyscratch)…At San Francisco (Nov. 3): Postedateam-highthreespecialteamstackleson14snapswhile alsoplaying16snapsondefense.Whilecoveringapuntlatein thesecondquarter,tackledRBAustinWalterattheSanFrancisco 25tologthefirstspecialteamstackleofhiscareer…Vs. Jacksonville (Nov. 15):Appearedon25snapsonspecial teams…At Indianapolis (Nov. 22): Played three snaps on defenseand26snapsonspecialteams,recordingaspecial teamstackle.
RANDY RAMSEY'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2020 Packers 6 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 4 2 2 0 0 0 0 NFL TOTALS 6 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 4 2 2 0 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Special Teams Tackles 3atSanFrancisco49ers,Nov05,2020 1atIndianapolisColts,Nov22,2020 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings GAMEINACTIVE/INJURY W 43-34 09/20 Lions GAMEINACTIVE/INJURY W 42-21 09/27 atSaints GAMEINACTIVE/INJURY W 37-30 10/05 Falcons P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 35-20 11/01 Vikings INACTIVE L 22-28 11/05 at49ers P 0 0 0 0.0 0.0 0 0 00 000000 0 3 1 2 0 0 0 0 W 34-17 11/15 Jaguars P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 24-20 11/22 atColts P 0 0 0 0.0 0.0 0 0 00 000000 0 1 1 0 0 0 0 0 L 31-34+ 2020 TOTALS 6-0 0 0 0 0.0 0.0 0 0 00 000000 0 4 2 2 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 61 17tackles(11solo),twoquarterbackhits,onepassdefensedand three special teams tackles…Inactive in Weeks 9-10 (shoulder)…At Minnesota (Sept. 13):Appearedon24playson defenseand18playsonspecialteams,loggingtwotackles(both solo) on defense. Also posted one assisted special teams tackle…Vs. Detroit (Sept. 20):Playedon12snapsondefense and23snapsonspecialteams,finishingwithonesolotackle, onequarterbackhitandonepassdefensed…At New Orleans (Sept. 27):Playedon32snapsondefenseand24snapson specialteams,loggingthreetackles(twosolo)andonespecial teamstackle…Vs. Atlanta (Oct. 5):Appearedon39defensive plays,registeringfivetackles(threesolo)beforeexitingthegame inthefourthquarterwithaninjury.Alsoappearedon17playson special teams…At Tampa Bay (Oct. 18): Recorded one quarterbackhitwhileplaying22defensivesnaps.Alsoplayed23 snapsonspecialteams…At Houston (Oct. 18):Madehisfirst startoftheseasoninplaceofaninjuredDarnellSavageandmade aseason-highsixtackles(threesolo)whileplayingall68 defensivesnaps.Alsoplayedninesnapsonspecialteams…Vs. Minnesota (Nov. 1):Appearedonfourdefensiveplaysandfour playsonspecialteams…At San Francisco (Nov. 5):Inactive (shoulder)…Vs. Jacksonville (Nov. 15):Inactive(shoulder)…At Indianapolis (Nov. 22):Recordingatacklewhileplaying26 snapsonspecialteams.Alsogotinforonedefensiveplay. 2020 SEASON:Hasplayedineightgameswithonestart,logging
WILL REDMOND'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2018 Packers 5 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 2019 Packers 13 4 30 23 7 1 2 0.0 0.0 0 0 0 0 0 1 0 0 0 8 6 2 0 0 0 0 2020 Packers 8 1 17 11 6 0 0 0.0 0.0 2 0 0 0 0 1 0 0 0 3 2 1 0 0 0 0 NFL TOTALS 26 5 47 34 13 1 2 0.0 0.0 2 0 0 0 0 2 0 0 0 12 9 3 0 0 0 0
WILL REDMOND'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 2 0 1 1 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 NFL TOTALS 2 0 1 1 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 8vs.OaklandRaiders,Oct20,2019 Tackles For Loss 1atDallasCowboys,Oct06,2019 8vs.PhiladelphiaEagles,Sep26,2019 Special Teams Tackles 3atLosAngelesChargers,Nov03,2019 Passes Defensed 1vs.DetroitLions,Sep20,2020 3atDallasCowboys,Oct06,2019 1vs.DetroitLions,Oct14,2019 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings P 2 2 0 0.0 0.0 0 0 00 000000 0 1 0 1 0 0 0 0 W 43-34 09/20 Lions P 1 1 0 0.0 0.0 0 0 1 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 42-21 09/27 atSaints P 3 2 1 0.0 0.0 0 0 00 000000 0 1 1 0 0 0 0 0 W 37-30 10/05 Falcons P 5 3 2 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers P 0 0 0 0.0 0.0 0 0 1 0 000000 00000000 L 10-38 10/25 atTexans S 6 3 3 0.0 0.0 0 0 00 000000 00000000 W 35-20 11/01 Vikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers GAMEINACTIVE/INJURY W 34-17 11/15 Jaguars GAMEINACTIVE/INJURY W 24-20 11/22 atColts P 0 0 0 0.0 0.0 0 0 00 000000 0 1 1 0 0 0 0 0 L 31-34+ 2020 TOTALS 8-1 17 11 6 0.0 0.0 0 0 2 0 0 0 0 1 0 0 0 3 2 1 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 62 Orleans (Sept. 27):Posteda124.9passerrating,completing21 of32passes(65.6pct.)for283yardsandthreeTDswithno INTs.ThrewapairofTDpassestotightends,an18-yarderto MarcedesLewislateinthethirdquarteranda1-yardertoRobert Tonyanlateinthefourthquarter,hisfirstgamewithtwoTD passestoTEssinceNov.15,2015,vs.Detroit.Connectedwith Lazardforaseason-long72-yardcompletionontheopening driveofthesecondhalfdowntotheNewOrleans3,hisleague- best21stcompletionof70-plusyardssince2008.Added12 rushingyardsontwocarries(6.0avg.),highlightedbyaseason- long 13-yard pickup on a third-and-12 late in the first quarter…Vs. Atlanta (Oct. 5):Threwfor327yardsandfourTDs withnoINTson27-of-33passing(81.8pct.),justthethirdgame inhiscareerthathepostedacompletionpercentageof80-plus, 325-pluspassingyards,four-pluspassingTDsandzeroINTs(vs. Washingtonin2013,vs.Oaklandin2019).Completedall20of hispassestargetedforRBsandTEsasthosepositiongroups finishedwith20receptionsfor241yards(12.1avg.)andfour TDs,thethird-mostreceivingyardsbyGreenBay’sRBs/TEsina gamesincethe1970mergerbehindonlythe285yardsatTampa Bayin1980andthe269vs.Washingtonin1983.Itmarkedhis ninthcareergamewith325-pluspassingyards,four-pluspassing TDsandzeroINTsashemovedpastManningforthethirdmost all-timebehindDrewBrees(17)andTomBrady(12)…At Tampa Bay (Oct. 18):Completed16of35passes(45.7pct.)for160 yardswithtwoINTsfora35.4rating.Threwjusthisthirdcareer pick-sixwhenhewasinterceptedforaTDbyCBJamelDeanin thesecondquarteronhis6,215thcareerpassingattempt…At Houston (Oct. 25):Connectedon23of34passes(67.6pct.)for 283yardsandfourTDswithnoINTsfora132.4rating,his21st careergamewithfour-plusTDpassesandzeroINTs,thethird mostinNFLhistorybehindonlyBrees(25)andBrady(21). Posteda142.0passerratingonthirddown,connectingon7of 11passesfor125yardsandtwoTDs,withallsevenofthose completionsgoingtoAdams…Vs. Minnesota (Nov. 1):Threw for291yardsandthreeTDson27-of-41passing(65.9pct.)with noINTs,his51stcareergamewiththree-plusTDpassesandno INTs,tiedwithPeytonManningforthethirdmostinNFLhistory behindonlyBrady(60)andBrees(54).AllthreeofhisTDpasses 2020 SEASON: Hasstartedall10gamesandhascompleted240 wenttoAdams,justthesecondtimeinhiscareer(2012,James of352passes(68.2pct.)for2,889yardsand29TDswithfour JonesandJordyNelson)thathethrewthreeTDpassesina INTs(115.8rating)…RanksNo.1intheNFLinpasserrating,No. singlegametotwodifferentplayersinthesameseason(Tonyan 2inpassingTDsandTD/INTratio(7.25),No.5inyardsper inWeek4)…At San Francisco (Nov. 5):Threwfor305yardsand attempt(8.21)andNo.4ininterceptionpercentage(1.14)…Is fourTDswithnoINTson25-of-31passing(80.6pct.)fora147.2 oneofonlytwoQBsinNFLhistory(TomBrady,2007)tothrow passerrating.Itwashisfourthcareergamewith300-plus 29-plusTDpasseswithfourorfewerINTsinthefirst10games passingyards,four-pluspassingTDs,zeroINTsandacompletion oftheseason,havingnowdoneittwice(31/4in2011)…His29 percentageof80-plus,thesecondmostinNFLhistorybehind TDpassesarethesecondmostthrough10gamesinteamhistory onlyBrees(five).Threwa52-yardTDpasstoValdes-Scantling behindonlyhis31TDsin2011…Hasninegamesthisseason withjustundertwominutesremaininginthefirsthalf,his40th withatleasttwoTDpassesanda100-pluspasserrating,marking TDpassof50-plusyardssince2008,themostintheNFLover justthethirdtimeinNFLhistorythataQBhasdonesointhefirst thatspan.ThrewthreeTDpassesinthefirsthalf,thethirdtime 10games(Rodgers,10in2011;TomBrady,ninein2007)…Has thisseasonhehasdoneso,matchinghismostinaseason(2012 postedaleague-highfourgamesthisseasonwith300-plusyards and2016)…Vs. Jacksonville (Nov. 15):Completed24of34 andthree-pluspassingTDs…Hasaveraged8-plusyardsper passes(70.6pct.)for325yardsandtwoTDswithoneINTfora passing attempts in a league-high eight games this 108.1rating.Threwa78-yardTDpasstoValdes-Scantlingonthe season…RanksNo.6intheleaguewitha111.6passerratingon firstplayofthesecondquarter,hislongestcompletionsincean thirddown,completing60of94passesforaleague-high931 80-yardTDtoWRJordyNelsonvs.theN.Y.JetsonSept.14, yardsandeightTDs(No.4)withthreeINTs…Hascompleteda 2014.Itmarkedhis19thcareerTDpassof70-plusyards,tied league-high11passesof40-plusyardsontheseasonandfour withQBDrewBreesforthemostinNFLhistory.Addeda5-yard TDsof40-plusyards,tiedforNo.2intheNFL…Hasconnected TDrunwithjustovertwominutesremaininginthefirsthalf,the on41passesof20-plusyards,tiedforNo.1intheleague…Has 29thofhiscareerashemovedintoatiewithTobinRoteforthe rushedfor78yardsandaTDon17carries(4.6avg.)…At mostrushingTDsbyaquarterbackinfranchisehistory…At Minnesota (Sept. 13): Completed32of44passes(72.7pct.)for Indianapolis (Nov. 22): Connectedon27of38passesfor311 364yardsandfourTDswithnoINTsfora127.5rating,justthe yardsandthreeTDswithoneINT(110.7rating).ThrewthreeTD secondtimeinhiscareerthatheposted30-pluscompletions, passesinthefirsthalfforthefourthtimeontheseason,acareer 350-pluspassingyards,four-plusTDsandnoINTsinagame(vs. high(threegamesin2012and2016).Completeda47-yardpass Washington;Sept.15,2013).BecameonlythesecondNFL toValdes-ScantlingdownthemiddleofthefieldonGreenBay’s quarterbacktohitthosemarksinaseasonopenersincethe1970 game-tyingdrive,thefifthstraightgamehehadcompletedapass AFL-NFLmerger(AndrewLuck,2016).Connectedonfourpasses of45-plusyards,tiedforthelongeststreakofhiscareer(2011). of35-plusyards(45,40,39,38),matchinghissingle-game Appearedinhis191stcareergameinaGreenBayuniform, careerhigh(vs.SanFrancisco;Dec.5,2010).Completed20 movingintothetopfiveinfranchisehistoryashemovedpastLB passesfor337yardsandfourTDstoWRsDavanteAdams,Allen RayNitschke(190). LazardandMarquezValdes-Scantling,justthesecondtimesince theNFLmergerthatthePackershavehadaWRcorpsregister 20-pluscatchesfor300-plusyardsandfour-plusTDsinasingle game(vs.Denver;Oct.2,2011)…Vs. Detroit (Sept. 20): Connectedon18of30passes(60.0pct.)for240yardsandtwo TDswithnoINTsfora107.6rating.Postedthreecompletionsof 25-plusyardsontheafternoon(41-yardertoValdes-Scantling, 30-yardertoRBAaronJones,25-yardertoLazard)…At New
2020GREENBAYPACKERS 63
REGULAR SEASON COMPARISON: PASSING - CHICAGO BEARS DATE OPP W/L GP/GS C ATT YDS. AVG. TD LG INT SK SKYD RTG 11/16/08 GBvs.CHI W S 23 30 227 7.6 2 29 1 0 0 105.8 12/22/08 GB@CHI LS 24 39 260 6.7 2 35 1 0 0 87.6 9/13/09 GBvs.CHI WS 17 28 184 6.6 1 50 0 4 34 92.0 12/13/09 GB@CHI WS 16 24 180 7.5 0 25 0 3 23 88.9 9/27/10 GB@CHI LS 34 45 316 7.0 1 28 1 0 0 92.5 1/2/11 GBvs.CHI WS 19 28 229 8.2 1 46 1 2 5 89.7 9/25/11 GB@CHI WS 28 38 297 7.8 3 25 1 2 5 111.4 12/25/11 GBvs.CHI WS 21 29 283 9.8 5 55 0 0 0 142.7 9/13/12 GBvs.CHI WS 22 32 219 6.8 1 26 1 5 31 85.3 12/16/12 GB@CHI WS 23 36 291 8.1 3 31 0 3 13 116.8 11/4/13 GBvs.CHI LS 1 2 27 13.5 0 27 0 1 3 95.8 12/29/13 GB@CHI WS 25 39 318 8.2 2 48 2 3 5 85.2 9/28/14 GB@CHI WS 22 28 302 10.8 4 46 0 1 0 151.2 11/9/14 GBvs.CHI WS 18 27 315 11.7 6 73 0 0 0 145.8 9/13/15 GB@CHI WS 18 23 189 8.2 3 34 0 0 0 140.5 11/26/15 GBvs.CHI LS 22 43 202 4.7 1 32 1 2 14 62.4 10/20/16 GBvs.CHI WS 39 56 326 5.8 3 25 0 2 23 102.2 12/18/16 GB@CHI WS 19 31 252 8.1 0 60 0 4 27 87.0 9/28/17 GBvs.CHI WS 18 26 179 6.9 4 58 0 2 10 128.0 9/9/18 GBvs.CHI WS 20 30 286 9.5 3 75 0 2 19 130.7 12/16/18 GB@CHI LS 25 42 274 6.5 0 28 1 5 39 68.9 9/5/19 GB@CHI WS 18 30 203 6.8 1 47 0 5 37 91.4 12/15/19 GBvs.CHI WS 16 33 203 6.2 1 49 0 1 11 78.2 TOTALS 18/5 23/23 488 739 5,562 7.5 47 75 10 47 299 --
POSTSEASON COMPARISON: PASSING - CHICAGO BEARS DATE OPP W/L GP/GS C ATT YDS. AVG. TD LG INT SK SKYD RTG 1/23/11 GB@CHI W S 17 30 244 8.1 0 26 2 1 8 55.4 TOTALS 1/0 1/1 17 30 244 8.1 0 26 2 1 8 --
