DOCSLIB.ORG

SORORIN and PLK1 As Potential Therapeutic Targets in Malignant Pleural Mesothelioma

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
SORORIN and PLK1 As Potential Therapeutic Targets in Malignant Pleural Mesothelioma INTERNATIONAL JOURNAL OF ONCOLOGY 49: 2411-2420, 2016 SORORIN and PLK1 as potential therapeutic targets in malignant pleural mesothelioma TATSUYA KATO1,2, DAIYOON LEE1, LICUN WU1, PRIYA PATEL1, AHN JIN YOUNG1, HIRONOBU WADA1, HSIN-PEI HU1, HIDEKI UJIIE1, MITSUHITO KAJI3, SATOSHI KANO4, SHINICHI MATSUGE5, HIROMITSU DOMEN2, HIROMI KANNO6, YUTAKA HATANAKA6, KANAKO C. HATANAKA6, KICHIZO KAGA2, YOSHIRO MATSUI2, YOSHIHIRO MATSUNO6, MARC DE PERROT1 and KAZUHIRO YASUFUKU1 1Division of Thoracic Surgery, Toronto General Hospital, University Health Network, Toronto, Canada; 2Department of Cardiovascular and Thoracic Surgery, Hokkaido University Graduate School of Medicine, Sapporo; 3Department of Thoracic Surgery, Sapporo Minami-sanjo Hospital, Sapporo; Departments of 4Pathology, and 5Surgery, Kinikyo-Chuo Hospital, Sapporo; 6Department of Surgical Pathology, Hokkaido University Hospital, Sapporo, Japan Received May 23, 2016; Accepted July 13, 2016 DOI: 10.3892/ijo.2016.3765 Abstract. Malignant pleural mesothelioma (MPM) is an PLK1 inhibitor induced drug-related adverse effects in several aggressive type of cancer of the thoracic cavity commonly clinical trials, our results suggest inhibition SORORIN-PLK1 associated with asbestos exposure and a high mortality rate. axis may hold promise for the treatment of MPMs. There is a need for new molecular targets for the develop- ment of more effective therapies for MPM. Using quantitative Introduction reverse-transcriptase polymerase chain reaction (qRT-PCR) and an RNA interference-based screening, we examined the Malignant pleural mesothelioma (MPM) from exposure to SORORIN gene as potential therapeutic targets for MPM asbestos is an aggressive tumor that arises from mesothelial in addition to the PLK1 gene, which is known for kinase of cells lining the intrathoracic cavities, and its worldwide inci- SORORIN. Following in vitro investigation of the effects dence continues to increase (1). The latency period between of target silencing on MPM cells, cell cycle analyses were the time of initial exposure and diagnosis is approximately performed. SORORIN expression was analyzed immuno- 30 years although it ranges from 20 to 50 years, and it will histochemically using a total of 53 MPM samples on tissue continue to be a health concern globally in the next few microarray. SORORIN was found to be overexpressed in decades with the continued use of asbestos in developing the majority of clinical MPM samples and human MPM cell countries (1,2). Depending on different etiologies of the lines as determined by qRT-PCR. Gene suppression of each disease, MPM can be divided into four types: epithelioid, SORORIN and PLK1 led to growth inhibition in MPM cell sarcomatoid, desmoplastic and biphasic, according to the lines. Knockdown of SORORIN showed an increased number World Health Organization (WHO) classification of pleural of G2M-phase population and a larger nuclear size, suggesting tumors (3). MPM patients have poor prognosis and current mitotic arrest. High expression of SORORIN (SORORIN-H) treatment strategies are limited. The median survival time for was found in 50.9% of all the MPM cases, and there is a the main types (epithelioid, sarcomatoid and biphasic) is only tendency towards poorer prognosis for the SORORIN-H group 18, 8 and 11 months, respectively (4-6). Aggressive surgery, but the difference is not significant. Suppression of SORORIN screening with proposed biomarkers, advances in modern with PLK1 inhibitor BI 6727 showed a combinational growth systemic chemotherapy using the combination of pemetrexed suppressive effect on MPM cell growth. Given high-dose and cisplatin, combination