Aphanomyces Euteiches Par Une Approche Génomique

TTHHÈÈSSEE

En vue de l'obtention du

DOCTORAT DE L’UNIVERSITÉ DE TOULOUSE

Délivré par l’Université Toulouse III – Paul Sabatier Discipline ou spécialité : Biosciences Végétales

Présentée et soutenue par Mohammed-Amine Madoui Le 12 mai 2009

Identification d'effecteurs du pouvoir pathogène et de voies métaboliques chez l'oomycète Aphanomyces euteiches par une approche génomique

JURY

Harald Keller (Rapporteur) – Directeur de Recherhce à l’UMR IPMSV, INRA/CNRS/UNSA, Sophia Antipolis Marc-Henri Lebrun (Rapporteur) – Directeur de Recheche à l’UMR 5240, CNRS/UCB/INSA/BCS, Lyon Hubert Schaller (Examinateur) - Chargé de Recherche à l'UPR 2357 CNRS / Université de Strasbourg Mathieu Arlat (Président du jury) – Professeur au LIPM, INRA/CNRS, Castanet-Tolosan Bernard Dumas (Directeur de thèse) – Chargé de Recherche à l’UMR 5546, CNRS/Université Paul Sabatier - Toulouse III Elodie Gaulin (Directrice de thèse) – Maître de Conférences à l’UMR 5546, CNRS/Université Paul Sabatier - Toulouse III

Ecole doctorale : SEVAB, Sciences Ecologiques, Vétérinaires, Agronomiques et Bioingénieries

Unité de recherche : UMR 5546 CNRS - UPS, Surface Cellulaires et Signalisation chez les Végétaux

Directeurs de Thèse : Bernard Dumas et Elodie Gaulin

. 2 Remerciements

Je remercie en premier lieu mes encadrants, Bernard Dumas et Elodie Gaulin pour m’avoir fait confiance pendant et à la suite de mon stage de master et pour m’avoir permis de réaliser mes travaux de thèse dans de très bonnes conditions. Je les remercie également pour leur encadrement de qualité qui m’a permis de me former à la démarche de la recherche scientifique ainsi qu’aux techniques de la biologie moléculaire. Merci à vous deux pour votre patience et votre dévouement.

Je remercie ensuite mes deux aides précieuses, Catherine Mathé et Hélène San Clémente qui m’ont donné goût à la programmation. Elles m’ont largement aidé à me former et à mettre en pratique les notions de bioinformatique acquises de jours en jours. Un grand merci à vous deux pour vos enseignements.

Un énorme merci à Justine Bertrand-Michel de la plate-forme de lipidomique de l’INSERM de Purpan. Merci pour l’investissement considérable qu’elle a apporté dans les travaux de biochimie des stérols d’Aphanomyces. Merci également à Hubert Schaller pour ses conseils avisés lors de mon comité de thèse et pour le suivi de mes travaux.

Je tiens également à remercier spécialement Arnaud Bottin pour tous les repas passés ensemble à discuter d’Aphanomyces et à confronter nos hypothèses sur ce parasite. Je souhaite aussi remercier Christophe Jacquet, Marie-Thérèse Esquerré-Tugayé, Francis Carbonne et Claude Lafitte pour leur participation à mes travaux durant les diverses réunions d’équipe.

Et puis que seraient ces trois années passées sans la présence des autres doctorants ? Merci à Valérie Jaulneau pour l’ambiance qu’elle a mis dans le laboratoire. Et merci aux autres doctorants : aux anciens comme Marc, Ilham, Joanne et Nasser ainsi qu’au nouveau, merci Mathieu pour ta bonne humeur.

Un grand merci aux services communs de l’UMR 5546, à Jean-Luc, Catherine, Nicole et Michèle.

Et enfin merci à toutes les personnes qui ne sont pas du laboratoire mais qui m’ont aidé ou ont participé à un moment donné à mes travaux, alors merci à Martina Rickauer du laboratoire SP2 de l’INP/ENSAT, à David Allouche et à Didier Laborie de la plateforme bioinformatique de l’INRA de Toulouse, à Gérald Salin et à Julien Sarry de la plateforme génomique de Toulouse.

3 4 Sommaire

Résumé...... 7 Abstract ...... 9 Chapitre 1 : Introduction ...... 11 1 Les oomycètes : classification et importance...... 13 1.1 Caractéristiques et classification des oomycètes...... 13 1.2 Des microorganismes parasites de plantes et d'animaux...... 15 2. Génomique des oomycètes...... 17 2.1 Banques d’ESTs et génomes d’oomycètes...... 17 2.2 Outils bioinformatiques dédiés à l’étude des oomycètes ...... 21 2.3 Effecteurs du pouvoir pathogène...... 23 3. Aphanomyces euteiches, un parasite des légumineuses ...... 31 3.1 La pourriture racinaire précoce du pois...... 31 3.2 Biologie d’A. euteiches...... 35 3.3 Variabilité du pouvoir pathogène...... 41 4 Objectifs de la thèse ...... 43 Chapitre 2 : AphanoDB: une ressource génomique pour Aphanomyces ...... 47 Introduction ...... 49 Article 1 : AphanoDB : a genomic ressource for Aphanomyces pathogens...……...... 51 Conclusion...... 59 Chapitre 3 : Identification d’effecteurs et de voies métaboliques chez Aphanomyces euteiches ...... 61 Introduction ...... 63 Article 2 : Transcriptome of Aphanomyces euteiches : New Oomycete Putative Pathogenicity Factors and Metabolic Pathways………………………………………………65 Conclusion...... 77 Chapitre 4 : Synthèse de sterols chez A. euteiches...... 79 Introduction aux stérols...... 81 Structure chimique et nomenclature des stérols...... 81 Diversité des stérols chez les organismes vivants...... 83 Fonctions biologiques des stérols...... 85 Voies de synthèse de stérols...... 89 Article 3 : Sterol metabolism in the oomycete Aphanomyces euteiches, a legume root pathogen…………………………………………………………………………………....91 Conclusion...... 107 Chapitre 5 : Discussion ...... 109 1. Génomique d’A. euteiches...... 111 2. Identification de gènes d’interêt chez A. euteiches ...... 112 3. Synthèse des stérols par A. euteiches ...... 113 3.1 Une nouvelle voie de synthèse identifiée...... 113 3.2 Voie des stérols et molécules anti-oomycètes...... 115 4. Conclusion...... 116 Références ...... 117

5 6

Résumé

été déposées. L’exploitation d’AphanoDB a permis l’identification de nouveaux effecteurs putatifs du pouvoir pathogène et de voies métaboliques originales comme celle des stérols.

L'étude de ce métabolisme a été approfondie par une approche biochimique. Contrairement à d'autre oomycètes comme Phytophthora, incapables de synthétiser des stérols, A. euteiches possède tous les gènes nécessaires à leur synthèse. L’analyse biochimique des stérols d’A. euteiches a montré que le fucostérol correspond au stérol majoritaire. L’inhibition de la synthèse de stérols par des triazoles comme le tébuconazole et l’époxiconazole a conduit à une inhibition de la croissance mycélienne. L'ensemble de ces travaux, associant des approches génomique et biochimique, ont permis une meilleur compréhension de la biologie et du pouvoir pathogène d'A. euteiches. Ils permettront à terme de définir de nouvelles pistes de recherches pour lutter plus efficacement contre la pourriture racinaire des légumineuses.

Abstract

Oomycetes are a group of eukaryotic microorganisms causing devastating diseases on crops.

Pea root rot disease caused by the oomycete Aphanomyces euteiches is the causal agent of important damages on legumes. To identify effectors of pathogenicity and metabolic pathways a transcriptomic approach was developped. In silico analysis of 20, 000 cDNAs obtained from the ATCC201684 strain led to the development of a database, AphanoDB, which is an online genomic ressource containing processed A. euteiches ESTs. Data mining on AphanoDB allowed identifying new putatives effectors, and metabolic pathways, such as a sterol biosynthesis pathway. While most of oomycetes such as Phytophthora are unable to produce their own sterols, all the genes required for sterol synthesis were found in

A. euteiches. Biochemical analysis showed that fucosterol is the major A. euteiches sterol.

Inhibition of sterol synthesis with triazoles, such as tebuconazole and epoxiconazole, led to an inhibition of mycelial growth. This study is the first overview of A. euteiches genomic, transcriptomic and metabolism that paves the way to the identification of new molecular targets to design anti-Aphanomyces chemicals.