AARON RODGERS' NFL REGULAR SEASON PASSING STATISTICS
DATE TEAM GP GS ATT. CMP. PCT. YDS AVG. TD INT. LG SK LST RATE 2005 Packers 3 0 16 9 56.3 65 4.1 0 1 16 3 28 39.8 2006 Packers 2 0 15 6 40.0 46 3.1 0 0 16 3 18 48.2 2007 Packers 2 0 28 20 71.4 218 7.8 1 0 43 3 24 106.0 2008 Packers 16 16 536 341 63.6 4,038 7.5 28 13 71t 34 231 93.8 2009 Packers 16 16 541 350 64.7 4,434 8.2 30 7 83t 50 306 103.2 2010 Packers 15 15 475 312 65.7 3,922 8.3 28 11 86t 31 193 101.2 2011 Packers 15 15 502 343 68.3 4,643 9.2 45 6 93t 36 219 122.5 2012 Packers 16 16 552 371 67.2 4,295 7.8 39 8 73 51 293 108.0 2013 Packers 9 9 290 193 66.6 2,536 8.7 17 6 83t 21 117 104.9 2014 Packers 16 16 520 341 65.6 4,381 8.4 38 5 80t 28 174 112.2 2015 Packers 16 16 572 347 60.7 3,821 6.7 31 8 65t 46 314 92.7 2016 Packers 16 16 610 401 65.7 4,428 7.3 40 7 66t 35 246 104.2 2017 Packers 7 7 238 154 64.7 1,675 7.0 16 6 72 22 168 97.2 2018 Packers 16 16 597 372 62.3 4,442 7.4 25 2 75t 49 353 97.6 2019 Packers 16 16 569 353 62.0 4,002 7.0 26 4 74t 36 284 95.4 2020 Packers 10 10 352 240 68.2 2,889 8.2 29 4 78t 11 108 115.8 TOTALS 191 184 6,413 4,153 64.8 49,835 7.8 393 88 93t 459 3,076 103.1
2020GREENBAYPACKERS 64 AARON RODGERS' NFL POSTSEASON PASSING STATISTICS
DATE TEAM GP GS ATT. CMP. PCT. YDS AVG. TD INT. LG SK LST RATE 2007 Packers 1 0 0 0 0.0 0 0.0 0 0 0 0 0 0.0 2009 Packers 1 1 42 28 66.7 423 10.1 4 1 44 5 19 121.4 2010 Packers 4 4 132 90 68.2 1,094 8.3 9 2 38 8 53 109.8 2011 Packers 1 1 46 26 56.5 264 5.7 2 1 21 4 23 78.5 2012 Packers 2 2 72 49 68.1 531 7.4 3 1 44 4 33 97.6 2013 Packers 1 1 26 17 65.4 177 6.8 1 0 26 4 20 97.8 2014 Packers 2 2 69 43 62.3 494 7.2 4 2 46t 3 26 91.1 2015 Packers 2 2 80 45 56.3 471 5.9 4 1 60 2 15 84.9 2016 Packers 3 3 128 80 62.5 1,004 7.8 9 2 42t 10 79 103.8 2019 Packers 2 2 66 47 71.2 569 8.6 4 2 65 5 38 104.9 TOTALS 19 18 661 425 64.3 5,027 7.6 40 12 65 45 306 100.0
AARON RODGERS' NFL REGULAR SEASON RUSHING STATISTICS
DATE TEAM NO. YDS. AVG. LG TD 2005 Packers 2 7 3.5 8 0 2006 Packers 2 11 5.5 6 0 2007 Packers 7 29 4.1 13 0 2008 Packers 56 207 3.7 21 4 2009 Packers 58 316 5.4 35 5 2010 Packers 64 356 5.6 27 4 2011 Packers 60 257 4.3 25 3 2012 Packers 54 259 4.8 27t 2 2013 Packers 30 120 4.0 18 0 2014 Packers 43 269 6.3 19 2 2015 Packers 58 344 5.9 18 1 2016 Packers 67 369 5.5 23 4 2017 Packers 24 126 5.3 18 0 2018 Packers 43 269 6.3 23 2 2019 Packers 46 183 4.0 17 1 2020 Packers 17 78 4.6 13 1 TOTALS 631 3,200 5.1 35 29
AARON RODGERS' NFL POSTSEASON RUSHING STATISTICS
DATE TEAM NO. YDS. AVG. LG TD 2007 Packers 0 0 0.0 0 0 2009 Packers 3 13 4.3 13 1 2010 Packers 14 54 3.9 25 2 2011 Packers 7 66 9.4 16 0 2012 Packers 5 40 8.0 17 0 2013 Packers 2 11 5.5 9 0 2014 Packers 4 8 2.0 12 0 2015 Packers 3 20 6.7 19 0 2016 Packers 8 62 7.8 28 0 2019 Packers 6 14 2.3 14 0 TOTALS 52 288 5.5 28 3
SINGLE-GAME HIGHS: QUARTERBACK Pass Attempts 61vs.DetroitLions,Nov15,2015 Passer Rating 158.3vs.OaklandRaiders,Oct20,2019 56vs.ChicagoBears,Oct20,2016 155.4atClevelandBrowns,Oct25,2009 Pass Completions 39vs.ChicagoBears,Oct20,2016 Rush Attempts 12atAtlantaFalcons,Nov28,2010 37atNewYorkJets,Dec23,2018 10atDetroitLions,Jan01,2017 Yards Passing 480vs.Washington,Sep15,2013 Rushing Yards 60atAtlantaFalcons,Oct30,2016 442atNewYorkJets,Dec23,2018 57atIndianapolisColts,Oct07,2012 ...1moreat442. Longest Runs 35vs.MinnesotaVikings,Nov01,2009 TD Passes 6vs.ChicagoBears,Nov09,2014 27tvs.DetroitLions,Dec09,2012 6atHoustonTexans,Oct14,2012 ...1moreat27. Long Passes 93tvs.St.LouisRams,Oct16,2011 Rushing TDs 2atNewYorkJets,Dec23,2018 86tvs.MiamiDolphins,Oct17,2010 2vs.DenverBroncos,Oct02,2011 Completion Percentage 86.4vs.CarolinaPanthers,Oct19,2014 82.8atMinnesotaVikings,Oct27,2013
2020GREENBAYPACKERS 65 SINGLE-GAME HIGHS - POSTSEASON: QUARTERBACK Pass Attempts 46vs.NewYorkGiants,Jan15,2012 Passer Rating 136.8atAtlantaFalcons,Jan15,2011 45atAtlantaFalcons,Jan22,2017 125.4vs.DallasCowboys,Jan11,2015 Pass Completions 31atSanFrancisco49ers,Jan19,2020 Rush Attempts 7vs.NewYorkGiants,Jan15,2012 31atAtlantaFalcons,Jan15,2011 7atChicagoBears,Jan23,2011 Yards Passing 423atArizonaCardinals,Jan10,2010 Rushing Yards 66vs.NewYorkGiants,Jan15,2012 366atAtlantaFalcons,Jan15,2011 46atAtlantaFalcons,Jan22,2017 TD Passes 4vs.NewYorkGiants,Jan08,2017 Longest Runs 28atAtlantaFalcons,Jan22,2017 4atArizonaCardinals,Jan10,2010 25atChicagoBears,Jan23,2011 Long Passes 65atSanFrancisco49ers,Jan19,2020 Rushing TDs 1atChicagoBears,Jan23,2011 60atArizonaCardinals,Jan16,2016 1atAtlantaFalcons,Jan15,2011 Completion Percentage 86.1atAtlantaFalcons,Jan15,2011 ...1moreat1. 79.5atSanFrancisco49ers,Jan19,2020
2020GREENBAYPACKERS 66 300-YARD PASSING GAMES (65): REGULAR SEASON DATE TEAM NO. YDS. AVG. LG TD 09/14/08 atLions 24 328 13.7 62 3 10/05/08 FALCONS 25 313 12.5 44t 3 11/02/08 atTitans 22 314 14.3 52 1 12/28/08 LIONS 21 308 14.7 71t 3 10/05/09 atVikings 26 384 14.8 62t 2 10/18/09 LIONS 29 358 12.3 47t 2 11/22/09 49ERS 32 344 10.8 64t 2 11/26/09 atLions 28 348 12.4 68 3 12/20/09 atSteelers 26 383 14.7 83t 3 09/27/10 atBears 34 316 9.3 28 1 10/17/10 DOLPHINS 18 313 17.4 86t 1 11/21/10 atVikings 22 301 13.7 47 4 11/28/10 atFalcons 26 344 13.2 35 1 12/26/10 GIANTS 25 404 16.2 80t 4 09/08/11 SAINTS 27 312 11.6 36 3 09/18/11 atPanthers 19 308 16.2 84t 2 10/02/11 BRONCOS 29 408 14.1 61 4 10/09/11 atFalcons 26 396 15.2 70t 2 10/16/11 RAMS 18 316 17.6 93t 3 10/23/11 atVikings 24 335 14.0 79t 3 11/24/11 atLions 22 307 14.0 65t 2 12/04/11 atGiants 28 369 13.2 33 4 09/09/12 49ERS 30 303 10.1 49 2 09/30/12 SAINTS 31 319 10.3 20 4 10/14/12 atTexans 24 338 14.1 48t 6 10/21/12 atRams 30 342 11.4 52 3 12/23/12 TITANS 27 342 12.7 34 3 12/30/12 atVikings 28 365 13.0 73 4 09/08/13 at49ers 21 333 15.9 38 3 09/15/13 WASHINGTON 34 480 14.1 57 4 10/13/13 atRavens 17 315 18.5 64t 1 12/29/13 atBears 25 318 12.7 48t 2 09/14/14 JETS 25 346 13.8 80t 3 09/28/14 atBears 22 302 13.7 46 4 10/26/14 atSaints 28 418 14.9 70t 1 11/09/14 BEARS 18 315 17.5 73t 6 11/16/14 EAGLES 22 341 15.5 64 3 11/30/14 PATRIOTS 24 368 15.3 45t 2 12/08/14 FALCONS 24 327 13.6 60t 3 12/21/14 atBuccaneers 31 318 10.3 30 1 09/28/15 CHIEFS 24 333 13.9 52 5 11/08/15 atPanthers 25 369 14.8 53t 4 11/15/15 LIONS 35 333 9.5 32 2 10/20/16 BEARS 39 326 8.4 25 3 11/13/16 atTitans 31 371 12.0 46 2 11/20/16 atWashington 26 351 13.5 47 3 11/28/16 atEagles 30 313 10.4 50 2 12/24/16 VIKINGS 28 347 12.4 48 4 01/01/17 atLions 27 300 11.1 39 4 09/10/17 SEAHAWKS 28 311 11.1 32t 1 09/17/17 atFalcons 33 343 10.4 33t 2 09/24/17 BENGALS 28 313 11.2 72 3 10/07/18 atLions 32 442 13.8 54 3 10/15/18 49ERS 25 425 17.0 60 2
2020GREENBAYPACKERS 67 11/15/18 atSeahawks 21 332 15.8 57 2 12/23/18 atJets 37 442 11.9 49t 2 09/26/19 EAGLES 34 422 12.4 58 2 10/20/19 RAIDERS 25 429 17.2 74t 5 10/27/19 atChiefs 23 305 13.3 67t 3 12/29/19 atLions 27 323 12.0 33 2 09/13/20 atVikings 32 364 11.4 45t 4 10/05/20 FALCONS 27 327 12.1 29 4 11/05/20 at49ers 25 305 12.2 52t 4 11/15/20 JAGUARS 24 325 13.5 78t 2 11/22/20 atColts 27 311 11.5 47 3 300-YARD PASSING GAMES (7): POSTSEASON DATE TEAM NO. YDS. AVG. LG TD 01/10/10 atCardinals 28 423 15.1 44 4 01/15/11 atFalcons 31 366 11.8 34 3 02/06/11 STEELERS 24 304 12.7 38 3 01/11/15 COWBOYS 24 316 13.2 46t 3 01/08/17 GIANTS 25 362 14.5 42t 4 01/15/17 atCowboys 28 355 12.7 35 2 01/19/20 at49ers 31 326 10.5 65 2 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) PASSING RUSHING DATE OPPONENT P/S ATT CMP YDS PCT Y/A Y/C TD INT LG SK/YD RATE ATT YDS LG TD W/L SCORE 09/13 atVikings S 44 32 364 72.7 8.3 11.4 4 0 45t 0/0 127.5 1 2 2 0 W 43-34 09/20 Lions S 30 18 240 60.0 8.0 13.3 2 0 41 1/11 107.6 2 12 8 0 W 42-21 09/27 atSaints S 32 21 283 65.6 8.8 13.5 3 0 72 1/12 124.9 2 12 13 0 W 37-30 10/05 Falcons S 33 27 327 81.8 9.9 12.1 4 0 29 1/12 147.5 1 5 5 0 W 30-16 10/18 atBuccaneers S 35 16 160 45.7 4.6 10.0 0 2 20 4/42 35.4 2 14 8 0 L 10-38 10/25 atTexans S 34 23 283 67.6 8.3 12.3 4 0 45t 0/0 132.4 0 0 0 0 W 35-20 11/01 Vikings S 41 27 291 65.9 7.1 10.8 3 0 45 1/0 110.9 2 9 7 0 L 22-28 11/05 at49ers S 31 25 305 80.6 9.8 12.2 4 0 52t 1/11 147.2 1 7 7 0 W 34-17 11/15 Jaguars S 34 24 325 70.6 9.6 13.5 2 1 78t 1/10 108.1 3 4 5t 1 W 24-20 11/22 atColts S 38 27 311 71.1 8.2 11.5 3 1 47 1/10 110.7 3 13 9 0 L 31-34+ 2020 TOTALS 10-10 352 240 2,889 68.2 8.2 12.0 29 4 78t 11/108 115.8 17 78 13 1 7-3 +-Overtime
2020GREENBAYPACKERS 68 placeofaninjuredLaneTaylor(knee)andappearingonthefinal 15snapsofthegame.Alsoplayedsevensnapsonspecial teams…Vs. Detroit (Sept. 20):Playedthefinaleightsnapsofthe gameatRGwithstarterLucasPatrickmovingtoCinplaceofan injuredCoreyLinsley(hand).Alsoappearedonsixplayson specialteams…At New Orleans (Sept. 27):Playedsevensnaps onspecialteams…Vs. Atlanta (Oct. 5):Appearedonfiveplays onspecialteams…At Tampa Bay (Oct. 18):Playedtwosnapson specialteams…At Houston (Oct. 25):CameinforElgtonJenkins atLGforthefinaltwosnapsofthegame(kneel-downs).Also playedfivesnapsonspecialteams…Vs. Minnesota (Nov. 1): Appearedontwoplaysonspecialteams…At San Francisco (Nov. 5):Sawhismostextensiveactionfromscrimmageasapro tothatpoint,takingoveratLGfortheentiresecondhalfashe playedall31snapswithJenkinsmovingtoLTandBillyTurner movingtoRTinplaceofaninjuredRickWagner(knee)…Vs. Jacksonville (Nov. 15):Appearedonfourplaysonspecial teams…At Indianapolis (Nov. 22): Sawhismostsignificant actionasapro,takingoveratLGonthethirdserieswithJenkins movingtoCinplaceofaninjuredLinsley(back).Playedthefinal 50snaps,helpingtoprotectQBAaronRodgersashewassacked justonceandconnectedon27of38passesfor311yardsand threeTDswithoneINT(110.7rating). 2020 SEASON: Hasplayedinall10games,seeingtimeon offenseandspecialteams…At Minnesota (Sept. 13): Madehis NFLdebut,enteringthegameatRGearlyinthefourthquarterin
JON RUNYAN'S NFL REGULAR SEASON STATISTICS
DATE TEAM GP GS 2020 Packers 10 0 NFL TOTALS 10 0
2020GREENBAYPACKERS 69 straightyearandplayedin46defensivesnapsandfiveonspecial teams,finishingtiedforNo.3ontheteamwithfivetackles(three solo)...Vs. Detroit (Sept. 20):Playedin54ofthe59defensive snaps,postingfourtackles(twosolo)...At New Orleans (Sept. 27): Sawactiononall61snapsandfinishedwithseventackles, includingrankingNo.2ontheteamwithfivesolotackles...Vs. Atlanta (Oct. 5): Finishedthirdontheteamwithfivesolotackles aspartofasix-tackleperformance,recordedapassdefensedand broughtdownRBToddGurleythreeyardsbehindthelineof scrimmageinthesecondquarterforatackleforaloss...At Tampa Bay (Oct. 18): Sawactionon43snapsandtiedforNo.4 ontheteamwithfivetackles(threesolo)buthisdaywaslimited duetoaquadricepinjurysufferedinthethirdquarter...At Houston (Oct. 25): Inactive(quadricep)...Vs. Minnesota (Nov. 1): ReturnedtoactionandwasoneoftwoPackers(AdrianAmos)to playall52defensivesnaps,postingfourtackles(twosolo)...At San Francisco (Nov. 5): Playedthethird-mostsnapsonthe defense(44)andalsosawactionontwospecialteamsplays. Postedatackle(solo)andpassdefensed,breakingupapass fromQBNickMullenstoTEJordanReedonthird-and-6toforce apuntinthesecondquarter...Vs. Jacksonville (Nov. 15): Saw actionon61snapsondefense(fourthmostontheteam),leading 2020 SEASON:Startedninecontestsandistiedfortheteamlead theteamwithtwopassesdefensedandtyingforNo.3onthe withfivepassesdefensedandisNo.4ontheteamwith43 teamwithfivetackles(foursolo)...At Indianapolis (Nov. 22): tackles(30solotacklesrankNo.2ontheteam)...Suffereda Postedsixtackles(foursolo),apassdefensedandhisfirstcareer quadricepinjuryinWeek6thatforcedhimtomissWeek7...At fumblerecovery,givingGreenBaytheballatitsown49-yardline. Minnesota (Sept. 13):Startedtheseasonopenerforthesecond ThePackersscoredontheensuingdrivetotakea7-0leadinthe firstquarter.