of radiotherapy and chemotherapy regimens as well as combined treatment with preoperative radiation followed by surgery are currently being tested, but their benefits and long-term survival in patients with MPM Correspondence to: Dr Kazuhiro Yasufuku, Division of Thoracic is still rare (7-9). The absence of major improvements in the Surgery, Toronto General Hospital, University Health Network 200 survival rate has further facilitated research into identifying Elizabeth St, 9N-957, Toronto, ON M5G2C4, Canada new strategies aimed at improving MPM survival. To improve E-mail: [email protected] these survival rates, more targeted therapies with reduced toxicity are needed. Investigating molecular analyses of MPM Key words: SORORIN, [cell division cycle associated 5 (CDCA5)]; samples has led to novel targeted strategies that inhibit specific polo like kinase 1, therapeutic target genes, immunohistochemistry, key molecules in tumor growth and progression. malignant pleural mesothelioma We have previously screened for potential molecular targets for diagnosis and/or treatment of advanced lung cancer and MPM by analyzing gene expression using quantitative reverse- 2412 KATO et al: SORORIN AS A THERAPEUTIC TARGET IN MESOTHELIOMA Table I. The clinicopathological characteristics of patients in Table I. Postoperative pathological staging evaluation was with malignant pleural mesothelioma (MPM). demonstrated only in curative operative cases (n=21), showing stage I disease in 1 case, stage II disease in 5 cases, and Variables N (%) stage III disease in 15 cases. In all, one patient had T1 disease, 7 patients had T2 disease and 13 patients had T3 disease. A Gender (Male/female) 49/4 (92.5/7.5) total of 9 patients had N0 disease, 5 patients had N1 disease, Age, years (mean) 65.5 and 7 patients had N2 disease (Table II). Histological classifi- (range, 35-80) cation of tumors and stage were performed according to the Histology Union for International Cancer Control (UICC) pathological Epithelioid 34 (64.2) tumor/node/metastasis (pTNM) classification criteria (13). Biphasic 13 (24.5) Malignant mesothelioma cell lines. The human malignant Sarcomatoid 5 (9.4) mesothelioma cell lines used were as follows: NCI-H28, -H226, Desmoplastic 1 (1.9) -H2052 and -H2452 were purchased from the American Type Surgical procedure Culture Collection (ATCC; Manassas, VA, USA). All cancer Extrapleural pleuropneumonectomy (EPP) 21 (39.6) cells were grown in monolayers in RPMI-1640 medium Pleural biopsy 28 (52.8) supplemented with 10% fetal bovine serum (FBS). A human Tumor resection of recurrent tumors 3 (5.7) adult normal mesothelial cell line (MES-F) was purchased Radical pleurectomy 1 (1.9) from Zembio Inc. (Research Triangle Park, NC, USA) and was grown in mesothelial cell growth medium (Zembio). All cell Total 53 lines were maintained at 37˚C in atmospheres of humidified air with 5% CO2. cDNA sample preparation. Tumor samples from MPM patients transcriptase polymerase chain reaction (qRT-PCR) and RNA with surgery were excised and stored at -80˚C. QIAzol Lysis interference (RNAi) techniques (10,11) based on profiles of reagent (Qiagen, Valencia, CA, USA) and one 5-mm stainless various databases, such as NCBI-Gene® (http://www.ncbi. steel bead (Qiagen) were added before homogenizing with a nlm.nih.gov/gene), GeneCards® (http://www.genecards.org/), TissueLyser Adapter Set (Qiagen) for 2 min at 20 Hz. Total GenomeRNAi® (http://genomernai.dkfz.de/GenomeRNAi//) RNA was then purified using a miRNeasy Mini kit (Qiagen). and CTDatabase® (http://www.cta.lncc.br/). Throughout these The amount and purity were measured using a spectrophoto- screenings, we identified SORORIN [alias: cell division cycle meter (NanoDrop; Thermo Fisher Scientific, Wilmington, DE, associated 5 (CDCA5)] as a potential candidate target gene for USA). the treatment of MPM. Sororin, a cohesin-interacting protein