Genome-Wide Association Study for Serum Omega-3 and Omega-6
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
ELOVL5 Rabbit Polyclonal Antibody – TA338477 | Origene
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA338477 ELOVL5 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 35 kDa Gene Name: ELOVL fatty acid elongase 5 Database Link: NP_068586 Entrez Gene 60481 Human Q9NYP7 Background: ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids.ELOVL5 plays a role in elongation of long-chain polyunsaturated fatty acids (Leonard et al., 2000 [PubMed 10970790]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3003 AF338241.1 9-3011 Synonyms: dJ483K16.1; HELO1; SCA38 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, -
Rabbit Anti-Human ELOVL5 Polyclonal Antibody (DPABH-25302) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
Rabbit anti-Human ELOVL5 polyclonal antibody (DPABH-25302) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Condensing enzyme that catalyzes the synthesis of monounsaturated and of polyunsaturated very long chain fatty acids Acts specifically toward polyunsaturated acyl-CoA with the higher activity toward C18:3(n-6) acyl-CoA. Specificity BLAST analysis of the peptide immunogen showed no homology with other human proteins. Immunogen Synthetic 15 amino acid peptide from a region of Human ELOVL5 Isotype IgG Source/Host Rabbit Species Reactivity Human Purification Immunogen affinity purified Conjugate Unconjugated Applications IHC-P Format Liquid Size 50 μg Buffer Constituent: 99% PBS Preservative 0.1% Sodium Azide Storage Shipped at 4°C. Upon delivery aliquot and store at -80℃. Avoid freeze / thaw cycles. GENE INFORMATION Gene Name ELOVL5 ELOVL fatty acid elongase 5 [ Homo sapiens ] Official Symbol ELOVL5 Synonyms ELOVL5; ELOVL fatty acid elongase 5; ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3 like, yeast); elongation of very long chain fatty acids protein 5; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved dJ483K16.1; HELO1; ELOVL FA elongase 5; fatty acid elongase 1; 3-keto acyl-CoA synthase ELOVL5; homolog of yeast long chain polyunsaturated fatty acid elongatio; homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2; ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast); RP3-483K16.1; Entrez Gene ID 60481 Protein Refseq NP_001229757 UniProt ID Q9NYP7 Chromosome Location 6p21.1-p12.1 Pathway Biosynthesis of unsaturated fatty acids; Fatty Acyl-CoA Biosynthesis; Fatty acid biosynthesis, elongation, endoplasmic reticulum; Fatty acid elongation. -
Mouse Elovl5 Knockout Project (CRISPR/Cas9)
https://www.alphaknockout.com Mouse Elovl5 Knockout Project (CRISPR/Cas9) Objective: To create a Elovl5 knockout Mouse model (C57BL/6N) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Elovl5 gene (NCBI Reference Sequence: NM_134255 ; Ensembl: ENSMUSG00000032349 ) is located on Mouse chromosome 9. 8 exons are identified, with the ATG start codon in exon 2 and the TGA stop codon in exon 8 (Transcript: ENSMUST00000034904). Exon 3 will be selected as target site. Cas9 and gRNA will be co-injected into fertilized eggs for KO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Mice homozygous for a gene trapped allele have defects in fatty acid synthesis in the liver that result in hepatic steatosis. Also, majority of female mice have defects in female fertility. Exon 3 starts from about 6.58% of the coding region. Exon 3 covers 20.96% of the coding region. The size of effective KO region: ~188 bp. The KO region does not have any other known gene. Page 1 of 8 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele 5' gRNA region gRNA region 3' 1 3 8 Legends Exon of mouse Elovl5 Knockout region Page 2 of 8 https://www.alphaknockout.com Overview of the Dot Plot (up) Window size: 15 bp Forward Reverse Complement Sequence 12 Note: The 2000 bp section upstream of Exon 3 is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. -
The Proteomic Landscape of Resting and Activated CD4+ T Cells Reveal Insights Into Cell Differentiation and Function