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 9/5/19 GB@CHI W S 3 3 0 0.0 0 0 0 1 1 0 0 0 12/15/19 GBvs.CHI WS 3 2 1 0.0 0 0 0 1 0 0 0 0 TOTALS 2/0 2/2 6 5 1 0.0 0 0 0 2 1 0 0 0
DARNELL SAVAGE'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 14 14 61 41 20 1 2 0.0 0.0 1 2 37 28 0 7 2 0 0 0 0 0 0 0 0 0 2020 Packers 9 9 43 30 13 1 3 0.0 0.0 0 0 0 0 0 5 0 1 0 0 0 0 0 0 0 0 NFL TOTALS 23 23 104 71 33 2 5 0.0 0.0 1 2 37 28 0 12 2 1 0 0 0 0 0 0 0 0
DARNELL SAVAGE'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 2 2 12 9 3 1 4 0.0 0.0 0 0 000000 00000000 NFL TOTALS 2 2 12 9 3 1 4 0.0 0.0 0 0 000000 00000000
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 7atNewOrleansSaints,Sep27,2020 Tackles For Loss 1vs.AtlantaFalcons,Oct05,2020 7vs.CarolinaPanthers,Nov10,2019 1atDetroitLions,Dec29,2019 ...2moreat7. Interceptions 1atNewYorkGiants,Dec01,2019 Passes Defensed 2vs.JacksonvilleJaguars,Nov15,2020 1vs.DenverBroncos,Sep22,2019 2vs.MinnesotaVikings,Sep15,2019 Interception Return Yards 28atNewYorkGiants,Dec01,2019 Forced Fumbles 1vs.Washington,Dec08,2019 9vs.ChicagoBears,Dec15,2019 1vs.MinnesotaVikings,Sep15,2019 Fumble Recoveries 1atIndianapolisColts,Nov22,2020
2020GREENBAYPACKERS 70 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings S 5 3 2 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions S 4 2 2 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints S 7 5 2 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons S 6 5 1 0.0 0.0 1 3 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 30-16 10/18 atBuccaneers S 5 3 2 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans GAMEINACTIVE/INJURY W 35-20 11/01 Vikings S 4 3 1 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers S 1 1 0 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 34-17 11/15 Jaguars S 5 4 1 0.0 0.0 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 W 24-20 11/22 atColts S 6 4 2 0.0 0.0 0 0 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 L 31-34+ 2020 TOTALS 9-9 43 30 13 0.0 0.0 1 3 0 0 0 0 0 5 0 1 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 71 44.8-yardgrossaverageanda35.6-yardnetaverageon30 punts, with nine punts inside the 20…Has recorded four touchbackson16kickoffs…At Minnesota (Sept. 13):Puntedone timefor40yards,athird-quarterkickthatwasdownedatthe Minnesota19…Vs. Detroit (Sept. 20):Placedallthreeofhis puntsinsidethe20whilepostinga42.7-yardgrossandnet average…At New Orleans (Sept. 27):Recordedonepuntlatein thesecondquarter,akickthattraveled38yardsandwasreturned 14yards…Vs. Atlanta (Oct. 5):Posteda40.5-yardgrossaverage anda30.5-yardnetaverageontwopunts…At Tampa Bay (Oct. 18):Puntedaseason-highseventimeswhilepostinga46.4-yard grossaverageanda42.1-yardnetaveragewithtwopuntsplaced insidethe20…At Houston (Oct. 25):Recordeda51.8-yardgross averageanda37.6-yardnetaverageonfourpunts,withone blockedpunt.Notchedaseason-long62-yardpuntmidway throughthefirstquarter,anddowneda47-yardpuntatthe2- yardlineinthesecondquarter…Vs. Minnesota (Nov. 1): Downedhislonepuntoftheday,a38-yarder,onMinnesota’s6- yardlinewhilealsokickingofffourtimesasCrosbybattledback andquadinjuries…At San Francisco (Nov. 5):Puntedthree timesfora51.3-yardgrossaverageanda40.3-yardnetaverage whilehandlingkickoffdutiesforthesecondstraightgame…Vs. Jacksonville (Nov. 15):Puntedfivetimes(43.0-yardgross average,20.4-yardnetaverage)withonepuntinsidethe20.Also recordedthreetouchbacksonfivekickoffs…At Indianapolis (Nov. 22):Bootedthreepuntsfora39.0-yardnetaverageanda 2020 SEASON:Hasappearedinall10gamesandhasposteda 36.0-yardgrossaverage.
REGULAR SEASON COMPARISON: PUNTING - CHICAGO BEARS DATE OPP W/L GP/GS NO. YDS. AVG. TB I20 LG 9/9/18 GBvs.CHI W P 4 192 48.0 0 1 58 12/16/18 GB@CHI LP 5 208 41.6 0 1 50 9/5/19 GB@CHI WP 9 428 47.6 0 5 63 12/15/19 GBvs.CHI WP 7 250 35.7 0 2 43 TOTALS 3/1 4/0 25 1,078 0.0 0 9 63
JK SCOTT'S NFL REGULAR SEASON PUNTING STATISTICS
OPP. NET DATE TEAM GP NO. YDS. AVG. RET. YDS. YDS. AVG. TB IN20 LG BK 2018 Packers 16 71 3,176 44.7 20 206 2,790 38.8 9 19 67 1 2019 Packers 16 77 3,386 44.0 26 233 3,073 39.9 4 29 66 0 2020 Packers 10 30 1,343 44.8 13 198 1,105 35.6 2 9 62 1 NFL TOTALS 42 178 7,905 44.4 59 637 6,968 38.7 15 57 67 2
JK SCOTT'S NFL POSTSEASON PUNTING STATISTICS
OPP. NET DATE TEAM GP NO. YDS. AVG. RET. YDS. YDS. AVG. TB IN20 LG BK 2019 Packers 2 8 345 43.1 2 36 309 38.6 0 2 62 0 NFL TOTALS 2 8 345 43.1 2 36 309 38.6 0 2 62 0
JK SCOTT'S NFL REGULAR SEASON KICKING STATISTICS
DATE TEAM GP FGM FGA PCT. LG XP XPA PCT. BLK PTS 2018 Packers 16 0 0 0.0 0 0 0 0.0 0 0 2019 Packers 16 0 0 0.0 0 0 0 0.0 0 0 2020 Packers 10 0 0 0.0 0 0 0 0.0 0 0 NFL TOTALS 42 0 0 0.0 0 0 0 0.0 0 0
2020GREENBAYPACKERS 72 JK SCOTT'S NFL POSTSEASON KICKING STATISTICS
DATE TEAM GP FGM FGA PCT. LG XP XPA PCT. BLK PTS 2019 Packers 2 0 0 0.0 0 0 0 0.0 0 0 NFL TOTALS 2 0 0 0.0 0 0 0 0.0 0 0
SINGLE-GAME HIGHS: PUNTER Punts 9atChicagoBears,Sep05,2019 Longest Punts 67atSeattleSeahawks,Nov15,2018 8vs.MinnesotaVikings,Sep15,2019 66vs.DenverBroncos,Sep22,2019 Gross Punting Yards 428atChicagoBears,Sep05,2019 Inside the 20 5atChicagoBears,Sep05,2019 381vs.MinnesotaVikings,Sep15,2019 3vs.DetroitLions,Sep20,2020 Gross Punting Avg 55.3vs.OaklandRaiders,Oct20,2019 ...2moreat3. 53.0vs.DenverBroncos,Sep22,2019 Pass Attempts 1atWashington,Sep23,2018 Net Punting Yards 392atChicagoBears,Sep05,2019 Special Teams Tackles 1atNewYorkJets,Dec23,2018 336vs.MinnesotaVikings,Sep15,2019 1atChicagoBears,Dec16,2018 Net Punting Avg 51.7vs.DetroitLions,Oct14,2019 47.3vs.DenverBroncos,Sep22,2019 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) OPP. NET W/L/ DATE OPPONENT NO. YDS. AVG. RET. YDS. YDS. AVG TB IN20 LG BK T SCORE 09/13 atVikings P 1 40 40.0 0 0 40 40.0 0 1 40 0 W 43-34 09/20 Lions P 3 128 42.7 0 0 128 42.7 0 3 54 0 W 42-21 09/27 atSaints P 1 38 38.0 1 14 24 24.0 0 0 38 0 W 37-30 10/05 Falcons P 2 81 40.5 0 0 61 30.5 1 0 44 0 W 30-16 10/18 atBuccaneers P 7 325 46.4 4 30 295 42.1 0 2 55 0 L 10-38 10/25 atTexans P 4 207 51.8 2 19 188 37.6 0 1 62 1 W 35-20 11/01 Vikings P 1 38 38.0 0 0 38 38.0 0 1 38 0 L 22-28 11/05 at49ers P 3 154 51.3 1 13 121 40.3 1 0 57 0 W 34-17 11/15 Jaguars P 5 215 43.0 3 113 102 20.4 0 1 59 0 W 24-20 11/22 atColts P 3 117 39.0 2 9 108 36.0 0 0 40 0 L 31-34+ 2020 TOTALS 10 30 1,343 44.8 13 198 1,105 35.6 2 9 62 1 7-3 +-Overtime
2020GREENBAYPACKERS 73 2020 SEASON: at Minnesota (Sept. 13): PlayedinfirstNFL game,seeingactionondefense(threesnaps)andspecialteams (sixsnaps).