essential for sister chromatid cohesion, plays a novel role in the Quantitative RT-PCR analysis. cDNA was synthesized from resolution of sister chromatid arms by direct interaction with 2 µg total RNA using QuantiTect® reverse transcription kit polo like kinase 1 (PLK1) (12). (Qiagen). The primers were designed as follows: for PLK1, The aims of the present study were to examine the forward primer, 5'-cccctcacagtcctcaataa-3' and reverse primer, frequency of transcriptional expression of the SORORIN in 5'-tgtccgaatagtccaccc-3'; for SORORIN, forward primer, 5'-cg addition to PLK1, which is known for kinase of SORORIN, ccagagacttggaaatgt-3' and reverse primer, 5'-gtttctgtttctcgggt in MPM samples, to investigate their functional roles in MPM ggt-3'; for actin, beta (ACTB), forward primer, 5'-gaaatcgtgcgt- cell proliferation by using an RNAi technique, and to assess gacattaa-3' and reverse primer, 5'-aaggaaggctggaagagtg-3'. clinicopathological relationships in MPM by immunohisto- qRT-PCR analysis was performed using LightCycler480® chemical (IHC) study using tissue microarray (TMA) and SYBR-Green I Master Ready-to-use hot start reaction mix and to explore the possibilities of these target genes as potential LightCycler480® system (Roche, South San Francisco, CA, molecular targets for therapeutic agents. USA). The thermal cycler conditions were as follows: 5 min at 95˚C to denature, 45 cycles at 95˚C for 10 sec, 56˚C for 20 sec, Materials and methods and 72˚C for 10 sec for PCR amplification, and 1 min at 65˚C for melting. The threshold cycle value was defined as the value Malignant mesothelioma clinical samples and tissue samples. obtained in the PCR cycle when the fluorescence signal Nine samples were taken from patients with MPMs, including increased above the background threshold. PCR reactions four cases of epithelioid, four biphasic and one sarcomatoid were carried out in duplicate. subtypes, with written informed consent at Toronto General Hospital (Toronto, Canada).
Load more

Recommended publications
  • Genetic and Genomic Analysis of Hyperlipidemia, Obesity and Diabetes Using (C57BL/6J × TALLYHO/Jngj) F2 Mice
    University of Tennessee, Knoxville TRACE: Tennessee Research and Creative Exchange Nutrition Publications and Other Works Nutrition 12-19-2010 Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P. Stewart Marshall University Hyoung Y. Kim University of Tennessee - Knoxville, [email protected] Arnold M. Saxton University of Tennessee - Knoxville, [email protected] Jung H. Kim Marshall University Follow this and additional works at: https://trace.tennessee.edu/utk_nutrpubs Part of the Animal Sciences Commons, and the Nutrition Commons Recommended Citation BMC Genomics 2010, 11:713 doi:10.1186/1471-2164-11-713 This Article is brought to you for free and open access by the Nutrition at TRACE: Tennessee Research and Creative Exchange. It has been accepted for inclusion in Nutrition Publications and Other Works by an authorized administrator of TRACE: Tennessee Research and Creative Exchange. For more information, please contact [email protected]. Stewart et al. BMC Genomics 2010, 11:713 http://www.biomedcentral.com/1471-2164/11/713 RESEARCH ARTICLE Open Access Genetic and genomic analysis of hyperlipidemia, obesity and diabetes using (C57BL/6J × TALLYHO/JngJ) F2 mice Taryn P Stewart1, Hyoung Yon Kim2, Arnold M Saxton3, Jung Han Kim1* Abstract Background: Type 2 diabetes (T2D) is the most common form of diabetes in humans and is closely associated with dyslipidemia and obesity that magnifies the mortality and morbidity related to T2D. The genetic contribution to human T2D and related metabolic disorders is evident, and mostly follows polygenic inheritance. The TALLYHO/ JngJ (TH) mice are a polygenic model for T2D characterized by obesity, hyperinsulinemia, impaired glucose uptake and tolerance, hyperlipidemia, and hyperglycemia.