International Journal of Molecular Sciences Article The Proteomic Landscape of Resting and Activated CD4+ T Cells Reveal Insights into Cell Differentiation and Function Yashwanth Subbannayya 1 , Markus Haug 1, Sneha M. Pinto 1, Varshasnata Mohanty 2, Hany Zakaria Meås 1, Trude Helen Flo 1, T.S. Keshava Prasad 2 and Richard K. Kandasamy 1,* 1 Centre of Molecular Inflammation Research (CEMIR), Department of Clinical and Molecular Medicine (IKOM), Norwegian University of Science and Technology, 7491 Trondheim, Norway; [email protected] (Y.S.); [email protected] (M.H.); [email protected] (S.M.P.); [email protected] (H.Z.M.); trude.fl[email protected] (T.H.F.) 2 Center for Systems Biology and Molecular Medicine, Yenepoya (Deemed to be University), Mangalore 575018, India; [email protected] (V.M.); [email protected] (T.S.K.P.) * Correspondence: [email protected] Abstract: CD4+ T cells (T helper cells) are cytokine-producing adaptive immune cells that activate or regulate the responses of various immune cells. The activation and functional status of CD4+ T cells is important for adequate responses to pathogen infections but has also been associated with auto-immune disorders and survival in several cancers. In the current study, we carried out a label-free high-resolution FTMS-based proteomic profiling of resting and T cell receptor-activated (72 h) primary human CD4+ T cells from peripheral blood of healthy donors as well as SUP-T1 cells. We identified 5237 proteins, of which significant alterations in the levels of 1119 proteins were observed between resting and activated CD4+ T cells. -
Identifying Blood Biomarkers for Mood Disorders Using Convergent
Molecular Psychiatry (2009) 14, 156–174 & 2009 Nature Publishing Group All rights reserved 1359-4184/09 $32.00 www.nature.com/mp ORIGINAL ARTICLE Identifying blood biomarkers for mood disorders using convergent functional genomics H Le-Niculescu1,2,3, SM Kurian4, N Yehyawi1,5, C Dike1,5, SD Patel1,3, HJ Edenberg6, MT Tsuang7, DR Salomon4, JI Nurnberger Jr3 and AB Niculescu1,2,3,5 1Laboratory of Neurophenomics, Department of Psychiatry, Indiana University School of Medicine, Indianapolis, IN, USA; 2INBRAIN, Department of Psychiatry, Indiana University School of Medicine, Indianapolis, IN, USA; 3Institute of Psychiatric Research, Indiana University School of Medicine, Indianapolis, IN, USA; 4Department of Molecular and Experimental Medicine, The Scripps Research Institute, La Jolla, CA, USA; 5Indianapolis VA Medical Center, Indianapolis, IN, USA; 6Department of Biochemistry and Molecular Biology, Indiana University School of Medicine, Indianapolis, IN, USA and 7Department of Psychiatry, University of California at San Diego, La Jolla, CA, USA There are to date no objective clinical laboratory blood tests for mood disorders. The current reliance on patient self-report of symptom severity and on the clinicians’ impression is a rate- limiting step in effective treatment and new drug development. We propose, and provide proof of principle for, an approach to help identify blood biomarkers for mood state. We measured whole-genome gene expression differences in blood samples from subjects with bipolar disorder that had low mood vs those that had high mood at the time of the blood draw, and separately, changes in gene expression in brain and blood of a mouse pharmacogenomic model. We then integrated our human blood gene expression data with animal model gene expression data, human genetic linkage/association data and human postmortem brain data, an approach called convergent functional genomics, as a Bayesian strategy for cross- validating and prioritizing findings. -
Systems Analysis of the Liver Transcriptome in Adult Male