9 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

10 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Chapitre 1 : Introduction

11 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Figure 1 : Arbre phylogénique des eucaryotes inféré par maximum de vraissemblance et analyse bayesienne de 16 protéines codées par le noyau. Les Chromalvéolés constituent un groupe monophylétique composés des Chromistes (Straménopiles, Haptophytes et Cryptophytes) et des Alvéolés (Ciliés, Dinoflagélés et Apicomplexes). Les oomycètes appartiennent au phylum des Straménopiles et sont ici représentés par Phytophthora sojae et Phytophthora ramurum dans un clade contenant également la diatomée Thalassiosira pseudonana. (Hacket et al, 2007). Les valeurs des bootstrap sont situées au dessus de chaque branche. Les branches épaisses ont une probabilité a posteriori de 1. L’arbre est enraciné sur le super-groupe des Opistokontes.

12 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

1 Les oomycètes : classification et importance

1.1 Caractéristiques et classification des oomycètes

La classe des oomycètes regroupe plus de 600 espèces de micro-organismes filamenteux vivant en milieux marin ou terrestre (Dick et al. 1999). Ces microorganismes coenocytiques sont pour la plupart homothalliques. Certains oomycètes ont un mode de vie saprophyte et se nourrissent par conséquent de débris organiques (Margulis and Schwartz 1998). D’autres sont des parasites d’algues, d’animaux ou de plantes. Dans les anciennes classifications, plusieurs caractéristiques phénotypiques et biochimiques ont conduit au classement des oomycètes au sein du règne des champignons. Parmi ces caractéristiques communes, on trouve la structure filamenteuse, l’absence de pigment chlorophyllien et l’organotrophie. Cependant, la présence de cellulose dans les parois cellulaires, la diploïdie au cours de l'essentiel du cycle de développement, l’existence de zoospores biflagellées et les analyses phylogénétiques moléculaires montrent que les oomycètes n’appartiennent pas au règne des champignons. Les dernières études phylogéniques ont démontré que les oomycètes appartiennent au super- groupe des chromalvéolés (Chromalveolata) (Hackett et al. 2007; Harper, Waanders, and

Keeling 2005; Martens, Vandepoele, and Van de Peer 2008). Les chromalvéolés sont subdivisés en deux groupes, les Chromistes (Chromista) et les alvéolés (Alveolata). Le groupe des Alvéolés comprend des organismes non phototrophes appartenant au phylum des Ciliés, des Apicomplexes ou des Dinoflagéllés. Le groupe des chromistes comprends trois phyla : les

Cryptophytes, les Haptophytes et les Straménopiles (aussi appelés Hétérokontes) (Figure 1).

La présence des plastes chez les Chromalvéolés aurait comme origine l’endosymbiose secondaire d’une algue rouge, il semblerait que la majorité des groupes photosynthétiques de

Chromalvéolés ait une origine unique (Li et al. 2006; Martens, Vandepoele, and Van de Peer

2008; Patterson and Corliss 1989).

13 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Tableau 1 : Classification des oomycètes parasites de plantes ou d'animaux les plus étudiés selon la classification taxonomique disponible sur le site NCBI (http://www.ncbi.nlm.nih.gov/Taxonomy). La liste des organismes infectés par ces oomycètes n’est pas exhaustive mais représente les hôtes majoritairement associés à l’oomycète concerné.

Sous-classe Ordre Famille Genre Espèce Hôtes

Saprolegniomycetidae Saprolegniales Saprolégniaceae Aphanomyces euteiches Légumineuses, céréales cochlioides Betteraves, épinards astaci Crustacées

Saprolegnia parasitica Poissons ferax Poissons, amphibiens

Peronosporomycetidae Pythiales Pythiaceae Pythium ultimum Angiospermes oligandrum Solanacées insidiosum Mammifères

Peronosporales Peronosporaceae Hyaloperonospora parasitica Crucifères

Plasmopara viticola Vigne

Phytophthora sojae Soja ramorum Chêne parasitica Solanacées infestans Solanacées

14 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Au sein de l’embranchement des Straménopiles, les oomycètes sont phylogénétiquement proche des diatomées (Bacillariophyceae), des algues dorées (Pelagophyceae) et des algues brunes (Pheophyceae) (Figure 1).

1.2 Des microorganismes parasites de plantes et d'animaux

La classe des oomycètes comprend des parasites destructeurs de nombreuses plantes cultivées. La sous-classe des Peronosporomycetidae (Tableau 1), comprend certaines espèces pathogènes d’animaux et de nombreuses espèces phytopathogènes responsables de maladies communément appelées "mildiou" (francisation du nom anglais « mildew »). On trouvera ainsi Phytophthora infestans (Figure 2.1), responsable du mildiou de la pomme de terre, qui a causé une importante famine aux conséquences tragiques dans l’Irlande du XIXème siècle.

Les études phylogénétiques de différentes souches de P. infestans montrent que celles qui se situent actuellement en Europe sont toutes originaires des Andes (Gomez-Alpizar, Carbone, and Ristaino 2007), une des régions initiales de la culture des solanacées dans le monde.

L'oomycète responsable du mildiou de la vigne, Plasmopara viticola (Figure 2.B), a

également été importé depuis l’Amérique et infecte toutes les plantes du genre vitis. Certains oomycètes sont des parasites responsables de pourritures racinaires comme par exemple

Phytophthora sojae (Figure 2.C), à l'origine de lourdes pertes sur les cultures de soja (Wrather et al. 2001).

La sous-classe des Saprolegniomycetidae (Tableau 1) comprend des espèces phyto et zoopathogènes. Ainsi le genre Aphanomyces regroupe plusieurs espèces de parasites racinaires. Parmi les plus importants d'un point de vue agronomique, on trouve Aphanomyces cochlioides (Figure 2.D) qui infecte la betterave et l’épinard ainsi qu’Aphanomyces euteiches

(Figure 2.E) qui infecte une large gamme de légumineuses telles que le haricot, la luzerne et le pois. La maladie du pois causée par A. euteiches est appelée « pourriture racinaire précoce»

15 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

A B C

DE F

G H I

Figure 2 : Illustration des principaux oomycètes pathogènes et de leurs hôtes. A. Phytophthora infestans sur pomme de terre (www.agen.ufl.edu). B. Plasmopara. viticola sur la vigne (www.apsnet.org). C. Champ de soja contaminé par Phytophthora s ojae (www.apsnet.org). D. Betterave saine à gauche et infecté par A. cochlioides à droite (www.apsnet.org). E. Champ de pois contaminé par Aphanomyces euteiches (INRA). F. Cheval infecté par Pythium in sidiosum (www.cpap.embrapa.br). G. Saprolegnia p arasitica sur une Perche (www.umassvegetable.org). H. Pythium u ltimum sur des pommes de terre (www.gov.mb.ca). I. Hyaloperonospora parasitica sur le broccoli (www.bspp.org.uk)

16 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

(Gaulin et al. 2007). L’ampleur des dégâts causés par cette maladie en France et le manque de moyen de lutte efficace contre cette maladie ont limité fortement l'extension de la culture de pois fourrager en France. D'autres oomycètes sont responsables de maladies sur les animaux, tel que Pythium insidiosum (Figure 2.F) capable d’infecter des mammifères comme le chien, le cheval et l’homme et provoquant une maladie appelé pythiose (Mendoza, Hernandez, and

Ajello 1993). Cependant la plupart des hôtes d'oomycètes parasites d'animaux sont des organismes aquatiques, comme les poissons et les crustacés (van West 2008). Pour exemple, les épizooties dûes à Saprolegnia parasitica (Figure 2.G) ont de lourdes conséquences sur la production et les rendements de la pêche et des fermes piscicoles (Hatai and Hoshiai 1992).

De façon similaire, Aphanomyces astaci vivant en milieu aquatique serait responsable de la disparition de la plupart des écrevisses dites « Europénnes » (Unestam and Weiss 1970)

(Austropotamobius pallipes ). Il semblerait que la souche d’A. astaci ait été importée en

Europe au XIXème siècle via des écrevisses dites « Américaines » (Orconectes limosus ) introduite dans les cours d’eau européens (Vennerström, Söderhäll, and Cerenius 1998).