    [Show full text]
  • Real-Time Dynamics of Plasmodium NDC80 Reveals Unusual Modes of Chromosome Segregation During Parasite Proliferation Mohammad Zeeshan1,*, Rajan Pandey1,*, David J
    © 2020. Published by The Company of Biologists Ltd | Journal of Cell Science (2021) 134, jcs245753. doi:10.1242/jcs.245753 RESEARCH ARTICLE SPECIAL ISSUE: CELL BIOLOGY OF HOST–PATHOGEN INTERACTIONS Real-time dynamics of Plasmodium NDC80 reveals unusual modes of chromosome segregation during parasite proliferation Mohammad Zeeshan1,*, Rajan Pandey1,*, David J. P. Ferguson2,3, Eelco C. Tromer4, Robert Markus1, Steven Abel5, Declan Brady1, Emilie Daniel1, Rebecca Limenitakis6, Andrew R. Bottrill7, Karine G. Le Roch5, Anthony A. Holder8, Ross F. Waller4, David S. Guttery9 and Rita Tewari1,‡ ABSTRACT eukaryotic organisms to proliferate, propagate and survive. During Eukaryotic cell proliferation requires chromosome replication and these processes, microtubular spindles form to facilitate an equal precise segregation to ensure daughter cells have identical genomic segregation of duplicated chromosomes to the spindle poles. copies. Species of the genus Plasmodium, the causative agents of Chromosome attachment to spindle microtubules (MTs) is malaria, display remarkable aspects of nuclear division throughout their mediated by kinetochores, which are large multiprotein complexes life cycle to meet some peculiar and unique challenges to DNA assembled on centromeres located at the constriction point of sister replication and chromosome segregation. The parasite undergoes chromatids (Cheeseman, 2014; McKinley and Cheeseman, 2016; atypical endomitosis and endoreduplication with an intact nuclear Musacchio and Desai, 2017; Vader and Musacchio, 2017). Each membrane and intranuclear mitotic spindle. To understand these diverse sister chromatid has its own kinetochore, oriented to facilitate modes of Plasmodium cell division, we have studied the behaviour movement to opposite poles of the spindle apparatus. During and composition of the outer kinetochore NDC80 complex, a key part of anaphase, the spindle elongates and the sister chromatids separate, the mitotic apparatus that attaches the centromere of chromosomes to resulting in segregation of the two genomes during telophase.
    [Show full text]
  • Monoclonal Anti-Nuf2 Antibody Produced in Mouse (N5287)
    Monoclonal Anti-Nuf2 Clone 28-37 Purified Mouse Immunoglobulin Product Number N 5287 Product Description Reagent Monoclonal Anti-Nuf2 (mouse IgG1isotype) is derived The antibody is supplied as a solution in 0.01 M phos- from the hybridoma 28-37 produced by the fusion of phate buffered saline, pH 7.4, containing 15 mM sodium mouse myeloma cells (PAI cells) and splenocytes from azide. BALB/c mice immunized with recombinant full length human Nuf2.1 The isotype is determined using a double Antibody Concentration: ~2 mg/mL diffusion immunoassay using Mouse Monoclonal Antibody Isotyping Reagents (Sigma ISO-2). Precautions and Disclaimer Due to the sodium azide content, a material safety data Monoclonal Anti-Nuf2 recognizes human Nuf2.1 The sheet (MSDS) for this product has been sent to the antibody can be used in various applications including attention of the safety officer of your institution. Consult ELISA, immunoblotting (~52 kDa),1 immunocyto- the MSDS for information regarding hazardous and chemistry,1 and immunoprecipitation.1 safe handling practices. Chromosome movements during mitosis are Storage/Stability orchestrated primarily by the interaction of mitotic For continuous use, store at 2-8 °C for up to one month. spindle microtubules with the kinetochore, the site of For extended storage, freeze in working aliquots. attachment of spindle microtubules to the centromere.2 Repeated freezing and thawing is not recommended. The kinetochore consists of several proteins including Storage in “frost-free” freezers is also not recom- the Ndc80 protein complex, which consists of Nuf2, mended. If slight turbidity occurs upon prolonged Hec1, Spc24, and Spc25. Nuf2 is a conserved protein storage, clarify the solution by centrifugation before from yeast and nematode to human.