www.nature.com/scientificreports OPEN Systems Analysis of the Liver Transcriptome in Adult Male Zebrafsh Exposed to the Plasticizer Received: 8 August 2017 Accepted: 15 January 2018 (2-Ethylhexyl) Phthalate (DEHP) Published: xx xx xxxx Matthew Huf1,2, Willian A. da Silveira1,3, Oliana Carnevali4, Ludivine Renaud5 & Gary Hardiman1,5,6,7,8 The organic compound diethylhexyl phthalate (DEHP) represents a high production volume chemical found in cosmetics, personal care products, laundry detergents, and household items. DEHP, along with other phthalates causes endocrine disruption in males. Exposure to endocrine disrupting chemicals has been linked to the development of several adverse health outcomes with apical end points including Non-Alcoholic Fatty Liver Disease (NAFLD). This study examined the adult male zebrafsh (Danio rerio) transcriptome after exposure to environmental levels of DEHP and 17α-ethinylestradiol (EE2) using both DNA microarray and RNA-sequencing technologies. Our results show that exposure to DEHP is associated with diferentially expressed (DE) transcripts associated with the disruption of metabolic processes in the liver, including perturbation of fve biological pathways: ‘FOXA2 and FOXA3 transcription factor networks’, ‘Metabolic pathways’, ‘metabolism of amino acids and derivatives’, ‘metabolism of lipids and lipoproteins’, and ‘fatty acid, triacylglycerol, and ketone body metabolism’. DE transcripts unique to DEHP exposure, not observed with EE2 (i.e. non-estrogenic efects) exhibited a signature related to the regulation of transcription and translation, and rufe assembly and organization. Collectively our results indicate that exposure to low DEHP levels modulates the expression of liver genes related to fatty acid metabolism and the development of NAFLD. Endocrine Disrupting Compounds (EDCs) are ubiquitous chemical compounds used in numerous consumer products as plasticizers or fame retardants that have been shown to have unforeseen impacts on the ecosystem1 and human health2. -
DNA Methylation Microarrays Identify Epigenetically Regulated Lipid
Płatek et al. Mol Med (2020) 26:93 https://doi.org/10.1186/s10020-020-00220-z Molecular Medicine RESEARCH ARTICLE Open Access DNA methylation microarrays identify epigenetically regulated lipid related genes in obese patients with hypercholesterolemia Teresa Płatek1* , Anna Polus1, Joanna Góralska1, Urszula Raźny1, Anna Gruca1, Beata Kieć‑Wilk2,3, Piotr Zabielski4, Maria Kapusta1, Krystyna Słowińska‑Solnica1, Bogdan Solnica1, Małgorzata Malczewska‑Malec1 and Aldona Dembińska‑Kieć1 Abstract Background: Epigenetics can contribute to lipid disorders in obesity. The DNA methylation pattern can be the cause or consequence of high blood lipids. The aim of the study was to investigate the DNA methylation profle in periph‑ eral leukocytes associated with elevated LDL‑cholesterol level in overweight and obese individuals. Methods: To identify the diferentially methylated genes, genome‑wide DNA methylation microarray analysis was performed in leukocytes of obese individuals with high LDL‑cholesterol (LDL‑CH, 3.4 mmol/L) versus control obese individuals with LDL‑CH, < 3.4 mmol/L. Biochemical tests such as serum glucose, total≥ cholesterol, HDL cholesterol, tri‑ glycerides, insulin, leptin, adiponectin, FGF19, FGF21, GIP and total plasma fatty acids content have been determined. Oral glucose and lipid tolerance tests were also performed. Human DNA Methylation Microarray (from Agilent Tech‑ nologies) containing 27,627 probes for CpG islands was used for screening of DNA methylation status in 10 selected samples. Unpaired t‑test and Mann–Whitney U‑test were used for biochemical and anthropometric parameters statistics. For microarrays analysis, fold of change was calculated comparing hypercholesterolemic vs control group. The q‑value threshold was calculated using moderated Student’s t‑test followed by Benjamini–Hochberg multiple test correction FDR. -
The Development and Improvement of Instructions
IDENTIFICATION OF SIGNIFICANTLY REGULATED GENES IN THE ESTROGEN INDUCED GALLUS GALLUS LIVER OVER A 24- HOUR TIME COURSE A Thesis by ERICA RENEE TROJACEK Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE December 2011 Major Subject: Nutrition IDENTIFICATION OF SIGNIFICANTLY REGULATED GENES IN THE ESTROGEN INDUCED GALLUS GALLUS LIVER OVER A 24- HOUR TIME COURSE A Thesis by ERICA RENEE TROJACEK Submitted to the Office of Graduate Studies of Texas A&M University in partial fulfillment of the requirements for the degree of MASTER OF SCIENCE Approved by: Chair of Committee, Rosemary Walzem Committee Members, Alice Villalobos Huaijun