2. Génomique des oomycètes

2.1 Banques d’ESTs et génomes d’oomycètes

La plupart des produits phytosanitaires utilisés habituellement contre les maladies fongiques sont généralement inefficaces contre les maladies causées par les oomycètes. Afin d'identifier de nouvelles cibles de molécules anti-oomycètes et de mieux comprendre les mécanismes moléculaires infectieux des oomycètes, des projets de séquençages de banque d’ADNc à grande échelle et de génomes ont été développés. Ces projets ont concerné en priorité plusieurs espèces de Phytophthora, ceci étant justifié par l’importance des dégâts causés par ces organismes sur des plantes cultivées d'intérêt agronomique majeur comme le soja et la pomme de terre.

17 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Tableau 2 : Données de génomiques d’oomycètes disponibles. Les données d’EST sont celles disponibles sur le NCBI.

Organismes Taille du génome (Mb) Nombre de gènes (x 1000) Nombre d'ESTs Couverture du génome

Phytophthora infestans 237 22 94 k 9x

Phytophthora ramorum 65 16 - 7x

Phytophthora sojae 95 18 41K 9x

Phytophthora capsici 60-70 - 56457 2-30x (en cours)

Phytophthora parasitica 60-70 - 3 568 -

Phytophthora nicotinae 60-70 - 755 -

Phytophthora brassicae - - 12922 -

Phytophthora colosaiae - - 6 -

Phytophthora megakarya - - 1 -

Hyaloperonospora parasitica 75 14,7 387 8,5x

Pythium ultimum - - 100391 -

Pythium oligandrum - - 4652 -

Plasmopara viticola - - 10 -

Plasmopara halstedii - - 145 -

Saprolegnia parasitica - - 1513 -

Aphanomyces piscida - - 3 -

Aphanomyces cochlioides - - 3599 -

Aphanomyces euteiches - - 19160 -

18 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Les efforts de séquençage (Tableau 2) se sont tout d'abord focalisés sur P. infestans, une banque de 1000 clones d’ADNc issues d’hyphes a été réalisée (Kamoun et al. 1999). En 2003,

2147 ESTs ont été obtenues à partir de P. infestans (Torto et al. 2003) qui furent complétées par 75757 ESTs issues de 20 banques d’ADNc différentes représentant un large spectre de condition de culture (Randall et al. 2005). L’assemblage de ces séquences a permis l’annotation et la prédiction de 18256 unigènes. Parmi les gènes identifiés, plusieurs interviennent dans les mécanismes infectieux et sont communs aux champignons.

P. sojae a également fait l'objet d'un séquençage massif d'ADNc. 3035 ESTs issues de sojas infectés par P. sojae ont été obtenues (Qutob et al. 2000). Les 3035 ESTs obtenues ont pu être analysées et classées selon différents critères comme l’homologie avec d’autres séquences connues, le pourcentage de GC, la présence de motifs conservés. Les premiers ESTs de

P. sojae ont été complété par la suite par d’autres programmes de séquençages sur des banques d’ADNc issues de mycélium cultivé dans des conditions de culture différentes. Les

ESTs de P. sojae ont atteint finalement un total de 28 913 ESTs assemblées en 13 234 unigènes. D’autres organismes du genre de Phytophthora ont pu aussi faire l’objet de séquençage d’ADNc. 755 ESTs de P. nicotianae ont été obtenus et assemblés en 386 unigènes qui ont permis la mise en évidence de gènes intervenant spécifiquement dans certaines phases de développement de l’organisme (Shan, Marshall, and Hardham 2004;

Skalamera, Wasson, and Hardham 2004). P. parasitica a également bénéficié du séquençage de 3568 clones d’ADNc obtenus à partir de mycélium cultivé in vitro . Les ESTs furent ensuite assemblés en 2269 unigènes (Panabieres et al. 2005). L’obtention de souche de

P. parasitica exprimant une gène rapporteur de type GFP, a permis d’établir précisément les stades de l’interaction avec la tomate. Ainsi 4 000 ESTs ont été générées au moment de la phase tardive de l’interaction (phase nécrotrophe). L’analyse de ces ESTs de P. parasitica (Le

Berre, Engler, and Panabieres 2008) a permis d’identifier de nombreux gènes intervenant dans

19 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction - la phase nécrotrophe de la croissance du pathogène. Récement, 90 664 ESTs de Pythium ultimum ont été générés par pyroséquençage, les ESTs ont été assemblés en 35 507 unigènes

(Cheung et al. 2008).

Certains ESTs d’organismes appartenant aux Saprolégniales ont également été obtenus. 1513

ESTs de S. parasitica ont été générés puis assemblés en 1155 unigènes (Torto-Alalibo et al.

2005). Chez le genre Aphanomyces, trois banques de 1500 ADNc issues d’A. cochliodes de trois conditions de culture différentes, un milieu de culture pauvre, un milieu de culture riche et une condition d’infection d’une lignée sensible de betterave (Weiland and MacGrath 2006).

Au total, 3599 ESTs ont été générés puis assemblés en 1964 unigènes. Les unigènes ont été annotés puis implémentés sur la « Oomycete Genomic Database » (www.oomycete.org).

Les premiers séquençages de génome ont été entrepris par le Joint Genome Institute (JGI,

USA) en 2004 sur les espèces P. sojae et P. ramorum (Govers and Gijzen 2006). La méthode rapide de séquençage par shotgun (ou Whole-Genome Shotgun) a permis de bénéficier très tôt des données nucléiques pour ces deux espèces, à savoir 86 Mb, avec une couverture de 9x, comportant 19 027 modèles de gènes chez P. sojae et de 66.6 Mb, avec une couverture de 7x, comportant 15 743 modèles de gènes chez P. ramorum (Tyler et al. 2006). Par la suite le séquençage du génome de P. infestans a été entrepris au Broad Institute, USA. Le génome génome de 237 Mb comportant 22658 modèles de gènes, les données sont disponibles sur

Phytophthora infestans genome database (http://www.broad.mit.edu/) (Nusbaum 2008). Il s’avère que 50 Mb du génome de P. infes tans sont uniquement constitués de séquences répétées ce qui a rendu l’assemblage du génome difficile. Le JGI a également séquencé le génome de Hyaloperonospora parasitica qui comporte 75 Mb avec une couverture de 8,5x.

La recherche de modèle de gène a conduit à l’identification de 14 700 modèles de gènes.

Pour l’ensemble de ces génomes, la prédiction de gènes a été réalisée à l’aide de l’algorithme

20 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

FGENESH (Solovyev, Salamov, and Lawrence 1994). Les ESTs disponibles pour chacune des espèces ont facilité la prédiction des modèles de gènes. Ceci a permis de mettre à la disposition de la communauté scientifique les protéomes prédits de ces différents organismes sur différents sites web et bases de données.

2.2 Outils bioinformatiques dédiés à l’étude des oomycètes

L’essor du nombre de données nucléiques et leur mise à disposition à la communauté scientifique a nécessité le développement de bases de données. Elles sont pour la plupart facilement utilisables sur Internet et permettent de récupérer les données nucléiques et protéiques. Oomycete Genomics Database (http://www.oomycete.org/) contient en plus des données génomiques de Phytophthora, les données de transcrits de Hyaloperonospora parasitica, Plasmopara halstedii, Saprolegnia parasitica et Aphanomyces cochlioides . Cette base de données contient également des données de génomique de clones de P. infestans. VBI

Microbial Database V3.0 (http://phytophthora.vbi.vt.edu/) est un portail qui permet d’accéder aux bases de données du Virginia Bioinformatics Institute (VBI). Les génomes de P. sojae,

P. ramorum, P. infestans. H. parasitica sont disponibles. En plus des bases de données génomiques, le VBI met également à disposition une base de données des EST de P. sojae,

P. infestans et H. parasitica. (Tripathy et al. 2006). BI Phytophthora infestans database est une base de données développée par le Broad Institut. Le site permet l’accès au génome de P. infestans ainsi qu’aux annotations. JGI genome database (http://genome.jgi-psf.org/) est un ensemble de base de données de génomes eucaryotes et procaryotes dont celui de P. sojae,

P. ramorum, P. capsici. Le site propose une large gamme d’outils de recherche sur les modèles de gènes. L’annotation de ces modèles est très complètes, annotation BLAST sur les protéines connues, recherche de domaine InterPro et l’assignation de catégorie Gene

Ontology. En plus de ces

21 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

22 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction - trois genomes de Phytophthora, le JGI met également à disposition le génome entièrement séquencés de trois autres chromalvéolés celui des diatomés Thalassiosisra pseudonana et

Phaeodactylum trichornotum et celui de la Pelagophyceae, Aureococcus anophagefferens.