    [Show full text]
  • Peripherally Generated Foxp3+ Regulatory T Cells Mediate the Immunomodulatory Effects of Ivig in Allergic Airways Disease
    Published February 20, 2017, doi:10.4049/jimmunol.1502361 The Journal of Immunology Peripherally Generated Foxp3+ Regulatory T Cells Mediate the Immunomodulatory Effects of IVIg in Allergic Airways Disease Amir H. Massoud,*,†,1 Gabriel N. Kaufman,* Di Xue,* Marianne Be´land,* Marieme Dembele,* Ciriaco A. Piccirillo,‡ Walid Mourad,† and Bruce D. Mazer* IVIg is widely used as an immunomodulatory therapy. We have recently demonstrated that IVIg protects against airway hyper- responsiveness (AHR) and inflammation in mouse models of allergic airways disease (AAD), associated with induction of Foxp3+ regulatory T cells (Treg). Using mice carrying a DTR/EGFP transgene under the control of the Foxp3 promoter (DEREG mice), we demonstrate in this study that IVIg generates a de novo population of peripheral Treg (pTreg) in the absence of endogenous Treg. IVIg-generated pTreg were sufficient for inhibition of OVA-induced AHR in an Ag-driven murine model of AAD. In the absence of endogenous Treg, IVIg failed to confer protection against AHR and airway inflammation. Adoptive transfer of purified IVIg-generated pTreg prior to Ag challenge effectively prevented airway inflammation and AHR in an Ag-specific manner. Microarray gene expression profiling of IVIg-generated pTreg revealed upregulation of genes associated with cell cycle, chroma- tin, cytoskeleton/motility, immunity, and apoptosis. These data demonstrate the importance of Treg in regulating AAD and show that IVIg-generated pTreg are necessary and sufficient for inhibition of allergen-induced AAD. The ability of IVIg to generate pure populations of highly Ag-specific pTreg represents a new avenue to study pTreg, the cross-talk between humoral and cellular immunity, and regulation of the inflammatory response to Ags.
    [Show full text]
  • The Mitotic Checkpoint Kinase NEK2A Regulates Kinetochore Microtubule Attachment Stability
    Oncogene (2008) 27, 4107–4114 & 2008 Nature Publishing Group All rights reserved 0950-9232/08 $30.00 www.nature.com/onc ORIGINAL ARTICLE The mitotic checkpoint kinase NEK2A regulates kinetochore microtubule attachment stability JDu1,6, X Cai1,2,6, J Yao1, X Ding2,3,QWu1,2, S Pei1, K Jiang1,2, Y Zhang1, W Wang3, Y Shi1, Y Lai1, J Shen1, M Teng1, H Huang4, Q Fei5, ES Reddy2, J Zhu5, C Jin1 and X Yao1,2 1Hefei National Laboratory for Physical Sciences at Micro-scale, University of Science and Technology of China, Hefei, China; 2Cancer Biology Program, Morehouse School of Medicine, Atlanta, GA, USA; 3Department of Medicine, Beijing University of Chinese Medicine, 4Department of Hematology, the 1st Affiliated Hospital, Zhejiang University, Hongzhou, China and 5Cancer Epigenetics Program, Shanghai Cancer Institute, Shanghai Jiaotong University, Shanghai, China Loss or gain of whole chromosome, the form of Introduction chromosome instability commonly associated with cancers is thought to arise from aberrant chromosome segregation Chromosomal instability (CIN) has been recognized as a during cell division. Chromosome segregation in mitosis is hallmark of human cancer and is caused by continuous orchestrated by the interaction of kinetochores with chromosome missegregation during cell division. Proper spindle microtubules. Our studies showthat NEK2A is a chromosome segregation requires a faithful physical link kinetochore-associated protein kinase essential for faith- between spindle microtubules and centromeric DNA via ful chromosome segregation. However, it was unclear how a protein supercomplex called kinetochore (Cleveland NEK2A ensures accurate chromosome segregation in et al., 2003). In addition to providing a physical link mitosis. Here we show that NEK2A-mediated Hec1 between chromosomes and spindle microtubules, the (highly expressed in cancer) phosphorylation is essential kinetochore has an active function in orchestrating for faithful kinetochore microtubule attachments in chromosome movements through microtubule motors mitosis.