VERNON SCOTT'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2020 Packers 12 0 3 3 0 2 4 1.0 1.0 1 0 0 0 0 0 0 0 0 3 3 0 0 0 0 0 NFL TOTALS 12 0 3 3 0 2 4 1.0 1.0 1 0 0 0 0 0 0 0 0 3 3 0 0 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 2vs.DetroitLions,Sep20,2020 Tackles For Loss 1atHoustonTexans,Oct25,2020 1atHoustonTexans,Oct25,2020 1vs.DetroitLions,Sep20,2020 Sacks 1.0vs.DetroitLions,Sep20,2020 Special Teams Tackles 1vs.AtlantaFalcons,Oct05,2020 1atNewOrleansSaints,Sep27,2020 ...1moreat1. 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions P 2 2 0 1.0 1.0 1 1 1 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 W 42-21 09/27 atSaints P 0 0 0 0.0 0.0 0 0 00 000000 0 1 1 0 0 0 0 0 W 37-30 10/05 Falcons P 0 0 0 0.0 0.0 0 0 00 000000 0 1 1 0 0 0 0 0 W 30-16 10/18 atBuccaneers P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans P 1 1 0 0.0 0.0 1 3 00 000000 00000000 W 35-20 11/01 Vikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers DIDNOTPLAY W 34-17 11/15 Jaguars DIDNOTPLAY W 24-20 11/22 atColts DIDNOTPLAY L 31-34+ 2020 TOTALS 7-0 3 3 0 1.0 1.0 2 4 1 0 0 0 0 0 0 0 0 3 3 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 74 36snapsandpostedacareer-high21yardsontworeceptions (10.5avg.),highlightedbyacareer-long19-yardcatchoverthe middledowntotheAtlanta6onathird-and-7inthefirst quarter…At Tampa Bay (Oct. 18):Posteda16-yardreceptionin sixsnapsofworkonoffenseandalsohandledpuntreturnsand kickoffreturnswithWRTylerErvinsidelined(wrist).Didnothave anyreturns,postingtwofaircatchesonpunts…At Houston (Oct. 25):Played29snapsonoffenseandnineonspecialteams, returningonepuntfor6yardswithtwofaircatchesandtwo kickoffsfor36yards(18.0avg.)…Vs. Minnesota (Nov. 1): Appearedon19playsonoffenseandhada6-yardreception.Also returnedtwokickoffsfor53yards(26.5avg.),includinga season-long27-yarder…At San Francisco (Nov. 5):Played23 snapsandhada3-yardreception…Vs. Jacksonville (Nov. 15): Inactive(shoulder)…At Indianapolis (Nov. 22): Postedacareer- 2020 SEASON: Hasappearedinsevengamesandhasfive highsevenkickoffreturnsforacareer-best138yards(19.7avg.), catchesfor46yards(9.2avg.)…Hasonepuntreturnfor6yards includinga30-yardreturnouttotheGreenBay34inthefirst withsixfaircatchesand11kickoffreturnsfor227yards(20.6 quarter. avg.)…Wassignedtotheactiverosterfromthepracticesquad onSept.26…At New Orleans (Sept. 27):Madehisseasondebut, appearingon23playsonoffense…Vs. Atlanta (Oct. 5):Played
DARRIUS SHEPHERD'S NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2019 Packers 6 0 1 1 1.0 1 0 0 0 0.0 0 0 2020 Packers 7 0 5 46 9.2 19 0 0 0 0.0 0 0 NFL TOTALS 13 0 6 47 7.8 19 0 0 0 0.0 0 0
DARRIUS SHEPHERD'S NFL REGULAR SEASON RETURN STATISTICS
KICKOFF RETURNS PUNT RETURNS DATE TEAM RET. YDS. AVG. LG TD NO. FC YDS. AVG. LG TD 2019 Packers 9 147 16.3 21 0 2 11 -9 -4.5 0 0 2020 Packers 11 227 20.6 30 0 1 6 6 6.0 6 0 NFL TOTALS 20 374 18.7 30 0 3 17 -3 -1.0 6 0
SINGLE-GAME HIGHS: RUSHING/RECEIVING Receptions 2vs.AtlantaFalcons,Oct05,2020 Longest Kickoff Return 30atIndianapolisColts,Nov22,2020 1atSanFrancisco49ers,Nov05,2020 27vs.MinnesotaVikings,Nov01,2020 ...3moreat1. Fair Catches 3vs.PhiladelphiaEagles,Sep26,2019 Receiving Yards 21vs.AtlantaFalcons,Oct05,2020 2atSanFrancisco49ers,Nov05,2020 16atTampaBayBuccaneers,Oct18,2020 ...5moreat2. Longest Receptions 19vs.AtlantaFalcons,Oct05,2020 Punt Return Yards 6atHoustonTexans,Oct25,2020 16atTampaBayBuccaneers,Oct18,2020 Longest Punt Return 6atHoustonTexans,Oct25,2020 All-purpose yards 138atIndianapolisColts,Nov22,2020 Punt Returns 1atHoustonTexans,Oct25,2020 79vs.DetroitLions,Oct14,2019 1vs.DetroitLions,Oct14,2019 Kickoff Returns 7atIndianapolisColts,Nov22,2020 ...1moreat1. 5vs.DetroitLions,Oct14,2019 Miscellaneous Tackles 1vs.PhiladelphiaEagles,Sep26,2019 Kickoff Return Yards 138atIndianapolisColts,Nov22,2020 87vs.DetroitLions,Oct14,2019
2020GREENBAYPACKERS 75 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RECEIVING RUSHING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings PRACTICESQUAD W 43-34 09/20 Lions PRACTICESQUAD W 42-21 09/27 atSaints P 0 0 0.0 0 0 0 0 0.0 0 0 W 37-30 10/05 Falcons P 2 21 10.5 19 0 0 0 0.0 0 0 W 30-16 10/18 atBuccaneers P 1 16 16.0 16 0 0 0 0.0 0 0 L 10-38 10/25 atTexans P 0 0 0.0 0 0 0 0 0.0 0 0 W 35-20 11/01 Vikings P 1 6 6.0 6 0 0 0 0.0 0 0 L 22-28 11/05 at49ers P 1 3 3.0 3 0 0 0 0.0 0 0 W 34-17 11/15 Jaguars GAMEINACTIVE/INJURY W 24-20 11/22 atColts P 0 0 0.0 0 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 7-0 5 46 9.2 19 0 0 0 0.0 0 0 7-3 +-Overtime
2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) KICKOFF RETURNS PUNT RETURNS DATE OPPONENT P/S RET YDS AVG LG TD NO FC YDS AVG LG TD W/L SCORE 09/13 atVikings PRACTICESQUAD W 43-34 09/20 Lions PRACTICESQUAD W 42-21 09/27 atSaints P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 37-30 10/05 Falcons P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 30-16 10/18 atBuccaneers P 0 0 0.0 0 0 0 2 0 0.0 0 0 L 10-38 10/25 atTexans P 2 36 18.0 19 0 1 2 6 6.0 6 0 W 35-20 11/01 Vikings P 2 53 26.5 27 0 0 0 0 0.0 0 0 L 22-28 11/05 at49ers P 0 0 0.0 0 0 0 2 0 0.0 0 0 W 34-17 11/15 Jaguars GAMEINACTIVE/INJURY W 24-20 11/22 atColts P 7 138 19.7 30 0 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 7-0 11 227 20.6 30 0 1 6 6 6.0 6 0 7-3 +-Overtime
2020GREENBAYPACKERS 76 20):Played55ofthepossible59defensivesnapsandrecorded threetackles(twosolo),ahalf-sackandaQBhit.Withjustover threeminutestoplayinthegame,splitasackofQBMattStafford withLBRashanGarytoforceafourth-and-16theLionsdidnot convert...At New Orleans (Sept. 27): Sawactionon58defensive snaps(mostforaGreenBayDLorLB)andtwospecialteams playsandtalliedthreetackles(twosolo)...Vs. Atlanta (Oct. 5): Postedtwoassistedtacklesandplayedon67defensivesnaps, whichtiedforthesecondmostontheteam...At Tampa Bay (Oct. 18): RegisteredasolotackleandQBhiton43defensive snaps...At Houston (Oct. 25): FinishedsecondamongLBswith 49snapsplayed,recordingthreetackles(twosolo)andatackle foraloss.BroughtQBDeshaunWatsondownforalossofayard onarunplayonfourth-and-1,givingGBtheballattheHOU46- yardline...Vs. Minnesota (Nov. 1): Sawactionon41defensive playsandtalliedthreetackles(allsolo)...At San Francisco (Nov. 5): Registeredtwotackles(onesolo),apassdefensedandtied fortheteamleadwithtwoQBhitson35defensivesnaps.Also appearedononeplayonspecialteams.PutpressureonQBNick Mullensearlyinthesecondquarter,forcingathrowthatwas interceptedbySRavenGreeneandreturnedtotheGB38-yard line.ThePackerswouldscoreaTDontheensuingdrivetotakea 14-3lead...Vs. Jacksonville (Nov. 15): TiedforNo.3ontheteam 2020 SEASON:Startedall10games,recording26tackles(19 withfivetackles(foursolo)whliealsoregisteringasack,two solo),1.5sacks,fiveQBhits(No.3ontheteam),fourtacklesfor tacklesforalossandaQBhit.Withunderaminuteandhalfto aloss(No.2ontheteam)andapassdefensed...At Minnesota playandGBprotectingafour-pointlead,sackedQBJakeLuton (Sept. 13):Playedon43defensivesnapsbutdidnotrecorda foralossof10yardsonthird-and-16,forcingafourth-and-26 statistic.ExtendedstreakofnevermissinganNFLgameinhis fromtheJAX48-yardlinethattheJaguarsdidnotconvert...At careerwithhis81regular-seasongamesplayedsince2015,tied Indianapolis (Nov. 22): Finishedwithfourtackles(threesolo) withKansasCityLBDamienWilsonandNewOrleansLBDamario andatackleforalosson67defensivesnaps. DavisforthemostamongNFLlinebackers...Vs. Detroit (Sept.
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 12/13/15 WAS@CHI W S 1 1 0 0.0 0 0 0 0 0 0 0 0 12/24/16 WAS@CHI WS 1 1 0 1.0 5 0 1 0 2 0 0 0 9/5/19 GB@CHI WS 8 3 5 1.5 11 0 1 1 5 0 0 0 12/15/19 GBvs.CHI WS 6 2 4 0.0 0 0 1 0 1 0 0 0 TOTALS 4/0 4/4 16 7 9 2.5 16 0 3 1 8 0 0 0
PRESTON SMITH'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2015 Washington 16 2 30 20 10 6 39 8.0 77.0 10 0 0 0 0 4 2 1 0 5 4 1 1 0 0 0 2016 Washington 16 16 38 22 16 8 37 4.5 31.5 12 1 22 22 0 3 0 0 0 0 0 0 0 0 0 0 2017 Washington 16 16 42 31 11 10 48 8.0 40.5 21 2 26 18 0 3 1 1 12 0 0 0 0 0 0 0 2018 Washington 16 16 53 30 23 5 26 4.0 32.5 16 1 3 3 0 3 0 1 1 0 0 0 0 0 0 0 2019 Packers 16 16 75 42 33 11 69 12.0 88.0 29 1 5 5 0 3 1 0 0 0 0 0 0 0 0 0 2020 Packers 10 10 26 19 7 4 11 1.5 12.5 5 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 NFL TOTALS 90 76 264 164 100 44 230 38.0 282.0 93 5 56 22 0 17 4 3 13 5 4 1 1 0 0 0
PRESTON SMITH'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2015 Washington 1 0 3 2 1 1 5 1.0 5.0 1 0 000000 00000000 2019 Packers 2 2 7 4 3 1 6 2.0 6.0 3 0 000000 00000000 NFL TOTALS 3 2 10 6 4 2 11 3.0 11.0 4 0 000000 00000000
2020GREENBAYPACKERS 77 SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 9vs.CarolinaPanthers,Nov10,2019 Tackles For Loss 2vs.JacksonvilleJaguars,Nov15,2020 9atLosAngelesChargers,Nov03,2019 2vs.CarolinaPanthers,Nov10,2019 Sacks 3.0vs.DenverBroncos,Sep22,2019 ...8moreat2. 3.0atPhiladelphiaEagles,Dec26,2015 Interceptions 1vs.MinnesotaVikings,Sep15,2019 Passes Defensed 1atSanFrancisco49ers,Nov05,2020 1vs.HoustonTexans,Nov18,2018 1atDetroitLions,Dec29,2019 ...3moreat1. ...15moreat1. Interception Return Yards 22vs.MinnesotaVikings,Nov13,2016 Forced Fumbles 1vs.DenverBroncos,Sep22,2019 18vs.ArizonaCardinals,Dec17,2017 1vs.DenverBroncos,Dec24,2017 Special Teams Tackles 1atDallasCowboys,Jan03,2016 ...2moreat1. 1vs.NewYorkGiants,Nov29,2015 Fumble Recoveries 1vs.DallasCowboys,Oct21,2018 ...3moreat1. 1vs.ArizonaCardinals,Dec17,2017 Special Teams Forced Fumbles 1vs.MiamiDolphins,Sep13,2015 ...1moreat1. 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings S 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions S 3 2 1 0.5 2.5 0 0 1 0 000000 00000000 W 42-21 09/27 atSaints S 3 1 2 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons S 2 2 0 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers S 1 1 0 0.0 0.0 0 0 1 0 000000 00000000 L 10-38 10/25 atTexans S 3 2 1 0.0 0.0 1 1 00 000000 00000000 W 35-20 11/01 Vikings S 3 3 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers S 2 1 1 0.0 0.0 0 0 2 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 34-17 11/15 Jaguars S 5 4 1 1.0 10.0 2 10 1 0 000000 00000000 W 24-20 11/22 atColts S 4 3 1 0.0 0.0 1 0 00 000000 00000000 L 31-34+ 2020 TOTALS 10-10 26 19 7 1.5 12.5 4 11 5 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 78 thefirsttwogamesoftheseason...At Minnesota (Sept. 13): Startedandsawactionon43snapsondefense,recordingtwo tackles(bothsolo),asack,atackleforalossandaQBhit.It markedthefourthyearinarowherecordedasackintheseason opener.Isoneofthreeplayers(CHIDTAkiemHicksandARILB ChandlerJones)toregisterasackinWeek1ineachofthelast fourseasons(2017-20).Midwaythroughthefirstquarter,sacked QBKirkCousinsonthird-and-eightforalossof7yards,forcinga punt.ThePackersensuingdrivestartedontheGB40-yardline andresultedinaTDtotakeaneight-pointlead...Vs. Detroit (Sept. 20):Playedthesecond-mostsnaps(56)onthedefense, postingfourtackles(threesolo),asack,atackleforalossand twoQBhits.TookdownQBMattStaffordonsecond-and-sixin thesecondquartertoforceathird-and-16fromtheDetroit1-yard line,andthenonthirddown,tackledRBAdrianPetersonaftera 4-yardgaintoforceapunt.ThePackers'ensuingdriveresultedin aTDandputGreenBayup,17-14...At New Orleans (Sept. 27): Playedon56defensivesnapsandsevenonspecialteams, recordingtwotackles(onesolo)andforcingandrecoveringa fumbleofQBTaysomHillattheGB43-yardlineearlyinthe fourthquarter.Theensuingdrivefinishedoffwithafieldgoalto givethePackersa30-27leadwithjustundernineminutesto play...Vs. Atlanta (Oct. 5): NamedNFCDefensivePlayerofthe Weekforthesecondtimeinhiscareer(2018)afterleadingthe teamwitheighttackles(sixsolo),threesacks,fourtacklesfora lossandfiveQBhits.Itwasthethirdthree-plussackgameofhis career(3.5atMINin2019and3.0atTENin2018)...At Tampa Bay (Oct. 25): In49defensiveplays,recordedatackleandaQB hit...At Houston (Oct. 25): Postedthreetackles(twosolo),asack, atackleforalossandtwoQBhitson50defensiveplays.Took downQBDeshaunWatsonforalossof6yardsinthesecond quarter,forcingathird-and-15thatHoustondidnotconvert...Vs. Minnesota (Nov. 1): Played47snapsondefenseandregistereda tackleforalossandfinishedNo.2ontheteamwithsixtackles (threesolo)...At San Francisco (Nov. 5): Playedon35defensive snapsandoneonspecialteams,recordingtwotackles(both solo),asack,twoQBhits,aforcedfumbleandafumblerecovery ondefense.Inthethirdquarter,forcedafumbleherecoveredon asackofQBNickMullenstogiveGBtheballattheSF47-yard line.ThePackers'ensuingdriveresultedinafieldgoaltotakea 2020 SEASON:Startedall10contestsandistiedforNo.4inthe 31-3lead...Vs. Jacksonville (Nov. 15): Postedfivetackles(four NFLwitheightsacks...Leadstheteamwith17QBhits(tiedfor solo),asack,atackleforalossandtwoQBhits.TookdownQB No.6intheNFL)and10tacklesforaloss(tiedforNo.5inthe JakeLutononthirdand8inthethirdquartertoforceapunt...At NFL)...Forthefirsttimeinhiscareer,registeredasackineachof Indianapolis (Nov. 22): Finishedwithsixtackles(fivesolo),a tackleforaloss,twoQBhitsandapassdefensed.