Zhou Intercollegiate Faculty Chair, Steven Smith December 2011 Major Subject: Nutrition iii ABSTRACT Identification of Significantly Regulated Genes in the Estrogen Induced Gallus gallus Liver Over a 24-Hour Time Course. (December 2011) Erica Renee Trojacek, B.S.; B.S., Texas A&M University Chair of Advisory Committee: Dr. Rosemary Walzem In birds, estrogen is a strong stimulator of gene programs that regulate the formation of very low density lipoproteins (VLDL). Apolipoprotein-B (ApoB) is an integral part of very low density lipoproteins. In mammals, the rate of ApoB synthesis is controlled by post-translational means. In contrast, estrogen treated birds show changes in ApoB transcript level; in a natural setting, the bird‟s metabolism and transcription are in great flux due to yolk formation. Besides the ApoB gene, the entire complement of genes that is necessary to form a VLDL is not known. To determine the genes that play a role in the formation of VLDL 7-10d old chicks were injected with estrogen at several time points over a 24hr period. -
Primary Open-Angle Glaucoma Genes
Eye (2011) 25, 587–595 & 2011 Macmillan Publishers Limited All rights reserved 0950-222X/11 www.nature.com/eye Primary open-angle JH Fingert REVIEW glaucoma genes Abstract of important biological pathways that once identified may help clarify the mechanisms that A substantial fraction of glaucoma has a lead to disease. The discovery of disease genes genetic basis. About 5% of primary open angle will also continue to provide insights into the glaucoma (POAG) is currently attributed to normal function of the eye. single-gene or Mendelian forms of glaucoma Discovery of the genes that cause eye disease (ie glaucoma caused by mutations in myocilin may also provide useful information for or optineurin). Mutations in these genes have a patients and their physicians. Identifying these high likelihood of leading to glaucoma and are genes will enable the design of DNA-based tests rarely seen in normal subjects. Other cases of that may help physicians assess their patient’s POAG have a more complex genetic basis and risk for disease and may also differentiate are caused by the combined effects of many between clinically similar disorders. Many genetic and environmental risk factors, each of such tests are already available on both a which do not act alone to cause glaucoma. fee-for-service and research basis (http:// These factors are more frequently detected in www.genetests.org). Identification of the patients with POAG, but are also commonly specific mutation or mutations that are observed in normal subjects. Additional genes responsible for a patient’s disease not only that may be important in glaucoma solidifies the diagnosis, but may also help pathogenesis have been investigated using predict its likely clinical course. -
In Spino-Cerebellar Tissue, Ataxin-2 Expansion Affects Ceramide-Sphingomyelin Metabolism
Preprints (www.preprints.org) | NOT PEER-REVIEWED | Posted: 5 November 2019 doi:10.20944/preprints201911.0042.v1 Peer-reviewed version available at Int. J. Mol. Sci. 2019, 20, 5854; doi:10.3390/ijms20235854 Article In Spino-Cerebellar Tissue, Ataxin-2 Expansion Affects Ceramide-Sphingomyelin Metabolism Nesli-Ece Sen1,2, Aleksandar Arsovic1, David Meierhofer3, Susanne Brodesser4, Carola Oberschmidt1, Júlia Canet-Pons1, Zeynep-Ece Kaya1,5, Melanie-Vanessa Halbach1, Suzana Gispert1, Konrad Sandhoff4,*, Georg Auburger1,* 1 Experimental Neurology, Building 89, Goethe University Medical Faculty, Theodor Stern Kai 7, 60590 Frankfurt am Main, Germany; 2 Faculty of Biosciences, Goethe-University Frankfurt am Main, Germany; 3 Max Planck Institute for Molecular Genetics, Ihnestrasse 63-73, 14195 Berlin, Germany; 4 Membrane Biology and Lipid Biochemistry Unit, Life and Medical Sciences Institute, University of Bonn, Bonn, Germany; 5 Cerrahpasa School of Medicine, Istanbul University, 34098 Istanbul, Turkey * Correspondence: [email protected]; [email protected]; Tel.: +49-228-73-5346 (K.S.); +49- 69-6301-7428 (G.A.) Abstract: Ataxin-2 (ATXN2) acts during stress-responses, modulating mRNA translation and nutrient metabolism. Atxn2 knockout mice exhibit progressive obesity, dyslipidemia and insulin resistance. Conversely, the progressive ATXN2 gain-of-function due to polyGlutamine (polyQ) expansions leads to a dominantly inherited neurodegenerative process named spinocerebellar ataxia type 2 (SCA2), with early adipose tissue loss and late muscle atrophy. We tried to understand lipid dysregulation in a SCA2 patient brain and in an authentic mouse model. Thin layer chromatography of a patient cerebellum was compared to the lipid metabolome of Atxn2-CAG100- KnockIn (KIN) mouse spinocerebellar tissue. -