    [Show full text]
  • Expression and Clinical Significance of NUF2 in Kidney Renal Clear Cell Carcinoma
    3637 Original Article Expression and clinical significance of NUF2 in kidney renal clear cell carcinoma Li Shan1#, Xiao-Li Zhu1#, Yuan Zhang1, Guo-Jian Gu2, Xu Cheng1^ 1Department of Hematology and Oncology, Soochow University Affiliated Taicang Hospital (The First People’s Hospital of Taicang), Suzhou, China; 2Department of Pathology, Soochow University Affiliated Taicang Hospital (The First People’s Hospital of Taicang), Suzhou, China Contributions: (I) Conception and design: X Cheng; (II) Administrative support: XL Zhu; (III) Provision of study materials or patients: L Shan, Y Zhang; (IV) Collection and assembly of data: GJ Gu; (V) Data analysis and interpretation: XL Zhu; (VI) Manuscript writing: All authors; (VII) Final approval of manuscript: All authors. #These authors contributed equally to this work. Correspondence to: Xu Cheng. Department of Hematology and Oncology, Soochow University Affiliated Taicang Hospital (The First People’s Hospital of Taicang), Suzhou 215400, China. Email: [email protected]. Background: To explore the expression and clinical significance of the cytokinesis-related gene NUF2 in kidney renal clear cell carcinoma (KIRC). Methods: Gene expression profiles of KIRC patients were extracted from The Cancer Genome Atlas (TCGA) database. The differences in NUF2 mRNA expression between patients and controls, as well as the relationship between the clinical characteristics and overall survival of the patients, were analyzed. The expression of NUF2 protein in 83 cancer tissues and para-cancerous tissues was detected to analyze the relationship with clinical characteristics. Gene Set Enrichment Analysis (GSEA) was used to investigate the possible regulatory pathways of the NUF2 in the development of KIRC. Results: NUF2 mRNA was significantly higher in patients with KIRC, and the prognosis of patients with high expression of NUF2 mRNA was significantly worse than those with low expression, and was related to the AJCC stage, T stage, lymph node metastases, and distant metastases.
    [Show full text]
  • A High-Throughput Approach to Uncover Novel Roles of APOBEC2, a Functional Orphan of the AID/APOBEC Family
    Rockefeller University Digital Commons @ RU Student Theses and Dissertations 2018 A High-Throughput Approach to Uncover Novel Roles of APOBEC2, a Functional Orphan of the AID/APOBEC Family Linda Molla Follow this and additional works at: https://digitalcommons.rockefeller.edu/ student_theses_and_dissertations Part of the Life Sciences Commons A HIGH-THROUGHPUT APPROACH TO UNCOVER NOVEL ROLES OF APOBEC2, A FUNCTIONAL ORPHAN OF THE AID/APOBEC FAMILY A Thesis Presented to the Faculty of The Rockefeller University in Partial Fulfillment of the Requirements for the degree of Doctor of Philosophy by Linda Molla June 2018 © Copyright by Linda Molla 2018 A HIGH-THROUGHPUT APPROACH TO UNCOVER NOVEL ROLES OF APOBEC2, A FUNCTIONAL ORPHAN OF THE AID/APOBEC FAMILY Linda Molla, Ph.D. The Rockefeller University 2018 APOBEC2 is a member of the AID/APOBEC cytidine deaminase family of proteins. Unlike most of AID/APOBEC, however, APOBEC2’s function remains elusive. Previous research has implicated APOBEC2 in diverse organisms and cellular processes such as muscle biology (in Mus musculus), regeneration (in Danio rerio), and development (in Xenopus laevis). APOBEC2 has also been implicated in cancer. However the enzymatic activity, substrate or physiological target(s) of APOBEC2 are unknown. For this thesis, I have combined Next Generation Sequencing (NGS) techniques with state-of-the-art molecular biology to determine the physiological targets of APOBEC2. Using a cell culture muscle differentiation system, and RNA sequencing (RNA-Seq) by polyA capture, I demonstrated that unlike the AID/APOBEC family member APOBEC1, APOBEC2 is not an RNA editor. Using the same system combined with enhanced Reduced Representation Bisulfite Sequencing (eRRBS) analyses I showed that, unlike the AID/APOBEC family member AID, APOBEC2 does not act as a 5-methyl-C deaminase.
    [Show full text]
  • Coupling Unbiased Mutagenesis to High-Throughput DNA Sequencing Uncovers Functional Domains in the Ndc80 Kinetochore Protein of Saccharomyces Cerevisiae
    Genetics: Early Online, published on July 5, 2013 as 10.1534/genetics.113.152728 Coupling Unbiased Mutagenesis to High-throughput DNA Sequencing Uncovers Functional Domains in the Ndc80 Kinetochore Protein of Saccharomyces cerevisiae Jerry F. Tien*, Kimberly K. Fong*, Neil T. Umbreit*, Celia Payen§, Alex Zelter*, Charles L. Asbury†, Maitreya J. Dunham§, and Trisha N. Davis*. *Department of Biochemistry, §Department of Genome Sciences, and †Department of Physiology and Biophysics, University of Washington, Seattle, Washington 98195 1 Copyright 2013. Running title: Linker-scanning mutagenesis of Ndc80 Keywords: Hec1, Illumina, coiled-coil, TIRF Corresponding author: Trisha N. Davis Box 357350 Department of Biochemistry, University of Washington, Seattle, Washington 98195 Phone: (206) 543-5345 E-mail: [email protected] 2 Abstract During mitosis, kinetochores physically link chromosomes to the dynamic ends of spindle microtubules. This linkage depends on the Ndc80 complex, a conserved and essential microtubule-binding component of the kinetochore. As a member of the complex, the Ndc80 protein forms microtubule attachments through a calponin homology domain. Ndc80 is also required for recruiting other components to the kinetochore and responding to mitotic regulatory signals. While the calponin homology domain has been the focus of biochemical and structural characterization, the function of the remainder of Ndc80 is poorly understood. Here, we utilized a new approach that couples high- throughput sequencing to a saturating linker-scanning mutagenesis screen in Saccharomyces cerevisiae. We identified domains in previously uncharacterized regions of Ndc80 that are essential for its function in vivo. We show that a helical hairpin adjacent to the calponin homology domain influences microtubule binding by the complex.