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 10/15/17 BLTvs.CHI L P 0 0 0 0.0 0 0 0 0 1 0 0 0 9/5/19 GB@CHI WS 5 4 1 1.0 1 0 1 0 6 0 0 0 12/15/19 GBvs.CHI WS 3 1 2 0.0 0 0 0 0 2 0 0 0 TOTALS 2/1 3/2 8 5 3 1.0 1 0 1 0 9 0 0 0
ZA'DARIUS SMITH'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2015 Ravens 15 0 30 20 10 7 28 5.5 24.5 7 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 2016 Ravens 13 4 20 10 10 4 16 1.0 9.0 4 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 2017 Ravens 14 4 24 15 9 3 16 3.5 22.0 16 0 0 0 0 1 1 0 0 0 0 0 0 0 0 0 2018 Ravens 16 8 45 26 19 10 56 8.5 61.0 25 0 0 0 0 2 1 0 0 0 0 0 0 0 0 0 2019 Packers 16 16 78 44 34 19 126 13.5 112.5 51 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 2020 Packers 10 10 39 28 11 10 53 8.0 59.0 17 0 0 0 0 1 2 2 0 0 0 0 0 0 0 0 NFL TOTALS 84 42 236 143 93 53 295 40.0 288.0 120 0 0 0 0 6 6 2 0 0 0 0 0 0 0 0
2020GREENBAYPACKERS 79 ZA'DARIUS SMITH'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2018 Ravens 1 1 1 1 0 0 0 0.0 0.0 00 000000 00000000 2019 Packers 2 2 9 5 4 1 4 2.0 4.0 3 0 000000 00000000 NFL TOTALS 3 3 10 6 4 1 4 2.0 4.0 3 0 000000 00000000
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 10atLosAngelesChargers,Nov03,2019 Forced Fumbles 1atSanFrancisco49ers,Nov05,2020 8vs.AtlantaFalcons,Oct05,2020 1atNewOrleansSaints,Sep27,2020 ...1moreat8. ...4moreat1. Sacks 3.5atMinnesotaVikings,Dec23,2019 Fumble Recoveries 1atSanFrancisco49ers,Nov05,2020 3.0vs.AtlantaFalcons,Oct05,2020 1atNewOrleansSaints,Sep27,2020 ...1moreat3.0. Tackles For Loss 5atMinnesotaVikings,Dec23,2019 Passes Defensed 1atIndianapolisColts,Nov22,2020 4vs.AtlantaFalcons,Oct05,2020 1vs.CincinnatiBengals,Nov18,2018 ...4moreat1. 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings S 2 2 0 1.0 7.0 1 7 1 0 000000 00000000 W 43-34 09/20 Lions S 4 3 1 1.0 10.0 1 10 2 0 000000 00000000 W 42-21 09/27 atSaints S 2 1 1 0.0 0.0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 W 37-30 10/05 Falcons S 8 6 2 3.0 25.0 4 27 5 0 000000 00000000 W 30-16 10/18 atBuccaneers S 1 0 1 0.0 0.0 0 0 1 0 000000 00000000 L 10-38 10/25 atTexans S 3 2 1 1.0 6.0 1 6 2 0 000000 00000000 W 35-20 11/01 Vikings S 6 3 3 0.0 0.0 1 1 00 000000 00000000 L 22-28 11/05 at49ers S 2 2 0 1.0 9.0 0 0 2 0 0 0 0 0 1 1 0 0 0 0 0 0 0 0 W 34-17 11/15 Jaguars S 5 4 1 1.0 2.0 1 2 2 0 000000 00000000 W 24-20 11/22 atColts S 6 5 1 0.0 0.0 1 0 2 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 L 31-34+ 2020 TOTALS 10-10 39 28 11 8.0 59.0 10 53 17 0 0 0 0 1 2 2 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 80 2020 SEASON: Hasplayedinfivegameswithonestartandhas beeninactiveforonecontest…Haspostedonereceptionfor12 yardsandatackleonspecialteams…Wasplacedoninjured reserve(knee)onSept.19andthenwasactivatedfrominjured reserveonOct.17…At Minnesota (Sept. 13): Inactive(healthy scratch)…At Tampa Bay (Oct. 18):Played11snapsonoffense andsixonspecialteams…At Houston (Oct. 25):Appearedon threeplaysonoffenseandnineonspecialteams,downingaJK ScottpuntattheHouston2-yardlineinthesecondquarter…Vs. Minnesota (Nov. 1):Played22snapsonoffenseandposteda 12-yardreception.Alsoappearedoneightplaysonspecialteams andrecordedatackle…At San Francisco (Nov. 5):Playedfour snapsonoffenseandfiveonspecialteams…Vs. Jacksonville (Nov. 15):Appearedon31playsonoffense…At Indianapolis (Nov. 22): StartedasthethirdWRforthefirsttimeonthe season,appearingon15snapsonoffense…Posteda23-yard reception,takingascreenpassdowntotheIndianapolis2-yard linetosetupRBAaronJones’2-yardTDrunonthenextplay.
REGULAR SEASON COMPARISON: RECEIVING - CHICAGO BEARS DATE OPP W/L GP/GS REC YDS. AVG. TD LG TGTS YAC 12/16/18 GB@CHI L P 1 7 7.0 0 7 3 7 TOTALS 0/1 1/0 1 7 7.0 0 7 3 7
EQUANIMEOUS ST. BROWN'S NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2018 Packers 12 7 21 328 15.6 54 0 1 5 5.0 5 0 2020 Packers 6 1 2 35 17.5 23 0 0 0 0.0 0 0 NFL TOTALS 18 8 23 363 15.8 54 0 1 5 5.0 5 0
SINGLE-GAME HIGHS: RUSHING/RECEIVING Rush Attempts 1atMinnesotaVikings,Nov25,2018 Receiving Yards 94atNewYorkJets,Dec23,2018 Rushing Yards 5atMinnesotaVikings,Nov25,2018 89atDetroitLions,Oct07,2018 Longest Runs 5atMinnesotaVikings,Nov25,2018 Longest Receptions 54atDetroitLions,Oct07,2018 Receptions 5atNewYorkJets,Dec23,2018 34atNewYorkJets,Dec23,2018 3atMinnesotaVikings,Nov25,2018 All-purpose yards 94atNewYorkJets,Dec23,2018 ...1moreat3. 89atDetroitLions,Oct07,2018 Special Teams Tackles 1vs.MinnesotaVikings,Nov01,2020 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RECEIVING RUSHING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings GAMEINACTIVE/INJURY W 43-34 09/20 Lions INJUREDRESERVE W 42-21 09/27 atSaints INJUREDRESERVE W 37-30 10/05 Falcons INJUREDRESERVE W 30-16 10/18 atBuccaneers P 0 0 0.0 0 0 0 0 0.0 0 0 L 10-38 10/25 atTexans P 0 0 0.0 0 0 0 0 0.0 0 0 W 35-20 11/01 Vikings P 1 12 12.0 12 0 0 0 0.0 0 0 L 22-28 11/05 at49ers P 0 0 0.0 0 0 0 0 0.0 0 0 W 34-17 11/15 Jaguars P 0 0 0.0 0 0 0 0 0.0 0 0 W 24-20 11/22 atColts S 1 23 23.0 23 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 6-1 2 35 17.5 23 0 0 0 0.0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 81 catchesofhiscareerintheregularseason,haulinginthree passesfor36yards(12.0avg.).Hisfirstgrabcameearlyinthe fourthquarterashemadeacatchintheflatandtookittookthe sidelinefora12-yardpickup.Laterinthequarter,madeaback- shouldercatchforacareer-long23-yardgaintotheNewOrleans 31onascoringdrivethatwouldputGreenBayahead, 37-27…Vs. Atlanta (Oct. 5):Played14snapsonoffenseand fouronspecialteams…At Tampa Bay (Oct. 18):Appearedon20 playsonoffenseandtwoonspecialteams…At Houston (Oct. 25):Played20snapsonoffenseandpostedhisfirstcareer regular-seasonTDcatch,comingacrossthefieldtomakealeft- handedgrabfora3-yardscoreearlyinthesecondquarter…Vs. Minnesota (Nov. 1):Appearedon28playsonoffenseandposted acareer-high46receivingyardsonthreecatches(15.3avg.), includingacareer-long27-yarderdowntotheMinnesota7with justunderthreeminutesremaininginthegamethatsetupaWR DavanteAdamsTDcatchonthenextplay…At San Francisco (Nov. 5):Played18snapsandhada1-yardreception…Vs. Jacksonville (Nov. 15):Played20snapsonoffenseandfiveon specialteams…At Indianapolis (Nov. 22): Played16snapson offenseand10onspecialteams,postingthreereceptionsfor23 2020 SEASON: Hasplayedinall10games,seeingactionon yards(7.7avg.). offenseandspecialteams,andhas11receptionsfor109yards (9.9avg.)andaTD…At Minnesota (Sept. 13): Appearedon12 snapsonoffenseand13onspecialteams…Vs. Detroit (Sept. 20):Played16snapsonoffenseand16onspecialteams…At New Orleans (Sept. 27):Played20snapsandpostedthefirst
JACE STERNBERGER'S NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2019 Packers 6 1 0 0 0.0 0 0 0 0 0.0 0 0 2020 Packers 10 0 11 109 9.9 27 1 0 0 0.0 0 0 NFL TOTALS 16 1 11 109 9.9 27 1 0 0 0.0 0 0
JACE STERNBERGER'S NFL POSTSEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2019 Packers 2 1 3 15 5.0 8t 1 0 0 0.0 0 0 NFL TOTALS 2 1 3 15 5.0 8t 1 0 0 0.0 0 0
SINGLE-GAME HIGHS: RUSHING/RECEIVING Receptions 3atIndianapolisColts,Nov22,2020 All-purpose yards 46vs.MinnesotaVikings,Nov01,2020 3vs.MinnesotaVikings,Nov01,2020 36atNewOrleansSaints,Sep27,2020 ...1moreat3. Special Teams Tackles 1vs.CarolinaPanthers,Nov10,2019 Receiving Yards 46vs.MinnesotaVikings,Nov01,2020 Most TDs 1atHoustonTexans,Oct25,2020 36atNewOrleansSaints,Sep27,2020 Longest Receptions 27vs.MinnesotaVikings,Nov01,2020 23atNewOrleansSaints,Sep27,2020 Receiving TDs 1atHoustonTexans,Oct25,2020
2020GREENBAYPACKERS 82 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RECEIVING RUSHING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings P 0 0 0.0 0 0 0 0 0.0 0 0 W 43-34 09/20 Lions P 0 0 0.0 0 0 0 0 0.0 0 0 W 42-21 09/27 atSaints P 3 36 12.0 23 0 0 0 0.0 0 0 W 37-30 10/05 Falcons P 0 0 0.0 0 0 0 0 0.0 0 0 W 30-16 10/18 atBuccaneers P 0 0 0.0 0 0 0 0 0.0 0 0 L 10-38 10/25 atTexans P 1 3 3.0 3t 1 0 0 0.0 0 0 W 35-20 11/01 Vikings P 3 46 15.3 27 0 0 0 0.0 0 0 L 22-28 11/05 at49ers P 1 1 1.0 1 0 0 0 0.0 0 0 W 34-17 11/15 Jaguars P 0 0 0.0 0 0 0 0 0.0 0 0 W 24-20 11/22 atColts P 3 23 7.7 12 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 10-0 11 109 9.9 27 1 0 0 0.0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 83 career touchdown, intercepting QB Matthew Stafford’s pass intendedforWRDannyAmendolaattheDetroit7andreturningit forthescore.BecamethefirstPackerwithapick-sixsinceCB BashaudBreelandvs.AtlantaonDec.9,2018…At New Orleans (Sept. 27):Recordedtwotackles(bothsolo)whileplayingon44 snapsondefenseand12snapsonspecialteams.Onathird- and-4playmidwaythroughthefourthquarter,sniffedouta screenpasstodropRBAlvinKamarafornogainandforcea punt…Vs. Atlanta (Oct. 5): Played three defensive snaps, registeringoneassistedtacklebeforeexitingthegamewitha concussion.Alsoplayedtwosnapsonspecialteams…At Tampa Bay (Oct. 18):Startedandrecordedthreetackles(onesolo)while appearingon46defensiveplays.Alsoplayedsevensnapson specialteams…At Houston (Oct. 25):Startedandmadethree tackles(allsolo)andonepassdefensedonaseason-high63 defensivesnaps.Alsoplayedonesnaponspecialteams…Vs. Minnesota (Nov. 1):Madeonesolotacklewhileappearingon13 defensiveplays.Alsoplayedeightsnapsonspecialteams…At San Francisco (Nov. 5):Startedandpostedanassistedtackle whileappearingon35defensiveplays.Alsoappearedonfive 2020 SEASON:Hasappearedinall10gameswithsixstartsand snapsonspecialteams…Vs. Jacksonville (Nov. 15):Startedand hasrecorded25tackles(19solo),fourpassesdefensedandone sawactiononall64defensivesnaps,recordingacareer-highsix interception, which he returned 7 yards for a score…At tackles(allsolo)whileplayingasabasecornerwithCBsKevin Minnesota (Sept. 13):Played36snapsondefenseand11snaps KingandJaireAlexanderbothinactivewithinjuries.Alsoplayed on special teams…Posted three tackles (two solo) on fivesnapsonspecialteams…At Indianapolis (Nov. 22):Started defense…Vs. Detroit (Sept. 20):Madethesecondstartofhis asthethirdcornerandpostedfivetackles(foursolo)andapass careerandfirstinaPackeruniform,appearingon43defensive defensedwhileappearingon73defensiveplays.Alsogotinon12 snapsand13snapsonspecialteams.Registeredonesolotackle, playsonspecialteams. twopassesdefensedandreturnedaninterceptionforhisfirst
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 12/15/19 GBvs.CHI W P 3 2 1 0.0 0 0 0 1 1 0 1 0 TOTALS 1/0 1/0 3 2 1 0.0 0 0 0 1 1 0 1 0
CHANDON SULLIVAN'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2018 Eagles 5 1 11 7 4 0 0 0.0 0.0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 2019 Packers 16 0 26 17 9 0 0 0.0 0.0 1 1 7 7 0 8 1 0 0 2 1 1 0 0 0 0 2020 Packers 10 6 25 19 6 0 0 0.0 0.0 0 1 7 7t 1 4 0 0 0 0 0 0 0 0 0 0 NFL TOTALS 31 7 62 43 19 0 0 0.0 0.0 1 2 14 7t 1 13 1 0 0 2 1 1 0 0 0 0
CHANDON SULLIVAN'S NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 2 1 1 1 0 0 0 0.0 0.0 00 000000 00000000 NFL TOTALS 2 1 1 1 0 0 0 0.0 0.0 00 000000 00000000
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 6vs.JacksonvilleJaguars,Nov15,2020 Interceptions 1vs.DetroitLions,Sep20,2020 6atNewOrleansSaints,Nov18,2018 1atDallasCowboys,Oct06,2019 Passes Defensed 2vs.DetroitLions,Sep20,2020 Interception Return Yards 7vs.DetroitLions,Sep20,2020 2atDetroitLions,Dec29,2019 7atDallasCowboys,Oct06,2019 Forced Fumbles 1vs.ChicagoBears,Dec15,2019 Special Teams Tackles 1atNewYorkGiants,Dec01,2019 1vs.CarolinaPanthers,Nov10,2019
2020GREENBAYPACKERS 84 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings P 2 1 1 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions S 1 1 0 0.0 0.0 0 0 0 1 7 7 1 2 0 0 0 0 0 0 0 0 0 0 W 42-21 09/27 atSaints P 2 2 0 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons P 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers S 3 1 2 0.0 0.0 0 0 00 000000 00000000 L 10-38 10/25 atTexans S 3 3 0 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 35-20 11/01 Vikings P 1 1 0 0.0 0.0 0 0 00 000000 00000000 L 22-28 11/05 at49ers S 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 34-17 11/15 Jaguars S 6 6 0 0.0 0.0 0 0 00 000000 00000000 W 24-20 11/22 atColts S 5 4 1 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 L 31-34+ 2020 TOTALS 10-6 25 19 6 0.0 0.0 0 0 0 1 7 7t 1 4 0 0 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 85 recordateam-leadingninetackles(sixsolo)whileplaying44 defensivesnaps,thefirstdefensiveactionofhiscareer.With6:30 remaininginthesecondquarter,combinedwithLBKrysBarnes tobringdownRBLataviusMurray,thefirsttackleofhisNFL career.Midwaythroughthefourthquarter,madeashoestring tackleofWRDeonteHarrisonacrossingroutetonegateabig gain.Alsoplayed19snapsonspecialteams…Vs. Atlanta (Oct. 5):Madehisfirstcareerstart,registeringseventackles(sixsolo) on52defensivesnaps.Alsoplayed18snapsonspecial teams…At Tampa Bay (Oct. 18):Recordedfourtackles(two solo)whileplaying22defensivesnaps.Alsorecordedonespecial teamstacklewhileplaying25specialteamssnaps…At Houston (Oct. 25):Postedtwotackles(bothsolo)on18defensivesnaps afterfillinginforaninjuredBarnesearlyinthesecondhalf.Also madeonetackleon24specialteamssnaps…Vs. Minnesota (Nov. 1):Sawactionon17specialteamssnaps,makingone tackle…At San Francisco (Nov. 5):SteppedinforinjuredLB KrysBarnesinthesecondhalf,recordingfourtackles(threesolo) whileplaying34snapsondefense.Alsoappearedon15special teamssnaps.Earlyinthefourthquarter,combinedwithLB 2020 SEASON:Hasplayedinall10gameswithonestart, RashanGarytostuffQBNickMullensfornogainonfourth-and-1 recording27tackles(19solo)…RanksNo.2ontheteamwith from the Green Bay 5-yard line, forcing a turnover on five tackles on special teams…At Minnesota (Sept. 13): downs…Vs. Jacksonville (Nov. 15):Appearedon25special Appearedonateam-high19snapsonspecialteams…Vs. Detroit teamsplaysandrecordedatackle…At Indianapolis (Nov. 22): (Sept. 20):Appearedon23snapsonspecialteams…At New Postedanassistedtacklewhileplayingthreedefensivesnaps. Orleans (Sept. 27):SteppedinforinjuredLBChristianKirkseyto Alsoplayed26snapsonspecialteams,recordingonetackle.