Coenzyme and Cofactor Metabolism Belongs to Biochemical Processes
Nawrocki et al. Medical Journal of Cell Biology 2019 DOI: 10.2478/acb-2019-0021 Received: 22.10.2019 Accepted: 26.11.2019 Coenzyme and cofactor metabolism belongs to biochemical processes significantly regulated in human granulosa cells collected after IVF during long-term primary in vitro culture Mariusz J. Nawrocki1 2 3, Piotr Celichowski4, Leszek Pawelczyk3 3, Claudia Dompe5, Bartosz Kempisty1,4,6, Paul Mozdziak7 , Rafał Sibiak , Maciej Brązert , Błażej Chermuła Abstract Granulosa cells (GCs) provide the microenvironment necessary for the development of the follicle and the maturation of the oocyte. GCs are associated with reproductive system function and the maintenance of pregnancy by participating in the synthesis of steroid hormones. Many authors point to new ways of using GCs in regenerative medicine and indicate the significant plasticity of this cell population, suggesting that GCs can undergo a transdifferentiation process. Employing primary in vitro cell cultures and high-thro- ughput transcriptome analysis via Affymetrix microarrays, this study describes groups of genes associated with enzymatic reactions. 52 genes were identified belonging to four gene ontology biological process terms (GO BP): “coenzyme biosynthetic process”, “coenzyme metabolic process”, “cofactor biosynthetic process” and “cofactor metabolic process”. All identified genes showed reduction in the level of mRNA expression during long-term in vitro cultivation. Significanthe transcriptomic profile variability was exhi- bited for the genes (ELOVL5, ELOVL6 -
A NOVEL Cerna ANALYSIS for LMNA and ZMPSTE24 RELATED to MECHANISMS of PROGEROID LAMINOPATHIES
EJONS International Journal on Mathematic, Engineering and Natural Sciences ISSN 2602 - 4136 Article Arrival Date Article Type Article Published Date 18.05.2020 Research Article 12.06.2020 Doi Number: http://dx.doi.org/10.38063/ejons.251 A NOVEL ceRNA ANALYSIS FOR LMNA AND ZMPSTE24 RELATED TO MECHANISMS OF PROGEROID LAMINOPATHIES Nazlı Irmak GİRİTLİOĞLU Molecular Biologist and Bioengineering Specialist, Istanbul/Turkey [email protected], https://orcid.org/0000-0001-5034-0984 ABSTRACT Progeroid syndromes are diseases that display old-age features such as skin aging (loss of elastin and skin thinning), cardiovascular problems, alopecia at young ages. One of the most known progeroid syndromes is Hutchinson-Gilford Progeria Syndrome (HGPS). HGPS is caused by LMNA de novo point mutation and as a result, a toxic protein that accumulates in the inner nuclear membrane called progerin is produced. Zinc Metallopeptidase STE24 (ZMPSTE24, also known as FACE-1 in humans) is an enzyme that has important functions in post-translational modifications. ZMPSTE24 mutations also can cause progeroid syndromes. Competing endogenous RNA (ceRNA) is a relatively new hypothesis that claims RNAs communicate with each other and regulate each other’s expressions via shared microRNA (miRNA)s. In this study, a ceRNA analysis was performed for mRNAs of LMNA and ZMPSTE24. Firstly, related miRNAs of LMNA and ZMPSTE24 mRNAs were found in miRTarBase, and the results with both strong and less strong evidence were considered. Then, other genes related to these miRNAs that have only strong evidence in miRTarBase were chosen and hit scores of these genes were calculated. The Gene Ontology (GO) Resource GO Enrichment analysis 359 algorithm was used for P values (<0.05) of molecular functions of these genes which have the highest hit scores.