    [Show full text]
  • PRODUCT SPECIFICATION Product Datasheet
    Product Datasheet QPrEST PRODUCT SPECIFICATION Product Name QPrEST NUF2 Mass Spectrometry Protein Standard Product Number QPrEST35721 Protein Name Kinetochore protein Nuf2 Uniprot ID Q9BZD4 Gene NUF2 Product Description Stable isotope-labeled standard for absolute protein quantification of Kinetochore protein Nuf2. Lys (13C and 15N) and Arg (13C and 15N) metabolically labeled recombinant human protein fragment. Application Absolute protein quantification using mass spectrometry Sequence (excluding AQFKINKKHEDVKQYKRTVIEDCNKVQEKRGAVYERVTTINQEIQKIKLG fusion tag) IQQLKDAAEREKLKSQEIFLNLKTALEKYHDG Theoretical MW 27582 Da including N-terminal His6ABP fusion tag Fusion Tag A purification and quantification tag (QTag) consisting of a hexahistidine sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G. Expression Host Escherichia coli LysA ArgA BL21(DE3) Purification IMAC purification Purity >90% as determined by Bioanalyzer Protein 230 Purity Assay Isotopic Incorporation >99% Concentration >5 μM after reconstitution in 100 μl H20 Concentration Concentration determined by LC-MS/MS using a highly pure amino acid analyzed internal Determination reference (QTag), CV ≤10%. Amount >0.5 nmol per vial, two vials supplied. Formulation Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0 Instructions for Spin vial before opening. Add 100 μL ultrapure H2O to the vial. Vortex thoroughly and spin Reconstitution down. For further dilution, see Application Protocol. Shipping Shipped at ambient temperature Storage Lyophilized product shall be stored at -20°C. See COA for expiry date. Reconstituted product can be stored at -20°C for up to 4 weeks. Avoid repeated freeze-thaw cycles. Notes For research use only Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use.
    [Show full text]
  • Kinetics of Spindle Pole Body Separation in Budding Yeast JASON A
    Proc. Natl. Acad. Sci. USA Vol. 92, pp. 9707-9711, October 1995 Cell Biology Kinetics of spindle pole body separation in budding yeast JASON A. KAHANA*, BRUCE J. SCHNAPPt, AND PAMELA A. SILVER*1 *Department of Biological Chemistry and Molecular Pharmacology, Harvard Medical School and Dana-Farber Cancer Institute, 44 Binney Street, Boston, MA 02115; and tDepartment of Cell Biology, Harvard Medical School, Boston, MA 02115 Communicated by Bruce M Alberts, National Academy of Sciences, Washington, DC, July 17, 1995 ABSTRACT In the budding yeast Saccharomyces cerevi- CAT. The PCR product was cut with BamHI and Xho I. The siae, the spindle pole body (SPB) serves as the microtubule- two fragments were ligated together into plasmid pPS293 (a organizing center and is the functional analog of the centro- 2-gm URA3 vector with the GALl promoter sequence) cut some of higher organisms. By expressing a fusion of a yeast with BamHI and Pst I. SPB-associated protein to the Aequorea victoria green fluores- Plasmid pJK6 was constructed as follows: Plasmid pPS511 cent protein, the movement of the SPBs in livineg east cells was cut with BamHI and Nhe I. A 359-bp fragment encom- undergoing mitosis was observed by fluorescence microscopy. passing the NUF2 5' promoter region along with the first 78 The ability to visualize SPBs in vivo has revealed previously nucleotides of the coding sequence was isolated. This fragment unidentified mitotic events. During anaphase, the mitotic was ligated into a pKG5 backbone, which had been cut with spindle has four sequential activities: alignment at the moth- BamHI and Nhe I.