TY SUMMERS' NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 16 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 4 2 2 0 0 0 0 2020 Packers 10 1 27 19 8 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 5 2 3 0 0 0 0 NFL TOTALS 26 1 27 19 8 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 9 4 5 0 0 0 0
TY SUMMERS' NFL POSTSEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2019 Packers 2 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 2 0 2 0 0 0 0 NFL TOTALS 2 0 0 0 0 0 0 0.0 0.0 0 0 0 0 0 0 0 0 0 2 0 2 0 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 9atNewOrleansSaints,Sep27,2020 Special Teams Tackles 1atIndianapolisColts,Nov22,2020 7vs.AtlantaFalcons,Oct05,2020 1vs.JacksonvilleJaguars,Nov15,2020 ...7moreat1. 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 43-34 09/20 Lions P 0 0 0 0.0 0.0 0 0 00 000000 00000000 W 42-21 09/27 atSaints P 9 6 3 0.0 0.0 0 0 00 000000 00000000 W 37-30 10/05 Falcons S 7 6 1 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers P 4 2 2 0.0 0.0 0 0 00 000000 0 1 1 0 0 0 0 0 L 10-38 10/25 atTexans P 2 2 0 0.0 0.0 0 0 00 000000 0 1 0 1 0 0 0 0 W 35-20 11/01 Vikings P 0 0 0 0.0 0.0 0 0 00 000000 0 1 1 0 0 0 0 0 L 22-28 11/05 at49ers P 4 3 1 0.0 0.0 0 0 00 000000 00000000 W 34-17 11/15 Jaguars P 0 0 0 0.0 0.0 0 0 00 000000 0 1 0 1 0 0 0 0 W 24-20 11/22 atColts P 1 0 1 0.0 0.0 0 0 00 000000 0 1 0 1 0 0 0 0 L 31-34+ 2020 TOTALS 10-1 27 19 8 0.0 0.0 0 0 0 0 0 0 0 0 0 0 0 5 2 3 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 86 2020 SEASON: Startedonegamebeforesustainingasignificant kneeinjury…WasplacedoninjuredreserveonSept.22…At Minnesota (Sept. 13): StartedatRGandplayed63snapsbefore sustainingasignificantkneeinjurymidwaythroughthefourth quarter.HelpedthePackersregistertheirfirstzero-sackgame againsttheVikingssinceOct.24,2010,andtheirfirstgamein franchisehistorywith40-pluspoints,500-plusyards,30-plus firstdownsandnoturnovers.BlockedforQBAaronRodgersas heconnectedon32of44passesfor364yardsandfourTDswith noINTsfora127.5rating…Vs. Detroit (Sept. 20):Inactive (knee).
LANE TAYLOR'S NFL REGULAR SEASON STATISTICS
DATE TEAM GP GS 2013 Packers 10 0 2014 Packers 16 0 2015 Packers 4 2 2016 Packers 16 16 2017 Packers 15 15 2018 Packers 15 14 2019 Packers 2 2 2020 Packers 1 1 NFL TOTALS 79 50
LANE TAYLOR'S NFL POSTSEASON STATISTICS
DATE TEAM GP GS 2014 Packers 2 0 2015 Packers 2 0 2016 Packers 3 3 NFL TOTALS 7 3
2020GREENBAYPACKERS 87 offense.Postedhisfirstcareerreceptionwithjustunderaminute remaininginthefirsthalf,haulinginashortpassfromQBAaron Rodgersonfourth-and-2andthentakingitdowntheleftsideline fora20-yardgaintotheAtlanta8,settingupaTERobertTonyan TDcatchonthenextplaytogiveGreenBaya20-3leadatthe half…At Tampa Bay (Oct. 18):Played32snapsonoffenseand nineonspecialteams…At Houston (Oct. 25):Played10snapson offenseandcaughttwopassesfor6yards(3.0avg.),highlighted byhisfirstcareerTDcatch,a1-yarderfromQBAaronRodgers with14secondsremaininginthefirsthalf…Vs. Minnesota (Nov. 1):Appearedon13playsonoffenseandpostedacareer-long26- yardreceptionoverthemiddleinthefourthquartertothe Minnesota24…At San Francisco (Nov. 5):Playedon26snaps 2020 SEASON: Hasappearedinall10gameswithonestart, andpostedhisfirstcareercarry,pickingup9yardsonarunearly seeingtimeonoffenseandspecialteams,andhaspostedfour inthefourthquarter…Vs. Jacksonville (Nov. 15):Playedeight receptionsfor52yards(13.0avg.)andaTDwithonecarryfor9 snapsonoffenseand19onspecialteams,recordingatackleand yards…Hasregisteredonetackleonspecialteamsandhas returningonekickofffor8yards…At Indianapolis (Nov. 22): returnedonekickofffor8yards…At Minnesota (Sept. 13): Made Appearedon16playsonspecialteams. hisNFLdebut,appearingononeplayonoffenseand14on specialteams…Vs. Detroit (Sept. 20):Appearedon15playson offenseand15onspecialteams…At New Orleans (Sept. 27): Playedfoursnapsonoffenseand15onspecialteams…Vs. Atlanta (Oct. 5):WithinjuriestoWRsDavanteAdamsandAllen Lazard,madehisfirstcareerstart,appearingon45snapson
MALIK TAYLOR'S NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2020 Packers 10 1 4 52 13.0 26 1 1 9 9.0 9 0 NFL TOTALS 10 1 4 52 13.0 26 1 1 9 9.0 9 0
SINGLE-GAME HIGHS: RUSHING/RECEIVING Rush Attempts 1atSanFrancisco49ers,Nov05,2020 All-purpose yards 26vs.MinnesotaVikings,Nov01,2020 Rushing Yards 9atSanFrancisco49ers,Nov05,2020 20vs.AtlantaFalcons,Oct05,2020 Longest Runs 9atSanFrancisco49ers,Nov05,2020 Kickoff Returns 1vs.JacksonvilleJaguars,Nov15,2020 Receptions 2atHoustonTexans,Oct25,2020 Kickoff Return Yards 8vs.JacksonvilleJaguars,Nov15,2020 1vs.MinnesotaVikings,Nov01,2020 Longest Kickoff Return 8vs.JacksonvilleJaguars,Nov15,2020 ...1moreat1. Special Teams Tackles 1vs.JacksonvilleJaguars,Nov15,2020 Receiving Yards 26vs.MinnesotaVikings,Nov01,2020 Miscellaneous Tackles 1vs.MinnesotaVikings,Nov01,2020 20vs.AtlantaFalcons,Oct05,2020 Most TDs 1atHoustonTexans,Oct25,2020 Longest Receptions 26vs.MinnesotaVikings,Nov01,2020 20vs.AtlantaFalcons,Oct05,2020 Receiving TDs 1atHoustonTexans,Oct25,2020 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RECEIVING RUSHING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings P 0 0 0.0 0 0 0 0 0.0 0 0 W 43-34 09/20 Lions P 0 0 0.0 0 0 0 0 0.0 0 0 W 42-21 09/27 atSaints P 0 0 0.0 0 0 0 0 0.0 0 0 W 37-30 10/05 Falcons S 1 20 20.0 20 0 0 0 0.0 0 0 W 30-16 10/18 atBuccaneers P 0 0 0.0 0 0 0 0 0.0 0 0 L 10-38 10/25 atTexans P 2 6 3.0 5 1 0 0 0.0 0 0 W 35-20 11/01 Vikings P 1 26 26.0 26 0 0 0 0.0 0 0 L 22-28 11/05 at49ers P 0 0 0.0 0 0 1 9 9.0 9 0 W 34-17 11/15 Jaguars P 0 0 0.0 0 0 0 0 0.0 0 0 W 24-20 11/22 atColts P 0 0 0.0 0 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 10-1 4 52 13.0 26 1 1 9 9.0 9 0 7-3 +-Overtime
2020GREENBAYPACKERS 88 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) KICKOFF RETURNS PUNT RETURNS DATE OPPONENT P/S RET YDS AVG LG TD NO FC YDS AVG LG TD W/L SCORE 09/13 atVikings P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 43-34 09/20 Lions P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 42-21 09/27 atSaints P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 37-30 10/05 Falcons S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 30-16 10/18 atBuccaneers P 0 0 0.0 0 0 0 0 0 0.0 0 0 L 10-38 10/25 atTexans P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 35-20 11/01 Vikings P 0 0 0.0 0 0 0 0 0 0.0 0 0 L 22-28 11/05 at49ers P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 34-17 11/15 Jaguars P 1 8 8.0 8 0 0 0 0 0.0 0 0 W 24-20 11/22 atColts P 0 0 0.0 0 0 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 10-1 1 8 8.0 8 0 0 0 0 0.0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 89 carries)…At New Orleans (Sept. 27):Startedandplayed39 snaps,postingacareer-highfivereceptionsfor50yards(10.0 avg.)andaTD,hissecondstraightgamewithaTDcatch.HisTD catchcamewithjustovertwominutesremaininginthegame,a 1-yardgrabintheflatthatputGreenBayup,37-27.Registereda career-bestfourreceivingfirstdowns,includingcatchesof10,14 and16yards…Vs. Atlanta (Oct. 5):Ledtheteamwithacareer- high98receivingyardsonsixcatches(16.3avg.)ashebecame justthethirdTEinfranchisehistorytopostthreereceivingTDsin agame(KeithJacksonin1996,JermichaelFinleyin2011). RegisteredTDcatchesof19,8and21yards,givinghimaTD catchinthreestraightgamesashebecamethefirstGreenBayTE todososinceFinleyin2011-12.Becamethefirstundrafted playertohavethreereceivingTDsinagameforthePackerssince EBobMannonOct.14,1951.Postedthreereceptionsof20-plus yards(27,21,20),themostbyaGreenBayTEsinceRichard RodgershadthreeatDetroitonDec.3,2015…At Tampa Bay (Oct. 18):Startedandplayed37snaps,haulinginthreepasses for25yards(8.3avg.)…At Houston (Oct. 25):Startedand appearedon31snaps,catchingtwopassesfor32yards(16.0 avg.).Madeadivinggrabfor31yardstotheGreenBay48early inthesecondquarter…Vs. Minnesota (Nov. 1):Startedand played46snaps,pacingtheteamwith79yardsreceivingonfive 2020 SEASON: Hasplayedinall10gameswitheightstartsand catches(15.8avg.),includingaseason-long45-yardertothe rankstiedforNo.2ontheteamwith32receptionsfor391yards Minnesota37earlyinthethirdquarter…At San Francisco (Nov. (12.9avg.)andsixTDs…IstiedforNo.3intheleagueamong 5):Startedandappearedon41snaps,haulingina5-yard tightendsinTDcatches…JoinsChiefsTETravisKelceasthe reception…Vs. Jacksonville (Nov. 15):Startedandplayed40of onlytightendsintheNFLthisseasonwith30-plusreceptions, 65snaps,postingthreereceptionsfor33yards(11.0avg.).Hada 375-plusreceivingyards,six-plusreceivingTDsandanaverage 23-yardreceptiondowntherightsidelineonathird-and-9outto of12-plusyardspercatch…HissixreceivingTDsontheseason theGreenBay49earlyinthefourthquarteronwhatprovedtobe aretiedforthesecondmostbyaGreenBayTEthrough10games thePackers’game-winningTDdrive…At Indianapolis (Nov. 22): behindonlyPaulCoffman(sevenin1984)…Becamethefirst Played44snapsandcaughtfivepassesfor44yards(8.8avg.), GreenBayTEintheSuperBowlera(since1966)tohavefive highlightedbya25-yardTDcatchdownthemiddleofthefieldon receiving TDs in the first four games of the season…At GreenBay’ssecondpossession. Minnesota (Sept. 13): Played48snapsonoffenseand10on specialteams,helpingclearholesforthePackerstorushfor158 yardson32carries(4.9avg.)…Vs. Detroit (Sept. 20):Started andplayed44snaps,postingtworeceptionsfor25yards(12.5 avg.),highlightedbyan11-yardTDreceptionwith14seconds remaininginthefirsthalf.AlsohelpedthePackersrackup259 rushingyardson35carries(7.4avg.),thetopyardagetotalfor GreenBaysinceDec.28,2003,vs.Denver(262yardson34
REGULAR SEASON COMPARISON: RECEIVING - CHICAGO BEARS DATE OPP W/L GP/GS REC YDS. AVG. TD LG TGTS YAC 9/5/19 GB@CHI W P 1 28 28.0 0 28 1 9 12/15/19 GBvs.CHI WP 1 5 5.0 0 5 2 5 TOTALS 2/0 2/0 2 33 16.5 0 28 3 14
ROBERT TONYAN'S NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2018 Packers 16 1 4 77 19.3 54t 1 0 0 0.0 0 0 2019 Packers 11 1 10 100 10.0 28 1 0 0 0.0 0 0 2020 Packers 10 8 32 391 12.2 45 6 0 0 0.0 0 0 NFL TOTALS 37 10 46 568 12.3 54t 8 0 0 0.0 0 0
ROBERT TONYAN'S NFL POSTSEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2019 Packers 2 0 0 0 0.0 0 0 0 0 0.0 0 0 NFL TOTALS 2 0 0 0 0.0 0 0 0 0 0.0 0 0
2020GREENBAYPACKERS 90 SINGLE-GAME HIGHS: RUSHING/RECEIVING Receptions 6vs.AtlantaFalcons,Oct05,2020 All-purpose yards 98vs.AtlantaFalcons,Oct05,2020 5atIndianapolisColts,Nov22,2020 79vs.MinnesotaVikings,Nov01,2020 ...2moreat5. Special Teams Tackles 1atChicagoBears,Dec16,2018 Receiving Yards 98vs.AtlantaFalcons,Oct05,2020 Most TDs 3vs.AtlantaFalcons,Oct05,2020 79vs.MinnesotaVikings,Nov01,2020 1atIndianapolisColts,Nov22,2020 Longest Receptions 54tatSeattleSeahawks,Nov15,2018 ...4moreat1. 45vs.MinnesotaVikings,Nov01,2020 Receiving TDs 3vs.AtlantaFalcons,Oct05,2020 1atIndianapolisColts,Nov22,2020 ...4moreat1. 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RECEIVING RUSHING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings P 0 0 0.0 0 0 0 0 0.0 0 0 W 43-34 09/20 Lions S 2 25 12.5 14 1 0 0 0.0 0 0 W 42-21 09/27 atSaints S 5 50 10.0 16 1 0 0 0.0 0 0 W 37-30 10/05 Falcons S 6 98 16.3 27 3 0 0 0.0 0 0 W 30-16 10/18 atBuccaneers S 3 25 8.3 11 0 0 0 0.0 0 0 L 10-38 10/25 atTexans S 2 32 16.0 31 0 0 0 0.0 0 0 W 35-20 11/01 Vikings S 5 79 15.8 45 0 0 0 0.0 0 0 L 22-28 11/05 at49ers S 1 5 5.0 5 0 0 0 0.0 0 0 W 34-17 11/15 Jaguars S 3 33 11.0 23 0 0 0 0.0 0 0 W 24-20 11/22 atColts P 5 44 8.8 25t 1 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 10-8 32 391 12.2 45 6 0 0 0.0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 91 62snaps.Waspartofalinethatallowedjustonesackonthe eveningasthePackersbecamethefirstteaminNFLhistoryto score35-pluspointswithnoturnoversineachofthefirstthree gamesoftheseason.ProtectedQBAaronRodgersashe connectedon21of32passesfor283yardsandthreeTDsfora 124.9rating…Vs. Atlanta (Oct. 5):StartedatRTandplayedall 63snaps,helpingprotectRodgersashewassackedjustonceon theeveningandcompleted27of33passesfor327yardsand fourTDswithnoINTsfora147.5rating…At Tampa Bay (Oct. 18):StartedatRTandplayedall63snaps…At Houston (Oct. 25):StartedatLTinplaceofaninjuredDavidBakhtiari(chest), justhissecondcareerstartintheNFLatLT(Oct.9,2016).Was partofalinethatdidnotallowasackasRodgersconnectedon 23of34passesfor283yardsandfourTDswithnoINTs(132.4 rating)…Vs. Minnesota (Nov. 1):StartedatLTinplaceofan injuredBakhtiariforthesecondstraightweek,appearingonall75 snaps.PartofalinethatallowedjustonesackasRodgers completed27of41passesfor291yardsandthreeTDswithno INTs(110.9rating)…At San Francisco (Nov. 5):StartedatLTfor thethirdstraightgameinplaceofBakhtiari,playingtheentire firsthalftherebeforeshiftingtoRTinplaceofaninjuredRick Wagner(knee).WorkedatRTforthesecondhalfuntilcomingout ofthegameforthefinalfoursnapswiththePackersholdingabig lead.HelpedtoprotectRodgersashewassackedjustonceon 2020 SEASON: Hasstartedalleightgameshehasappearedin, theeveningandasheconnectedon25of31passesfor305 openingfiveatRTandthreeatLT…Dressedbutdidnotplayin yardsandfourTDswithnoINTsfora147.2rating…Vs. onegameandwasinactiveforanother…Partofalinethathas Jacksonville (Nov. 15):StartedatRTwithBakhtiarireturningto allowedonesackorzerosacksinaleague-bestninegames,the action,appearingonall65snaps.Waspartofalinethatallowed firstNFLteamtodosointhefirst10gamesoftheseasonsince onlyonesackonthedayasRodgersthrewfor325yardsandtwo 2008(threeteams)…HashelpedthePackersrankNo.3in TDswithoneINTon24-of-34passing(108.1rating)…At scoring(30.8ppg)andsacksallowed(11),tiedforNo.3in Indianapolis (Nov. 22): StartedatRTandplayedall60snaps, giveaways(nine),No.7intotaloffense(392.9ypg),No.6in helpingtoprotectRodgersashewassackedjustonceand passingoffense(277.0ypg),No.3inyardsperplay(6.25),No.4 connectedon27of38passesfor311yardsandthreeTDswith inthird-downpercentage(47.9)andNo.1intimeofpossession oneINT(110.7rating). (32:27)…At Minnesota (Sept. 13): Inactive(knee),snappinga streakof32consecutivegamesplayed…Vs. Detroit (Sept. 20): Wasactive,butdidnotseeanyaction(knee)…At New Orleans (Sept. 27):Madehisseasondebut,openingatRTandplayingall