Phytophthoradb (University of Califonia) (http://www.phytophthoradb.org) élaborée par l’université de Pennsylvanie est plus particulièrement dédiée à la recherche de marqueurs génétiques et contient des données de marqueurs sur 93 espèces de Phytophthora. La particularité de cette base de données et de pouvoir effectuer sur le site des analyses RFLP virtuelles.

L’ensemble de ce type d’outils facilite grandement la recherche in silico de gène d’interêt en offrant notamment la possibilité de les identifier par mots clés, catégorie fonctionnelles, ou par leurs relations de paralogie/orthologie avec d’autres organismes. Ces gènes d’interêt pourront être ensuite expérimentalement testés.

2.3 Effecteurs du pouvoir pathogène

2.3.1 Définition et généralités sur les effecteurs

Au cours d’une interaction avec la plante, les oomycètes secrètent des molécules qui participent à l’infection des cellules hôtes et qui sont regroupées sous le terme d'effecteurs. Il s'agit notamment de protéines impliquées dans l'adhésion du parasite aux cellules de l'hôte ou encore la dégradation de molécules végétales. Une classe importante de ces molécules a pour rôle de bloquer la mise en place des réactions de défense de l’hôte afin de faciliter la colonisation de l’hôte. Les données moléculaires sur les génomes d’oomycète et les outils bioinformatiques ont permis la recherche et l’identification in silico d’effecteurs protéiques en recherchant notamment l’occurence d’un peptide signal dans les séquences.

23 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Figure 3 : Schéma représentant le mode d’action des effecteurs sécrétés par les oomycètes. En bleu figurent les effecteurs et les cibles apoplasmiques, en rouge les effecteurs et les cibles symplasmiques (Kamoun 2006). Les effecteurs apoplasmiques sont sécrétés dans l’espace extracellulaire et vont pouvoir interagir avec des cibles végétales pariétales ou membranaires. Les effecteurs symplasmiques sont sécrétés dans l’apoplasme puis ils sont internalisés dans la cellule végétale où ils peuvent interagir avec une cible cytoplasmique.

24 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Les effecteurs sont classés sous le terme de cytoplasmique ou apoplastique en fonction de leur localisation dans les tissus de l’hôte. Certains sont capables d’interagir avec une ou plusieurs cibles appartenant à la plante hôte (Figure 3) (Kamoun 2006). Cette cible peut être localisée soit dans l’espace extracellulaire, et dans ce cas l’effecteur est sécrété au niveau de l’apoplasme, ou bien dans le cytoplasme ce qui nécessite la translocation de l'effecteur dans le cytoplasme de la cellule hôte. Les effecteurs d’oomycètes peuvent être également classés sur la base de leur fonction biologique. Le tableau 3 présente les effecteurs identifiés et validés expérimentalement (Tyler 2008)

2.2.2 Effecteurs cytoplasmiques

2.2.2.1 Les protéines à motif RxLR-dEER

Pour une espèce végétale donnée, certaines variétés peuvent être résistantes à une souche ou une race d'une espèce de microorganisme pathogène, alors que d’autres sont qualifiées de sensibles. Les travaux de Flor sur le pathosystème Lin-Melampsora lin i ont montré que la résistance dépend de la présence d'un gène de résistance chez la plante (R) et d'un gène dit

« d'avirulence » (Avr) chez le microorganisme (Flor 1941). Chez les oomycètes, plusieurs gènes d'avirulence ont été caractérisés par des approches génétiques. Il s'agit des gènes

AvrATR1 et AvrATR13 de H. parasitica (Rentel et al. 2008; Sohn et al. 2007), Avr1b-1 chez

P. sojae (Dou, Kale, Wang, Chen et al. 2008; Shan et al. 2004), Avr4 et Avr3a chez

P. infestans (Armstrong et al. 2005; Bos et al. 2006; Dou et al. 2008; Whisson et al. 2007; van

Poppel et al. 2008). Les gènes de résistance correspondant ont également été isolés chez les plantes hôtes. Ces derniers codent des protéines prédites pour être localisées à l'intérieur du cytoplasme suggérant que la perception du produit du gène d'avirulence intervient à l'intérieur de la cellule végétale. La comparaison in silico des protéines Avr d’oomycètes a montré que toutes ces séquences possédaient un motif consensus RxLR-dEER au sein des régions N- terminales en aval d'un peptide signal de sécrétion (Birch et al. 2006) (Figure 4). Ce motif

25 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Figure 4 : Mode d’action de deux types d’effecteurs (Tyler et al., 2008). A partir de l'haustorium de Phtophthora, structure cellulaire spécialisée qui s'invagine dans la cellule végétale, des effecteurs microbiens sont produits et transloqués à l'intérieur de la cellule infectée. Deux types d'effecteurs ont été identifiés : les effecteurs à domaines RxLR-DEER (R-D) et les Crinkle and Necrosis (CRNs) protéines. Un des rôle de ces effecteurs est de supprimer les réactions de défense de l'hôte, en particulier la mort cellulaire de type hypersensible (PCD). En réponse à la production des effecteurs, certaines plantes ont acquis la capacité de détecter ces protéines grâce à des récepteurs spécifiques (R) et d'induire une résistance.

26 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction - est similaire à celui détecté chez certaines protéines de parasite humains du genre

Plasmodium, agents du paludisme. Ces pathogènes intracellulaires sécrètent des protéines dans les érythrocytes humains pendant l’infection et le motif proche de RxLR (RxLxE) permettrait le transport des protéines du parasite au travers de la membrane des érythrocytes infectés (Bhattacharjee et al. 2006). Il est à noter que les organismes appartenant au phylum des Apicomplexes comme ceux du genre Plasmodium sont des Chromalvéolés au même titre que les oomycètes. Dans ce contexte l’hypothèse a été émise que le motif RxLR-dEER était un signal de translocation de l'effecteur depuis l’haustorium du parasite vers l'intérieur de la cellule végétale (Birch et al. 2008; Dou et al. 2008). Le rôle du motif RxLR-dEER dans la translocation des protéines effectrices a été évalué notamment par la construction de souches de P. sojae exprimant des versions mutées sur le motif RxLR de la séquence du gène d’avirulence Avr1b. L’infection de plants de soja exprimant le gène de résitance Rps1 correspondant, a révélé une augmentation de la virulence des souches exprimant une version mutée d’Avr1b. De plus, des expériences d’expression transitoire sur feuille de soja, ont révélé que le motif RxLR est fonctionnel indépendemment du parasite, et permettrait la translocation de molécules depuis le parasite vers le cytosol de l’hôte (Dou et al. 2008). Une recherche exhaustive de protéines RxLR a été entreprise chez les oomycètes dont le génome

était séquencé par des approches in silico . Plus de 370 candidats ont été identifiés chez

P. sojae et P. ramorum (Dou et al. 2008). Ces gènes semblent provenir d’un même ancêtre commun qui se serait dupliqué plusieurs fois dans le génome et aurait évolué. Par ailleurs, plus de la moitié des candidats identifiés possèdent trois motifs conservés appelés K, Y et W

(Dou et al. 2008).

Le rôle des protéines RxLR au cours de l’interaction a été recherché via différentes approches.

Ainsi, l'expression transitoire de la protéine Avr1b de P. sojae dans des tissus végétaux inhibe

27 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction - la mort cellulaire induite par la protéine de souris, pro apoptotique Bax1 (Dou et al. 2008). Ce résultat est également obtenu chez Saccharomyces cer evisae, suggérant que les cibles d’Avr1b, conduisant à la mort cellulaire, sont conservées chez ces deux eucaryotes. De façon similaire la translocation de la protéine d'avirulence ATR13 de H. parasitica via le système de sécrétion de type III de la bactérie P. syringae entraîne une inhibition du dépôt de callose induite par l'interaction (Sohn et al. 2007). Ces deux exemples suggèrent qu'une fonction importante des protéines RxLR est de bloquer les systèmes de défense de la plante comme la mort cellulaire programmée, permettant à l’agent pathogène de se développer (Tyler 2008).

2.2.2.3 Les protéines crinkling and necrosis (CRN)

Les protéines de la famille des CRN (CRinkling and Necrosis) constituent un autre type d’effecteurs cytoplasmiques qui ne possèdent pas de motif RxLR. Cette famille de protéine a

été initialement identifiée chez P. infestans et a été détecté chez tous les oomycètes pour lesquels des programmes de séquençage ont été engagés. Des expériences d’expression transitoire via le virus X de la pomme de terre (PVX), suggèrent une localisation cytosolique de ces effecteurs, capables d’induire une réponse hypersensible chez le tabac (Torto et al.