    [Show full text]
  • Structural Basis of Stu2 Recruitment to Yeast Kinetochores Jacob a Zahm1†, Michael G Stewart2†, Joseph S Carrier2, Stephen C Harrison1*, Matthew P Miller2*
    RESEARCH ARTICLE Structural basis of Stu2 recruitment to yeast kinetochores Jacob A Zahm1†, Michael G Stewart2†, Joseph S Carrier2, Stephen C Harrison1*, Matthew P Miller2* 1Department of Biological Chemistry and Molecular Pharmacology, Harvard Medical School, and Howard Hughes Medical Institute, Boston, United States; 2Department of Biochemistry, University of Utah School of Medicine, Salt Lake City, United States Abstract Chromosome segregation during cell division requires engagement of kinetochores of sister chromatids with microtubules emanating from opposite poles. As the corresponding microtubules shorten, these ‘bioriented’ sister kinetochores experience tension-dependent stabilization of microtubule attachments. The yeast XMAP215 family member and microtubule polymerase, Stu2, associates with kinetochores and contributes to tension-dependent stabilization in vitro. We show here that a C-terminal segment of Stu2 binds the four-way junction of the Ndc80 complex (Ndc80c) and that residues conserved both in yeast Stu2 orthologs and in their metazoan counterparts make specific contacts with Ndc80 and Spc24. Mutations that perturb this interaction prevent association of Stu2 with kinetochores, impair cell viability, produce biorientation defects, and delay cell cycle progression. Ectopic tethering of the mutant Stu2 species to the Ndc80c junction restores wild-type function in vivo. These findings show that the role of Stu2 in tension- *For correspondence: sensing depends on its association with kinetochores by binding with Ndc80c. [email protected] (SCH); [email protected]. edu (MPM) Introduction †These authors contributed Equal partitioning of duplicated chromosomes during cell division preserves integrity of the genome equally to this work in each of the two daughter cells. ‘Bioriented attachment’ of sister chromatids to opposite poles of the mitotic spindle in turn ensures that when a cell enters anaphase, each pair of sister chromatids Competing interests: The segregates accurately (reviewed in Cheeseman, 2014).
    [Show full text]
  • Conservation of Outer Kinetochore Proteins Across All Eukaryotes?
    JCB: Spotlight All that is old does not wither: Conservation of outer kinetochore proteins across all eukaryotes? Aruni P. Senaratne1,2 and Ines A. Drinnenberg1 1Institut Curie, Paris Sciences et Lettres Research University, Centre National de la Recherche Scientifique UMR 3664, F-75005 Paris, France 2Sorbonne Universités, University Pierre-and-Marie-Curie, F-75005 Paris, France The kinetochore drives faithful chromosome segregation conservation, it appears unexpected that computational surveys in all eukaryotes, yet the underlying machinery is diverse would fail to identify true homologues of canonical kinetochore proteins in kinetoplastids, a group of early-branching protozo- across species. D’Archivio and Wickstead (2017. J. Cell ans that include the trypanosomes. Biol. https​://doi​.org​/10​.1083​/jcb​.201608043) apply In 2014, a pioneering study by Akiyoshi and Gull (2014) sensitive homology predictions to identify proteins in performed the first foray into the composition of kinetoplastid kinetoplastids with similarity to canonical outer kinetochore kinetochores. These authors applied an elegant candidate ap- proach evaluating chromosomal localization patterns of un- proteins, suggesting some degree of universality in the characterized proteins encoded by cell cycle–regulated genes. eukaryotic kinetochore. This led to the identification of a protein that exhibited a typical “kinetochore-like” localization behavior, termed kinetoplastid High-throughput sequencing technologies combined with com- kinetochore protein 1 (KKT1). KKT1 was subsequently used as parative genomics have provided insights into the evolution of a starting point for iterative protein interaction surveys, which biological pathways. Computational prediction of homologous identified 18 additional kinetoplastid kinetochore components. pathway components can trace back the ancestral origin of the While the KKT proteins are conserved among kinetoplastid underlying genes.
    [Show full text]