BILLY TURNER'S NFL REGULAR SEASON STATISTICS
DATE TEAM GP GS 2014 Dolphins 2 0 2015 Dolphins 13 12 2016 Dolphins 5 2 2016 Broncos 3 0 2016 TOTAL 8 2 2017 Broncos 1 0 2018 Broncos 16 11 2019 Packers 16 16 2020 Packers 8 8 NFL TOTALS 64 49
BILLY TURNER'S NFL POSTSEASON STATISTICS
DATE TEAM GP GS 2019 Packers 2 2 NFL TOTALS 2 2
2020GREENBAYPACKERS 92 (21.3avg.),highlightedbya41-yardgrabdowntherightsideline earlyinthefourthquarterwithCBJeffOkudahincoverage…At New Orleans (Sept. 27):Startedandplayed57snaps,postinga 5-yardreception…Vs. Atlanta (Oct. 5):Startedandplayed61of 63snaps,haulinginfourpassesfor45yards(11.3avg.)withall fourofthereceptionspickingupfirstdowns…At Tampa Bay (Oct. 18):Startedandplayed53of63snaps,postingthree catchesfor32yards(10.7avg.)…At Houston (Oct. 25):Started andplayed51of62snaps,butdidnothaveanyreceptions…Vs. Minnesota (Nov. 1):Startedandplayed62of75snaps,postinga 19-yardreceptioninthethirdquarter…At San Francisco (Nov. 5):Startedandplayed59of66snaps,recordingtwocatchesfor 53yards(26.5avg.)andacareer-hightwoTDcatches.Withjust undertwominutesremaininginthefirsthalf,beatCBEmmanuel Moseleydownthemiddleofthefieldfora52-yardTD.Midway throughthethirdquarter,freedhimselffromCBJasonVerretton athird-and-goaltomakea1-yardTDgrabinthebackcornerof theendzone…Vs. Jacksonville (Nov. 15):Startedandplayed60 of65snaps,leadingtheteamwithacareer-high149yardsanda TDonfourreceptions(37.3avg.),themostreceivingyardsbya PackerinagameonfourorfewerreceptionssinceCarrollDale (fourfor186)vs.AtlantaonSept.27,1970.Caughtacareer-long 78-yardTDpassfromRodgersonthefirstplayofthesecond quarter,thelongestcatchbyaPackersinceWRJordyNelson postedan80-yardTDgrabvs.theN.Y.JetsonSept.14,2014. BecamejustthefourthPackersincethe1970mergertoregistera TDcatchof50-plusyardsinback-to-backgames,joiningJames Lofton(1983and1984),GregJennings(2007)andJordyNelson (2011).Onthe78-yardTDgrab,beatCBSidneyJonesIVdown therightsideline,makingthegrabneartheJacksonville35before 2020 SEASON: Hasplayedinall10gameswitheightstartsand cuttingitacrossthefieldtooutrunJonesandSJarrodWilson. ranksNo.2ontheteamwith518receivingyardsandacareer- Addeda31-yardgrablateinthethirdquarter,comingacrossthe highfourTDson25catches(20.7avg.)…Amongplayerswith fieldandtakingitdowntherightsidelinetotheJacksonville 25-plusreceptions,ranksNo.1intheNFLinyardspercatch…Is 49…At Indianapolis (Nov. 22): Startedandplayed51of60 theonlyplayerintheNFLwiththreeTDreceptionsof40-plus snaps,haulinginthreepassesfor55yards(18.3avg.).Madea yards(45,52,78)andhasaleague-highfivereceptionsof40- 47-yardcatchdownthemiddleofthefieldtotheIndianapolis47 plusyards…Has206yardsreceivingandaTDonninecatches onthird-and-10withjustoveraminuteremainingonGreenBay’s (22.9avg.)onthirddown…At Minnesota (Sept. 13): Played42 game-tyingdrive.Itmarkedhisthirdstraightgamewithacatch snapsandhauledinfourpassesfor96yards(24.0avg.)anda of45-plusyards,thefirstPackertodosinceLoftonin1984.Also TD,hisfourthcareergamewith95-plusyardsreceivingonfour drewa51-yardpass-interferencepenaltyonColtsCBRockYa- orfewercatches,themostintheNFLsince2018.Scoredona SintotheIndianapolis4-yardlinewith20secondsremainingin 45-yardTDcatchwith14secondsremaininginthefirsthalf, thefirsthalftosetupRBJamaalWilliams’4-yardTDreception beatingCBCameronDantzlerdowntherightsidelinebefore onthenextplay. haulinginthepassinsidethe5andtakingitinforthescore.Ona third-and-5lateinthethirdquarter,gotbehindCBMikeHughes tomakea39-yardgrabtotheMinnesota2…Vs. Detroit (Sept. 20):Appearedon46playsandcaughtthreepassesfor64yards
REGULAR SEASON COMPARISON: RECEIVING - CHICAGO BEARS DATE OPP W/L GP/GS REC YDS. AVG. TD LG TGTS YAC 12/16/18 GB@CHI L P 1 12 12.0 0 12 2 5 9/5/19 GB@CHI WS 4 52 13.0 0 47 6 2 12/15/19 GBvs.CHI WS 0 0 0 0 0 1 0 TOTALS 2/1 3/2 5 64 12.8 0 47 9 7
MARQUEZ VALDES-SCANTLING'S NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2018 Packers 16 10 38 581 15.3 60 2 2 29 14.5 21 0 2019 Packers 16 10 26 452 17.4 74t 2 2 9 4.5 9 0 2020 Packers 10 8 25 518 20.7 78t 4 2 13 6.5 9 0 NFL TOTALS 42 28 89 1,551 17.4 78t 8 6 51 8.5 21 0
2020GREENBAYPACKERS 93 MARQUEZ VALDES-SCANTLING'S NFL POSTSEASON RUSHING/RECEIVING STATISTICS
RECEIVING RUSHING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2019 Packers 2 0 1 8 8.0 8 0 0 0 0.0 0 0 NFL TOTALS 2 0 1 8 8.0 8 0 0 0 0.0 0 0
SINGLE-GAME HIGHS: RUSHING/RECEIVING Rush Attempts 2vs.ArizonaCardinals,Dec02,2018 All-purpose yards 149vs.JacksonvilleJaguars,Nov15,2020 1vs.MinnesotaVikings,Nov01,2020 133vs.OaklandRaiders,Oct20,2019 ...3moreat1. Kickoff Returns 1vs.ChicagoBears,Sep09,2018 Rushing Yards 29vs.ArizonaCardinals,Dec02,2018 Kickoff Return Yards 21vs.ChicagoBears,Sep09,2018 9atHoustonTexans,Oct25,2020 Longest Kickoff Return 21vs.ChicagoBears,Sep09,2018 ...1moreat9. Special Teams Tackles 2atWashington,Sep23,2018 Longest Runs 21vs.ArizonaCardinals,Dec02,2018 Miscellaneous Tackles 1atIndianapolisColts,Nov22,2020 9atHoustonTexans,Oct25,2020 1vs.JacksonvilleJaguars,Nov15,2020 ...1moreat9. ...1moreat1. Receptions 7atDetroitLions,Oct07,2018 Most TDs 2atSanFrancisco49ers,Nov05,2020 6vs.DenverBroncos,Sep22,2019 1vs.JacksonvilleJaguars,Nov15,2020 ...1moreat6. ...5moreat1. Receiving Yards 149vs.JacksonvilleJaguars,Nov15,2020 133vs.OaklandRaiders,Oct20,2019 Longest Receptions 78tvs.JacksonvilleJaguars,Nov15,2020 74tvs.OaklandRaiders,Oct20,2019 Receiving TDs 2atSanFrancisco49ers,Nov05,2020 1vs.JacksonvilleJaguars,Nov15,2020 ...5moreat1. 100-YARD RECEIVING GAMES (4): REGULAR SEASON DATE TEAM NO. YDS. AVG. LG TD 10/15/18 49ERS 3 103 34.3 60 0 11/04/18 atPatriots 3 101 33.7 51 0 10/20/19 RAIDERS 2 133 66.5 74t 1 11/15/20 JAGUARS 4 149 37.3 78t 1 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RECEIVING RUSHING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings P 4 96 24.0 45t 1 0 0 0.0 0 0 W 43-34 09/20 Lions P 3 64 21.3 41 0 0 0 0.0 0 0 W 42-21 09/27 atSaints S 1 5 5.0 5 0 0 0 0.0 0 0 W 37-30 10/05 Falcons S 4 45 11.3 17 0 0 0 0.0 0 0 W 30-16 10/18 atBuccaneers S 3 32 10.7 15 0 0 0 0.0 0 0 L 10-38 10/25 atTexans S 0 0 0.0 0 0 1 9 9.0 9 0 W 35-20 11/01 Vikings S 1 19 19.0 19 0 1 4 4.0 4 0 L 22-28 11/05 at49ers S 2 53 26.5 52t 2 0 0 0.0 0 0 W 34-17 11/15 Jaguars S 4 149 37.3 78t 1 0 0 0.0 0 0 W 24-20 11/22 atColts S 3 55 18.3 47 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 10-8 25 518 20.7 78t 4 2 13 6.5 9 0 7-3 +-Overtime
2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) KICKOFF RETURNS PUNT RETURNS DATE OPPONENT P/S RET YDS AVG LG TD NO FC YDS AVG LG TD W/L SCORE 09/13 atVikings P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 43-34 09/20 Lions P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 42-21 09/27 atSaints S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 37-30 10/05 Falcons S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 30-16 10/18 atBuccaneers S 0 0 0.0 0 0 0 0 0 0.0 0 0 L 10-38 10/25 atTexans S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 35-20 11/01 Vikings S 0 0 0.0 0 0 0 0 0 0.0 0 0 L 22-28 11/05 at49ers S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 34-17 11/15 Jaguars S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 24-20 11/22 atColts S 0 0 0.0 0 0 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 10-8 0 0 0.0 0 0 0 0 0 0.0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 94 injuredLucasPatrick(shoulder).HelpedthePackersregistertheir firstzero-sackgameagainsttheVikingssinceOct.24,2010,and theirfirstgameinfranchisehistorywith40-pluspoints,500-plus yards,30-plusfirstdownsandnoturnovers.BlockedforQB AaronRodgersasheconnectedon32of44passesfor364yards andfourTDswithnoINTsfora127.5rating…Vs. Detroit (Sept. 20):MadehisfirststartinaGreenBayuniform,openingatRT andappearingonall73snaps.HelpedclearholesforRBAaron Jones’career-high168rushingyardsandtwoTDson18carries (9.3avg.)asJonesfinishedwithacareer-best236yardsfrom scrimmage,thethirdmostinagameinfranchisehistory.Partof anoffensethatrackedup259yardsrushingon35attempts(7.4 avg.),thetopyardagetotalbyGreenBaysinceDec.28,2003,vs. Denver(262yardson34carries).Alsowaspartofalinethat allowedjustonesackofRodgersontheafternoon…At New Orleans (Sept. 27): Appeared on seven plays on special teams…Vs. Atlanta (Oct. 5):Playedsevensnapsonoffenseas anextralinemanandappearedonfiveplaysonspecialteams…At Tampa Bay (Oct. 18):TookoveratLTforDavidBakhtiari(chest) onthesecondoffensiveplayfromscrimmageinthesecondhalf andplayedthefinal23snapsofthegame…At Houston (Oct. 25): StartedatRTwithBillyTurnermovingtoLTinplaceofaninjured Bakhtiari(chest).Waspartofalinethatdidnotallowasackas Rodgersconnectedon23of34passesfor283yardsandfour TDswithnoINTs(132.4rating)…Vs. Minnesota (Nov. 1): 2020 SEASON: Hasappearedinall10gameswithfourstartsat StartedatRTforthesecondstraightgameandappearedonall75 RT…Partofalinethathasallowedonesackorzerosacksina snaps.PartofalinethatallowedjustonesackasRodgers league-bestninegames,thefirstNFLteamtodosointhefirst10 completed27of41passesfor291yardsandthreeTDswithno gamesoftheseasonsince2008(threeteams)…Hashelpedthe INTs(110.9rating)…At San Francisco (Nov. 5):StartedatRT PackersrankNo.3inscoring(30.8ppg)andsacksallowed(11), andplayed35snaps,butdidnotplayinthesecondhalfduetoa tiedforNo.3ingiveaways(nine),No.7intotaloffense(392.9 kneeinjury.Helpedtheoffenserackup209totalyardsinthefirst ypg),No.6inpassingoffense(277.0ypg),No.3inyardsper halfasRodgerscompleted13of18passesfor149yardsand play(6.25),No.4inthird-downpercentage(47.9)andNo.1in threeTDs…Vs. Jacksonville (Nov. 15):Appearedonfourplays timeofpossession(32:27)…At Minnesota (Sept. 13): Playedthe onspecialteams…At Indianapolis (Nov. 22): Playedonfive final46snapsofthegameatRT,takingoverforElgtonJenkinsin snapsonspecialteams. thesecondquarterafterJenkinsmovedbacktoLGinplaceofan
RICK WAGNER'S NFL REGULAR SEASON STATISTICS
DATE TEAM GP GS 2013 Ravens 16 2 2014 Ravens 15 15 2015 Ravens 16 16 2016 Ravens 15 14 2017 Lions 13 13 2018 Lions 15 15 2019 Lions 12 12 2020 Packers 10 4 NFL TOTALS 112 91
2020GREENBAYPACKERS 95 Hadaseason-long18-yardrunearlyinthethirdquarter…At New Orleans (Sept. 27):Rushedfor14yardsonsixcarries(2.3avg.) andhada3-yardreception…Vs. Atlanta (Oct. 5):Startedasthe PackersopenedupwithtwoRBsandledtheteamwithacareer- higheightreceptionsforacareer-best95yards(11.9avg.). Registered77receivingyardsinthefirsthalfalone,themostina halfbyaGreenBayRBsinceEddieLacyposted85yardsatNew OrleansonOct.26,2014.BecamethefirstPackersRBtopost eight-pluscatchesand95-plusreceivingyardsinagamesince DorseyLevens(10-99)vs.DetroitonNov.21,1999.Hada season-long 29-yard grab down the right sideline midway throughthefirstquarter…At Tampa Bay (Oct. 18):Ledtheteam with34rushingyardsonfourcarries(8.5avg.),includinga season-long25-yardruninthefirstquarter…At Houston (Oct. 25):StartedinplaceofaninjuredAaronJones(calf)andpaced theteamwith77rushingyardsandaTDon19carries(4.1avg.). Addedfourreceptionsfor37yards(9.3avg.)foraseason-high 114yardsfromscrimmage.ScoredhisfirstTDoftheseasonon a1-yardrunupthemiddlewith3:40remainingtoextendGreen Bay’sleadto35-13…Vs. Minnesota (Nov. 1):Startedforthe secondstraightweekwithJonessidelined,leadingtheteamwith 75yardsrushingon16attempts(4.7avg.)asheposted75-plus rushingyardsinback-to-backgamesforthefirsttimeinhis career.Addedsixreceptionsfor27yards(4.5avg.)ashetopped 100yardsfromscrimmageinhissecondstraightgameandfor 2020 SEASON: Hasplayedinninegameswiththreestartsand thethirdtimeinthelastfourcontests…Vs. Jacksonville (Nov. hasrushedfor336yardsandaTDon81carries(4.1avg.)with 15):Rushedfor30yardsoneightcarries(3.8avg.)andadded 27receptionsfor212yards(7.9avg.)andaTD…Haspostedtwo threereceptionsfor25yards(8.3avg.)…At Indianapolis (Nov. tacklesonspecialteams…Wasplacedonreserve/COVID-19on 22): Had12yardsrushingonfivecarries(2.4avg.)andcaught Nov.3andthenwasactivatedonNov.9...At Minnesota (Sept. hisfirstTDpassoftheseason,haulinginapassfromQBAaron 13): Rushedfor21yardsonsevencarries(3.0avg.)andadded Rodgersintheflatwith16secondsremaininginthefirsthalfand fourreceptionsfor21yards(5.3avg.).Caughtaswingpassfrom takingitinforthe4-yardscore. QBAaronRodgersearlyinthefirstquarter,makingLBEric Wilsonmissintheflatbeforetakingitfora15-yardgain…Vs. Detroit (Sept. 20):Posted63rushingyardsonjusteightcarries (7.9avg.),themostrushingyardsbyaGreenBayRBoneightor fewercarriessinceDeShawnWynn(7-106,vs.Detroitin2008).