2003) (Figure 4). De façon surprenante cette famille de protéine, se caractérise par la présence d’un motif en aval du peptide signal du type LxLFLAK. Le rôle de ce motif ainsi que la fonction des protéines CRN au cours de l’interaction ne sont pas encore établis.

2.2.3 Effecteurs apoplastiques

2.2.3.1 Les protéines à domaines kazals

Parmi les effecteurs apoplasmiques d’oomycète, des protéines inhibitrices de protéases à sérines ont été identifiées chez P.infestans (Tian et al. 2004). Ces protéines possèdent un ou

28 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction - plusieurs domaines de type kazal responsables de l’activité inhibitrice de protéase. Le rôle de ces protéines serait d’inhiber des protéases de la plante hôte. C’est le cas d’EPI1 qui interagit avec la protéase P69 (de type subtilisine) de la tomate et dont l’expression est fortement induite au cours de l’interaction (Tian et al. 2004).

2.2.3.2 Les protéines CBEL et CBEL-like

La protéine CBEL de P. parasitica a été initialement caractérisée sur sa capacité d’induire une réponse hypersensible chez le tabac (Gaulin et al. 2006). Le rôle de CBEL pour le parasite a

été étudié par une approche de silencing transcriptionnel en construisant des souches modifiées pour l'expression du gène CBEL (Gaulin et al. 2002). Les mutants ainsi obtenus ne sont plus capables d'adhérer sur des substrats cellulosiques et de différencier des structures infectieuses. Une analyse par microscopique électronique des transformants, a révélé que

CBEL est impliquée dans l’organisation des parois des hyphes de P. parasitica . La capacité d’induction de réponse de défense chez le tabac ou A. thaliana par CBEL est liée à la présence dans la protéine de domaines de liaison à la cellulose (CBD ; Cellulose Binding

Domain) (Gaulin et al. 2002) (Gaulin et al. 2006). Ces motifs sont à eux seuls suffisants pour induire l’expression de gènes de défense. Les protéines CBEL-like sont rencontrées dans l’ensemble des oomycètes dont des données de séquences sont disponibles.

2.2.3.3 Les élicitines et les élicitines-like

Les élicitines sont des protéines produites par les oomycètes qui induisent des réactions de défense chez diverses espèces végétales. La famille des élicitines comporte 128 protéines différentes chez Phytophthora et Pythium (Ponchet et al. 1999). Les Phytophthora sont connus pour être incapables de synthétiser des stérols mais cependant ils les requièrent pour leur reproduction. L’hypothèse est admise que les Phytophthora utilisent les élicitines comme transporteurs de stérols (Blein et al. 2002; Mikes et al. 1998). Celles-ci leurs permettent de récupérer les stérols de la plante hôte afin de les utiliser pour réaliser leur cycle sexuel

29 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

(Hendrix 1964). La réponse nécrotique induite chez la plante par les élicitines est due à la reconnaissance d’un complexe élicitine-stérols et non l’élicitine seule (Ponchet et al. 1999).

30 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

3. Aphanomyces euteiches, un parasite des légumineuses

3.1 La pourriture racinaire précoce du pois

3.1.1 A. euteiches , Un membre du complexe parasitaire

Il existe différents microorganismes vivant dans le sol et capables de provoquer des maladies racinaires chez le pois. Ces maladies ont été étudiées et classées en quatre grandes catégories

(Hagedorn 1984; Wicker, Hulle, and Rouxel 2001). Ces catégories ont été crées en fonction du stade de développement du pois lors de l’infection par l’agent pathogène.

Chronologiquement, le pois est la cible de la fonte des semis causé par Pythium spp,

Rhizoctonia solani, Botrytis cinerea et Sclerotinia sclerotiorum. En second lieu, le pois est la cible de la pourriture racinaire précoce se déclarant généralement un mois après le semis dans des conditions pédoclimatiques favorables au développement d’A. euteiches. En troisième lieu, le pois est sujet à un flétrissement précoce dû à Fusarium oxysporum ainsi qu’à

Sclerotinia sclero tinium. En fin de cycle, le pois est aussi la cible de nécroses racinaires provoquées par des complexes parasitaires (Didelot, Maumene, and Carrouee 1994) composés essentiellement de Phoma medicaginis , Fusarium solani , Fusarium oxysporum et Chalara elegans.

La pourriture racinaire causée par Aphanomyces euteiches est la maladie d’origine microbienne qui cause le plus de dégâts dans la culture française de pois fourrager. A ce jour, il n’existe pas de traitement efficace, ni de variété de pois résistante à A. euteiches. Décrite pour la première fois par Jones et Drechsler en 1920 dans la région du Midwest aux Etats-

31 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Figure 5 : Carte de la répartition spatiale des zones contaminées par A. euteiches, élaboré en 2000 par l’UNIP et l’INRA de rennes (Muel 2007). Les zones quadrillées en vert correspondent aux zones où A. euteiches est très peu présent. En rouge figurent les départements qui sont régulièrement contaminés par A. eutei ches. Les départements colorés en noir représentent les zones très atteintes, le Bassin Parisien et la Bretagne.

Tableau 4 : Classification et efficacité des différentes méthodes de lutte contre A. euteiches. Les différentes méthodes de lutte contre A. euteiches sont décrites dans la première colonne. Les moyens utilisés par ces méthodes sont décrits dans la deuxième colonne. La troisième colonne présente une évaluation de cette méthode et la quatrième colonne les inconvénients liés à cette méthode.

Méthode de lutte Moyens utilisés Efficacité Inconvénient Références (Vandemark, Kraft et al. Prophylactique Mesure de l'Indice de Nécrose Racinaire Moyenne Ne décontamine pas la parcelle 2000; Vandemark, Barker et al. 2002) Test PCR et RT-PCR Bonne Ne décontamine pas la parcelle

Chimique Tachigaren Moyenne Couteuse (Grau and Reiling 1977; Jacobsen and Hopen 1981) Trifluraline et oryzaline Moyenne Couteuse

(Fritz, Allmaras et al. 1995; Williams- Woodward, Pfleger et al. 1997) (Papavizas and Itinéraire technique Ayers 1974; Smolinska, Crucifère ou avoine en précédent cutural Moyenne Knudsen et al. 1997) (Heungens and Parke 2000) (Rosendahl 1985; Biologique Burkholderia cepacia Moyenne Dandurand and Knudsen 1993)

Pseudomonas fluorescens Moyenne

Bacillus subtilis Moyenne

Glomus fasciculatum Moyenne

G. mossae Moyenne Trichoderma harzianum Moyenne (Pilet-Nayel, Muehlbauer Génétique Séléction assistée par marqueur en cours Résistance partielle et al. 2002)

32 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Unis, la pourriture racinaire du pois s’est ensuite étendue à toutes les régions américaines productrices de pois (Papavizas and Ayers 1974). Le micro-organisme affectant les zones de culture intensive du pois dans des régions humides et à climat doux, la maladie se rencontre dans d’autres pays producteurs de pois tel que la France (Labrousse 1933), l’Australie et le

Japon (Yokozawa, Kuninaga, and Teranaka 1974).

3.1.2 Symptômes de la pourriture racinaire

Les symptômes se manifestent généralement dès le stade 3-4 feuilles. Sur la partie racinaire, on peut observer les symptômes primaires de la maladie. Des lésions molles et translucides apparaissent une semaine après infection et sont suivis d’un brunissement des radicelles. Au début de la floraison, les micro-organismes du complexe parasitaires (majoritairement Phoma medicaginis et Fusarium solani) viennent assombrir les nécroses, il s’ensuit un dessèchement des racines. Les symptômes secondaires sont observables environ 15 jours après infection dès le stade 5-6 feuilles sur les parties aériennes de la plante. La maladie racinaire provoque des chloroses, le nanisme ainsi qu’un dessèchement de la plante. La plante ne produit alors que très peu de gousses qui ne contiennent parfois qu’une seule graine.

3.1.3 Répartition, impact et lutte contre la maladie en France

La zone majeure où se localise la maladie coïncide avec les zones de production intensive du pois, comme le Bassin Parisien et la partie Ouest de la Bretagne. Les zones mineures d’infection sont la région Rhône-Alpes, la Charente-Maritime, les Pyrénées Atlantiques

(Figure 5). En 2000, la surface totale de parcelles infectées était estimée à 4% des surfaces cultivées en pois selon les données Union Nationale de l’Interprofession des Protéagineux.