REGULAR SEASON COMPARISON: RECEIVING - CHICAGO BEARS DATE OPP W/L GP/GS REC YDS. AVG. TD LG TGTS YAC 9/28/17 GBvs.CHI W P 1 2 2.0 0 2 1 8 11/12/17 GB@CHI WP 1 7 7.0 0 7 1 7 9/9/18 GBvs.CHI WS 0 0 0 0 0 2 0 12/16/18 GB@CHI LP 4 42 10.5 0 21 5 44 9/5/19 GB@CHI WP 2 15 7.5 0 10 2 21 12/15/19 GBvs.CHI WP 1 7 7.0 0 7 1 7 TOTALS 5/1 6/1 9 73 8.1 0 21 12 87
JAMAAL WILLIAMS' NFL REGULAR SEASON RUSHING/RECEIVING STATISTICS
RUSHING RECEIVING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2017 Packers 16 7 153 556 3.6 25 4 25 262 10.5 54t 2 2018 Packers 16 8 121 464 3.8 20 3 27 210 7.8 26 0 2019 Packers 14 2 107 460 4.3 45 1 39 253 6.5 17 5 2020 Packers 9 3 81 336 4.1 25 1 27 212 7.9 29 1 NFL TOTALS 55 20 462 1,816 3.9 45 9 118 937 7.9 54t 8
JAMAAL WILLIAMS' NFL POSTSEASON RUSHING/RECEIVING STATISTICS
RUSHING RECEIVING DATE TEAM GP GS NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD 2019 Packers 2 0 4 9 2.3 4 0 3 10 3.3 9 0 NFL TOTALS 2 0 4 9 2.3 4 0 3 10 3.3 9 0
2020GREENBAYPACKERS 96 SINGLE-GAME HIGHS: RUSHING/RECEIVING Rush Attempts 22atDetroitLions,Dec31,2017 All-purpose yards 156atNewYorkJets,Dec23,2018 21vs.TampaBayBuccaneers,Dec03,2017 145vs.DetroitLions,Oct14,2019 ...1moreat21. Kickoff Returns 3vs.ArizonaCardinals,Dec02,2018 Rushing Yards 113vs.TampaBayBuccaneers,Dec03,2017 1vs.DetroitLions,Oct14,2019 104vs.DetroitLions,Oct14,2019 ...1moreat1. Longest Runs 45vs.DetroitLions,Oct14,2019 Kickoff Return Yards 72vs.ArizonaCardinals,Dec02,2018 25atTampaBayBuccaneers,Oct18,2020 23atMinnesotaVikings,Nov25,2018 ...1moreat25. Longest Kickoff Return 30vs.ArizonaCardinals,Dec02,2018 Rushing TDs 1atHoustonTexans,Oct25,2020 23atMinnesotaVikings,Nov25,2018 1atKansasCityChiefs,Oct27,2019 Special Teams Tackles 2atTampaBayBuccaneers,Oct18,2020 ...7moreat1. 1vs.ChicagoBears,Dec15,2019 Receptions 8vs.AtlantaFalcons,Oct05,2020 ...6moreat1. 7atSanFrancisco49ers,Nov24,2019 Miscellaneous Tackles 1atCarolinaPanthers,Dec17,2017 ...1moreat7. Most TDs 2atKansasCityChiefs,Oct27,2019 Receiving Yards 95vs.AtlantaFalcons,Oct05,2020 2atClevelandBrowns,Dec10,2017 69atClevelandBrowns,Dec10,2017 ...1moreat2. ...1moreat69. Longest Receptions 54tatPittsburghSteelers,Nov26,2017 30tatClevelandBrowns,Dec10,2017 Receiving TDs 1atIndianapolisColts,Nov22,2020 1atLosAngelesChargers,Nov03,2019 ...6moreat1. 100-YARD RUSHING GAMES (2): REGULAR SEASON DATE TEAM ATT. YDS. AVG. LG TD 12/03/17 BUCCANEERS 21 113 5.4 25 1 10/14/19 LIONS 14 104 7.4 45 0 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) RUSHING RECEIVING DATE OPPONENT P/S NO. YDS. AVG. LG TD NO. YDS. AVG. LG TD W/L SCORE 09/13 atVikings P 7 21 3.0 5 0 4 21 5.3 15 0 W 43-34 09/20 Lions P 8 63 7.9 18 0 0 0 0.0 0 0 W 42-21 09/27 atSaints P 6 14 2.3 6 0 1 3 3.0 3 0 W 37-30 10/05 Falcons S 8 10 1.3 5 0 8 95 11.9 29 0 W 30-16 10/18 atBuccaneers P 4 34 8.5 25 0 0 0 0.0 0 0 L 10-38 10/25 atTexans S 19 77 4.1 13 1 4 37 9.3 17 0 W 35-20 11/01 Vikings S 16 75 4.7 10 0 6 27 4.5 7 0 L 22-28 11/05 at49ers RESERVE/COVID-19 W 34-17 11/15 Jaguars P 8 30 3.8 7 0 3 25 8.3 12 0 W 24-20 11/22 atColts P 5 12 2.4 4 0 1 4 4.0 4t 1 L 31-34+ 2020 TOTALS 9-3 81 336 4.1 25 1 27 212 7.9 29 1 7-3 +-Overtime
2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) KICKOFF RETURNS PUNT RETURNS DATE OPPONENT P/S RET YDS AVG LG TD NO FC YDS AVG LG TD W/L SCORE 09/13 atVikings P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 43-34 09/20 Lions P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 42-21 09/27 atSaints P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 37-30 10/05 Falcons S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 30-16 10/18 atBuccaneers P 0 0 0.0 0 0 0 0 0 0.0 0 0 L 10-38 10/25 atTexans S 0 0 0.0 0 0 0 0 0 0.0 0 0 W 35-20 11/01 Vikings S 0 0 0.0 0 0 0 0 0 0.0 0 0 L 22-28 11/05 at49ers RESERVE/COVID-19 W 34-17 11/15 Jaguars P 0 0 0.0 0 0 0 0 0 0.0 0 0 W 24-20 11/22 atColts P 0 0 0.0 0 0 0 0 0 0.0 0 0 L 31-34+ 2020 TOTALS 9-3 0 0 0.0 0 0 0 0 0 0.0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 97 2020 SEASON:Hasplayedinfourgames,recordingthreetackles (onesolo)andapassdefensed…Waselevatedfromthepractice squadthedaybeforetheWeek3-4contestsandthenwassigned tothe53-manrosteronOct.24…InactiveinWeeks8-10(healthy scratch)…At New Orleans (Sept. 27):Sawhisfirstregular- seasonactionsinceJan.1,2017,appearingonsixdefensive snapsandrecordingonepassdefensedwhenhetippedapass fromQBDrewBreeslateinthesecondquarter…Vs. Atlanta (Oct. 5):Played11snapsondefenseandonesnaponspecial teams,makingoneassistedtackleondefense…At Houston (Oct. 25):Madetwotackles(onesolo)whileappearingonsixdefensive plays.Alsoappearedoneightplaysonspecialteams…Vs. Minnesota (Nov. 1): Inactive (healthy scratch)…At San Francisco (Nov. 5):Inactive(healthyscratch)…Vs. Jacksonville (Nov. 15):Inactive(healthyscratch)…At Indianapolis (Nov. 22): Gotinonsevenplaysondefenseandrecordedapassdefensed. Alsoplayed15snapsonspecialteams.Midwaythroughthe secondquarter,gotahanduptotipapassfromQBPhillip Rivers,leadingtoaninterceptionbyLBChristianKirksey.
REGULAR SEASON COMPARISON: DEFENSIVE - CHICAGO BEARS TACKLES MISC DATE OPP W/L GP/GS TOT SOLO ASST SACK YDS. INT TFL PD QBH TD FF FR 12/15/13 CLVvs.CHI L P 2 2 0 0.0 0 0 1 0 0 0 1 0 TOTALS 0/1 1/0 2 2 0 0.0 0 0 1 0 0 0 1 0
BILLY WINN'S NFL REGULAR SEASON DEFENSIVE STATISTICS
TACKLES INTERCEPTIONS O. FUMB ST MISC DATE TEAM GP GS TK S A TFL YDS SK YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A 2012 Browns 16 10 26 19 7 5 0 1.0 6.0 5 1 0 0 0 3 0 2 35 0 0 0 0 0 0 0 2013 Browns 11 3 21 18 3 6 21 2.0 13.0 4 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 2014 Browns 13 5 31 17 14 4 12 0.0 0.0 2 1 0 0 0 2 1 0 0 0 0 0 0 0 0 0 2015 Colts 12 3 14 6 8 1 1 0.0 0.0 1 0 0 0 0 0 0 2 2 0 0 0 0 0 0 0 2016 Broncos 16 2 19 8 11 1 4 0.0 0.0 0 0 0 0 0 0 0 1 4 0 0 0 0 0 0 0 2020 Packers 4 0 3 1 2 0 0 0.0 0.0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 NFL TOTALS 72 23 114 69 45 17 38 3.0 19.0 12 2 0 0 0 7 2 5 41 0 0 0 0 0 0 0
SINGLE-GAME HIGHS: DEFENSIVE Total Tackles 5vs.NewOrleansSaints,Oct25,2015 Fumble Recoveries 1atTampaBayBuccaneers,Oct02,2016 5atBuffaloBills,Nov30,2014 1atPittsburghSteelers,Dec06,2015 ...2moreat5. ...3moreat1. Sacks 1.0atPittsburghSteelers,Dec29,2013 Tackles For Loss 2atBaltimoreRavens,Dec28,2014 1.0atMinnesotaVikings,Sep22,2013 2atBaltimoreRavens,Sep27,2012 ...1moreat1.0. Interceptions 1atCarolinaPanthers,Dec21,2014 Passes Defensed 2vs.BuffaloBills,Sep23,2012 1vs.PittsburghSteelers,Nov25,2012 1atIndianapolisColts,Nov22,2020 ...4moreat1. Forced Fumbles 1vs.CincinnatiBengals,Dec14,2014 1vs.ChicagoBears,Dec15,2013
2020GREENBAYPACKERS 98 2020 GAME-BY-GAME REGULAR SEASON STATISTICS (PACKERS) TACKLES INTERCEPTIONS O. FUMB ST MISC DATE OPPONENT P/S TK S A SK YDS TFL YDS QBH NO YDS LG TD PD FF FR YDS TK S A FF FR S A W/L SCORE 09/13 atVikings NOTONROSTER W 43-34 09/20 Lions PRACTICESQUAD W 42-21 09/27 atSaints P 0 0 0 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 W 37-30 10/05 Falcons P 1 0 1 0.0 0.0 0 0 00 000000 00000000 W 30-16 10/18 atBuccaneers PRACTICESQUAD L 10-38 10/25 atTexans P 2 1 1 0.0 0.0 0 0 00 000000 00000000 W 35-20 11/01 Vikings INACTIVE L 22-28 11/05 at49ers INACTIVE W 34-17 11/15 Jaguars ONINACTIVELIST W 24-20 11/22 atColts P 0 0 0 0.0 0.0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 L 31-34+ 2020 TOTALS 4-0 3 1 2 0.0 0.0 0 0 0 0 0 0 0 2 0 0 0 0 0 0 0 0 0 0 7-3 +-Overtime
2020GREENBAYPACKERS 99