Les dégâts occasionnés par A. euteiches peuvent engendrer des pertes de rendement pouvant atteindre localement 100% de la récolte.

33 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Figure 6 : Arbre phylogénique des oomycètes constuit à partir de trois arbres phulogénique maximum de vraissemblance (ML), maximum de parsimonie (MP), et distance (NJ) de la protéines mitochondriales cox2. Les valeurs de bootstrapp supérieur à 50% sont figurés en dessus de chaque nœud dans l’ordre suivant ML (500), MP (1000), NJ (1000). L’arbre est enraciné sur l’espèce Hyphochytrium catenoides

34 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

L’ensemble des méthodes de lutte effectué jusqu’à présent contre A. euteiches sont rassemblées dans le tableau 4. Qu’elles soient chimiques, biologiques, prophylactiques ou culturales, aucune des méthodes élaborées n’est assez satisfaisante pour garantir des récoltes de pois à un coût de production raisonnable. La stratégie qui semble la plus prometteuse, concerne la création de lignées de pois tolérantes par sélection assistée par marqueur. Par ailleurs, la mise au point d’un agent chimique anti-Aphanomyces serait également une alternative envisageable.

3.2 Biologie d’A. euteiches

3.2.1 Classification d’A. euteiches

L’analyse phylogénique de la sous unité II de la cytochrome oxydase mitochondriale (cox2) a permis de construire une classification des oomycètes selon des critères moléculaires

(Figure 6). Le phylum des oomycètes contient deux sous-classes principales celle des

Peronosporomycetidae dont fait parti les Phytophthora, et celle des Saprolegniomycetidae auquel le genre Aphanomyces appartient. Aphanomyces est subdivisé en trois sous-genres construit à partir de caractéristiques morphologiques déterminées à partir de l’ornementation des parois de l’oogone (Scott 1961). Cette méthode permet de distinguer les sous-genres

Axyromyces et Aspiromyces qui comprennent la plupart des organismes aquatiques, et le sous- genre Aphanomyces qui comprend 10 espèces (Tableau 5) phytopathogènes sur 32 espèces

(Gaulin et al. 2007).

3.2.2 Cycle de vie d’A. euteiches.

Le mycélium d’A. euteiches est siphonné. Les hyphes ont un diamètre allant de 4 μm à 10 μm, hyalines et faiblement ramifiés avec des ramifications à angle droit (Figure 7.A). Les jeunes hyphes qui deviennent des zoosporanges contiennent des vacuoles irrégulièrement réparties

35 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Tableau 5 : Liste des espèces d’Aphanomyces phytopathogènes (Gaulin, et al. 2007). La première colonne correspond aux espèces et la deuxième au nom latin de la plante hôte. La dernière colonne correspond aux références bibliographiques

Espèces Plantes hôtes Publications Aphanomyces brassicae Brassica oleracae B. rapa Singh and Pavgi (1977) Aphanomyces camptostylus Avena sativa Drechsler (1929) Aphanomyces cladogamus Lycopersicum esculentum Drechsler (1929) Aphanomyces cocchlioides Beta vulgari, Spinacia oleacea Drechsler (1929) Aphanomyces euteiches Pisum sativum, Phaseolus vulgaris, Jones and Drechsler (1925)

Trifolium sp., Medicago sp. Pfender and Hageedorn (1982) Aphanomyces iridis Iris hollandica Ichitani et al. (1986) Aphanomyces norvegicus Spirogyra, Zygnema, Mougeotia Wille (1899) Aphanomyces phycophilus Spirogyra, Zygnema, Mougeotia de Barry (1860) Aphanomyces raphani Raphanus sativus Kendr (1927) Aphanomyces sparrowii Nitella sp. Cutter (1941)

A B

Figure 7 : Observations microscopiques d’A. euteiches. A. Mycélium d’Aphanomyces euteiches coloré à la WGA FITC observé au microscope inversé par épifluorescence (Badreddine et al 2008) B. Coupe de racine de M. t runcatula infectée par A. e uteiches, permettant de visualiser une oospore du parasite .

36 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction - dans le mycélium et possèdent un cytoplasme granuleux. Les zoosporanges sont de types filamenteux et sont longs de 1 ou 2 mm. A l’intérieur se différencient les spores asexuées aussi appelées zoospores. En 1961, Scott décrit la présence de deux types de zoospores, à ce titre A. euteiches est appelé dimorphique ou diplanétique. Les zoospores primaires migrent et s’accumulent à l’extrémité du zoosporange où elles s’enkystent. A partir des zoospores primaires enkystées se forment les zoospores secondaires biflagellées à l’aspect réniforme (7

à 8 μm de diamètre et 13 μm de long).

Les organes de reproduction sexués sont l’oogone (organe femelle) et l’anthéridie (organe mâle). Les organes sexuels se développent à partir du mycélium avec un rapport de 5 anthéridies pour 1 oogone. Les anthéridies ont un diamètre compris entre 5 et 10 μm, une longueur de 10 à 15 μm et possèdent des tubes de fertilisation visibles. L’oogone se forme à partir d’une courte ramification d’un hyphe, elles ont une forme sphérique et une taille comprise entre 20 et 35 μm. A maturité, la paroi de l’oogone s’épaissie pour atteindre 1,5 μm.

L’oosphère est contenu dans l’oogone et contient en son centre un globule huileux, elle donne l’oospore (Figure 7.B) après fertilisation.

Les cellules d'A. euteiches sont diploïdes, exceptées dans la phase de reproduction sexuée. La phase haploïde est réduite aux gamètes (anthéridies et oospores). D’autre part, A. euteiches est homothallique. Cependant des croisements ont été observés entre une souche d’A. euteiches isolée à partir du pois et une souche isolée à partir du haricot (Shang, Grau, and Peters 2000) ce qui semble rendre un hétérothallisme possible, tout au moins en conditions artificielles.

Une représentation du cycle de vie d’A. euteiches est représenté sur la figure 8.

Les hyphes sont naturellement lysés et détruits dans le sol (Lockwood 1960; Papavizas and

Ayers 1974), pour cette raison, le mycélium joue un rôle peu important dans la constitution de l’inoculum primaire. La viabilité des zoospores est estimée de l’ordre de 5 à 6 jours en conditions naturelles (Papavizas and Ayers 1974). L’inoculum primaire d’A. euteiches serait

37 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Figure 8 : Schéma de la reproduction sexuée et asexuée d’A. euteiches (Gaulin et al. 2007). L’hyphe peut soit former des sporanges qui vont libérer les zoospores qui s’enkystent et germent pour reformer un hyphe soit former des oogonies et des anthéridies qui fusionnent pour générer une oospore

38 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction - essentiellement composé d’oospores présent dans les racines infectées ou bien à l’état libre dans le sol. Les oospores ont la particularité de rester dans le sol pendant une période allant de

10 à 20 ans (Maufras 1997) et peuvent résister à des températures de -20°C. Ces infections secondaires permettraient aussi la constitution d’un inoculum primaire en persistant dans le sol pendant la période d’interculture et qui viendrait s’ajouter à l’inoculum constitué par les oospores.

En fonction des conditions du milieu, l’oospore germe pour générer soit un hyphe mycélien soit un sporange filamenteux. La composition des exsudats racinaires va conditionner le type de développement de l’oospore (Shang, Grau, and Peters 2000). D’autre part, les isolats de haricots produisent des oospores qui germent préférentiellement sur le haricot alors que les isolats de pois germent aussi bien sur pois que sur haricot. Le sporange différencié libère entre

300 et 400 zoospores biflagellées capables de nager dans un milieu aqueux. C’est la zoospore qui représente l’agent infectieux de la pourriture racinaire (Malvick and Percich 1998). Cette

étape de l’infection est très hautement tributaire de l’hygrométrie et ne peut avoir lieu que dans un sol saturé en eau, même ponctuellement. A ce titre l’infection des racines a lieu généralement après des précipitations abondantes.

La zoospore peut s’enkyster lorsqu’elle ne trouve pas de site d’infection ou lorsqu’elle subit un choc mécanique. Mais elle peut, une fois enkystée, régénérer une nouvelle spore nageuse.

Ce phénomène peut ainsi se répéter à 3 reprises jusqu’à l’établissement de l’infection

(Cerenius and Soderhall 1985; Deacon 1996).

Le déplacement de la spore vers la racine se fait par chimiotactisme des composés végétaux racinaires. La spore, attirée par la racine, s’enkyste à son contact, perd alors ses flagelles et forme très rapidement une paroi. Il semble que la spore s’enkyste préférentiellement sur la zone située juste au dessus de la coiffe racinaire, au niveau de la zone d’élongation de la racine (Deacon and Saxena 1998). Une demi-heure à 40 minutes après l’enkystement, la spore

39 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

40 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction - forme un hyphe mycélien qui pénètre dans la racine de manière intercellulaire en assimilant les nutriments. Après plusieurs heures, la croissance du mycélium devient inter et intracellulaire. Les hyphes progressent alors rapidement dans la racine et environ 60 heures après inoculation, l’ensemble du cortex racinaire est infecté. Les observations macroscopiques de la racine de pois infectée montrent des macérations des tissus de la plante. Cela suggère qu’A. euteiches induit une lyse des tissus de la plante hôte. Les travaux menés par Ayers en

1969 (Ayers, Papavizas, and Lumsden 1969) montre l’activité in vitro et in planta d’enzymes polygalacturonase et cellulase. Ces activités enzymatiques mettent en évidence la dégradation de la paroi végétale lors de l’infection du cortex.

Des études ont montré que la durée de vie du mycélium à l’intérieur de la racine est inversement corrélée à la quantité d’inoculum primaire. Cette courte durée de vie du mycélium peut aussi être la cause de l’inefficacité des traitements classiques, tels que les antifongiques et des antagonistes microbiens (Kjøller and Rosendahl 1998). Ainsi, cela suppose que la lutte chimique contre A. euteiches serait efficace à des stades plus précoces de la maladie, lors de la germination des zoospores ou des oospores par exemple.

Bien que la dissémination par contact de racine à racine soit la plus commune, une dissémination par sporulation secondaire sur des tissus fraîchement atteints peut être observée. Dans le cas d’une telle dissémination, la distance parcourue par la zoospore n’excède pas 15 cm (Pfender and Hagedorn 1983).

3.3 Variabilité du pouvoir pathogène

La spécificité d’hôte d’A. euteiches est difficile à déterminer dans la mesure où il a été montré qu’A. euteiches est capable d’infecter en conditions artificielles 19 familles botaniques différentes comprenant les légumineuses, les graminées, les crucifères et les solanacées

(Papavizas and Ayers 1974). Pour les légumineuses, A. euteiches a été isolé à partir de culture

41 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Figure 9 : Pathogénicité des souches d’A. euteiches sur différentes légumineuses en fonction de leur pathotype (Wicker, et al. 2001). L’indice de pathogénicité de la souche est indexé de 0 à 5. Les isolats sont classés par pathotype i.e par spécificité d’hôte. Les 4 pathotypes d’A. euteiches identifiés sont représentés.

42 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction - de pois, de haricot (Pfender and Hagedorn 1983), de luzerne (Delwiche et al. 1987), de trèfle rouge (Tofte, Smith, and Grau 1992), de trèfles souterrains en Australie (Greenhalgh,

Merriman, and Keane 1985) et de féverole au Canada.

Les études menées par Malvick en 1998 ont permis de caractériser les différents pathotypes américains au niveau phénotypique et moléculaire. Il ressort de ces études que le pathotype

"haricot" est éloigné des pathotypes luzerne et pois qui sont confondus. Une étude plus importante menée par Wicker (Wicker, Hulle, and Rouxel 2001) a porté sur l’analyse de 91 isolats de pois provenant de différentes régions françaises contaminées. Ces isolats ont été comparés à 18 isolats provenant de pays et d’hôtes variés. Les isolats français ont pu être classés en 4 pathotypes (Figure 9). Le premier pathotype correspond aux isolats infectants une large gamme d’hôtes, le deuxième pathotype infecte plus particulièrement le pois et la luzerne mais aussi le haricot, le troisième pathotype infecte uniquement le pois et la vesce, le quatrième pathotype n’infecte que le pois, la vesse et la luzerne.

4 Objectifs de la thèse

Il ressort de cette analyse bibliographique que l’étude d’A. euteiches a été réalisée essentiellement par des approches agronomiques. De plus sa position phylogénétique distincte par rapport aux Phytophthora dans les oomycètes suggère la possibilité de mécanismes propres aux Saprolégniales en termes d’infection et de métabolisme. En vue d’enrichir les connaissances sur cet oomycète, il semblait donc important de développer une ressource génomique dédiée à ce parasite. L’identification des gènes, des transcrits et des voies métaboliques spécifiques de ce micro-organisme est une première étape de recherche qui permet d’apporter de nouvelles connaissances sur la biologie d’A. euteiches, sa pathogénicité et les mécanismes moléculaires nécessaires à l’infection de la plante.

Mon travail de thèse se découpe en trois parties. La première partie présente les outils

43 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction - d’analyse bioinformatique élaborés pour traiter 18 684 ESTs issue du séquençage de 20 000

ADNc d’A. euteiches. Dans cette partie, la construction d’une base de données en libre accès,

AphanoDB, est présentée en détails. Ces travaux sont présentés sous la forme d’un article publié en 2007 dans BMC Genomics (Madoui et al. 2007).

La deuxième partie de mon travail de thèse a consisté à analyser les données déposées dans

AphanoDB afin d’identifier d’une part les effecteurs putatifs du pouvoir pathogène d’A. euteiches et d’autre part des gènes originaux (i.e absents chez les autres oomycètes

étudiés). Cette étude a permis la mise en évidence d’effecteurs du pouvoir pathogène ainsi que la présence de gènes codant les enzymes intervenant dans des voies de synthèse absentes chez les Phytophthora. Ces travaux sont présentés sous la forme d’un article qui a été publié en

2008 dans PlosOne (Gaulin et al. 2008).

La troisième partie de la thèse s’est focalisée sur le métabolisme des stérols propres à

A. euteiches identifié par les analyses in silico au cours de la deuxième partie de mon travail thèse. Une caractérisation biochimique et moléculaire de la voie de synthèse des stérols chez

A. euteiches a été réalisée. Une analyse des gènes intervenant dans la synthèse de ces stérols chez les oomycètes est effectuée. Cette dernière partie montre que la biosynthèse des stérols par A. euteiches peut être la cible de fongicides efficaces dans la lutte phytosanitaire. Ces travaux sont présentés sous forme d’un article publié en 2009 dans New Phytologist (Madoui et al. 2009).

44 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

45 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

46 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Chapitre 2 : AphanoDB: une ressource génomique pour Aphanomyces

47 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

48 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Introduction

Afin d’identifier les facteurs moléculaires qui interviennent dans l’infection racinaire des légumineuses par A. euteiches, il était nécessaire de disposer de ressources génomiques de l’organisme pathogène. Dans ce contexte, en collaboration avec le Génoscope d’Evry, deux banques de 10 000 ADNc d’A. euteiches ont été générés en juin 2006. Une première banque issue d’un mycélium en condition saprophytique sur milieu solide riche (extrait de levure et glucose) a été construite et une deuxième banque issue d’un mycélium au contact direct de racine de M. truncatula pendant 24 et 48 heures. La première partie de mon travail de thèse a consisté à à traiter les données nucléiques brutes obtenues après séquençage afin de développer la première ressource génomique dédiée à un oomycète distinct de Phytophthora, et de faciliter la recherche de gènes d’intérêt. En se basant sur des méthodes et des programmes de traitements déjà validés, un pipeline d’annotation a été alors développé et une base de données (AphanoDB) contenant toutes les données générées a été construite. Ce chapitre présente sous la forme d’un article la méthode utilisée pour le développement du pipeline d’annotation ainsi que les détails concernant les fonctionalités et l’utilisation d’AphanoDB.

49 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

50 BMC Genomics BioMed Central

Database Open Access AphanoDB: a genomic resource for Aphanomyces pathogens Mohammed-Amine Madoui1, Elodie Gaulin1, Catherine Mathé1, Hélène San Clemente1, Arnaud Couloux2, Patrick Wincker2 and Bernard Dumas*1

Address: 1UMR 5546 CNRS Université Paul Sabatier Toulouse III Pôle de Biotechnologie Végétale 24, Chemin de Borde-Rouge BP 42617, Auzeville 31326 Castanet-Tolosan, France and 2UMR 8030 Génoscope – CNRS, 2 rue Gaston Crémieux, 91000 Evry, France Email: Mohammed-Amine Madoui - [email protected]; Elodie Gaulin - [email protected]; Catherine Mathé - [email protected] tlse.fr; Hélène San Clemente - [email protected]; Arnaud Couloux - [email protected]; Patrick Wincker - [email protected]; Bernard Dumas* - [email protected] * Corresponding author

Published: 20 December 2007 Received: 4 September 2007 Accepted: 20 December 2007 BMC Genomics 2007, 8:471 doi:10.1186/1471-2164-8-471 This article is available from: http://www.biomedcentral.com/1471-2164/8/471 © 2007 Madoui et al; licensee BioMed Central Ltd. This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.

Abstract Background: The Oomycete genus Aphanomyces comprises devastating plant and animal pathogens. However, little is known about the molecular mechanisms underlying pathogenicity of Aphanomyces species. In this study, we report on the development of a public database called AphanoDB which is dedicated to Aphanomyces genomic data. As a first step, a large collection of Expressed Sequence Tags was obtained from the legume pathogen A. euteiches, which was then processed and collected into AphanoDB. Description: Two cDNA libraries of A. euteiches were created: one from mycelium growing on synthetic medium and one from mycelium grown in contact to root tissues of the model legume Medicago truncatula. From these libraries, 18,684 expressed sequence tags were obtained and assembled into 7,977 unigenes which were compared to public databases for annotation. Queries on AphanoDB allow the users to retrieve information for each unigene including similarity to known protein sequences, protein domains and Gene Ontology classification. Statistical analysis of EST frequency from the two different growth conditions was also added to the database. Conclusion: AphanoDB is a public database with a user-friendly web interface. The sequence report pages are the main web interface which provides all annotation details for each unigene. These interactive sequence report pages are easily available through text, BLAST, Gene Ontology and expression profile search utilities. AphanoDB is available from URL: http:// www.polebio.scsv.ups-tlse.fr/aphano/.

Background From recent studies on the phylogenic relationships Oomycetes form a phylogenetically distinct group of within oomycetes, it has been suggested that the ability to eukaryotic microorganisms which includes plant and ani- infect plants appeared at least twice in the oomycete line- mal pathogens, that cause widespread damages of high age, first in an ancient lineage which evolved into the economical [1-3] and ecological impacts [4]. Pathogenic Pythiales (including Phytophthora and Pythium) and Per- oomycete species are found mainly in three orders, the onosporales, and secondly in the Saprolegniales lineage Pythiales, the Peronosporales and the Saprolegniales [5]. [6], which includes destructive animal pathogens such as

Page 1 of 7 (page number not for citation purposes) BMC Genomics 2007, 8:471 http://www.biomedcentral.com/1471-2164/8/471

the fish pathogens Saprolegnia parasitica and Aphanomyces laid onto a 2 day-old mycelium, and culture continued for piscida, and plant pathogens such as A. euteiches and A. 1 and 2 days. Before the mycelium harvesting, plants were cochlioides. Among members of Oomycetes, Phytophthora gently removed from the Petri dish to avoid any contami- is the best studied genus and genomic resources are avail- nation of A. euteiches RNA with plant RNA.A. euteiches able for several species (cDNA libraries and/or complete mRNA extracts were pooled and cDNA generated as genome sequence) [7-11]. In contrast, few nucleic acid described for the MYC library. A library of approximately sequences are available from species classified in the Sap- 5 × 105 colony forming units was obtained. About 10,000 rolegniales, the main data consisting in a 1510 ESTs col- clones from each library were 5' end sequenced using T7 lection obtained from the fish pathogen S. parasitica [12]. primer on ABI3730xl DNA Sequencers.

Recently, we have developed a pathosystem which con- EST quality and assembling sists of the model legume Medicago truncatula and the leg- The two libraries were processed together. All reads were ume pathogen A. euteiches [13]. Up to now, no chemical obtained using the Phred program [16]. Only reads with a compound is able to protect efficiently against A. euteiches Phred value over 20 on 80% of the sequences and with a and infested fields cannot be used any longer for legume length of over 100 bp were selected. MultiFASTA sequence production during many years [14]. In order to get a better and quality files were generated and cleaned by vector and knowledge of the A. euteiches-legume interaction and to adaptor trimming using crossmatch (Figure 1). After these identify molecular targets for drug design, a genomic steps 18,684 high-quality sequences were obtained corre- approache was used. Two unidirectional cDNA libraries sponding to 93% of the initial sequence set. These from a A. euteiches strain ATCC201684 [15] were pre- sequences were assembled using the CAP3 program [17]. pared: one from mycelium growing in a liquid medium Minimum overlap length was set to 100 bp, minimum containing yeast extract and glucose (MYC library), and identity percent to 97% and maximum gap length to 30 one from mycelium in contact to M. truncatula root tissues bp (-o 100 -p 97 -f 30). ESTs from the two libraries were (INT library). The latter situation is a simplified model for assembled to obtain 7,977 unigenes composed of 2,843 growth during pathogenesis. A total of 18,684 expressed contigs and 5,134 singletons (Table 1). Consensus sequence tags (9,224 from MYC library and 9,460 from sequences were renamed with a unique identifier with the INT library) were submitted to the EBI databank for acces- prefix 'Ae' for the species, 3 digits for the number of ESTs sion number assignation and were assembled into 7,977 included in the contig, the 2 letters 'AL' for the strain and unigenes. Here we present a database named AphanoDB 5 digits as individual number. in which all the data were structured. Users can retrieve information using text searches or BLAST analyses. Aph- EST analysis and functional annotation anoDB is currently the most extensive resource of Aphano- Assignment of putative functions was performed by run- myces sequences and related annotations. ning the BLASTX algorithm (release 2.2.14) [18], against a local NCBI non-redundant (nr) protein database (5-17- Construction and content 2007 Version). 61% of the sequences showed similarity to Preparation of cDNA libraries and sequencing a protein sequence with an E-value ≤ 1e-10. To estimate The MYC library (saprophytic library) was made with the level of contamination of A. euteiches ESTs with M. total RNA isolated from mycelium after 5, 7 and 9 days of truncatula cDNA sequences which might occur in the INT growth in liquid YG medium (2.5% Yeast extract, 5% Glu- library, the unigene sequences were compared to 270,000 cose, w/v) at 23°C in the dark. Mycelia were frozen in liq- M. truncatula ESTs deposited in the GenBank database uid nitrogen and total RNA was extracted. RNAs of each using the BLASTN algorithm. Only 11 unigenes showed a sample were mixed in equal amounts. mRNAs were puri- high similarity (E value < 1e-100) to M. truncatula ESTs fied using an Oligotex mRNA purification kit (Qiagen, and only two unigenes were composed of ESTs from the Valencia, CA, USA) according to the manufacturer's INT library. However, these two sequences displayed a instructions. A unidirectionnal library was constructed in higher similarity to Phytophthora sequences than to M. pSport1 plasmid using the Superscript Plasmid System for truncatula sequences. From this analysis, it can be con- cDNA Synthesis and Cloning (Invitrogen, USA). Plasmid cluded that contamination of the INT library with M. trun- ligations were transferred by electroporation into E. coli catula cDNAs is very low if any. Sequences were compared DH5α cells following the manufacturer's protocol (Invit- to proteome data from seven different fully sequenced rogen Life Technologies, CA, USA). A library of approxi- organisms using BLASTX algorithm, since parts of the pro- mately 5 × 105 colony forming units was obtained. teome of these organisms are not present in the nr database. To facilitate comparative analyses between The INT library (interaction library) was made with total oomycete species, A. euteiches sequences were compared mRNAs purified from mycelium grown for 1 or 2 days on to the P. sojae and P. ramorum proteomes [8]. Since it has M. truncatula roots. Roots of two week-old plants were been shown that oomycetes are phylogenetically related

Page 2 of 7 (page number not for citation purposes) BMC Genomics 2007, 8:471 http://www.biomedcentral.com/1471-2164/8/471

Base calling Electrophoregrams Phred

Sequences and quality files

Poor quality trimming Vector trimming & adaptor trimming Crossmatch

Clean sequences and quality files

Contig assembling CAP3

Susko’s test Expression profile Assembled sequences statistical analysis

BLASTx on local HMM searches on BLASTx on 7 Repeat Masker NCBI non redondant local InterPro predicted proteomes protein database integrated PFAM database

GO AphanoDB

AphanoDBFigure 1 pipeline flow chart AphanoDB pipeline flow chart. to diatoms, A. euteiches sequences were compared to the selected since it has been suggested recently that apicom- Thalassiosira pseudonana proteome [19]. In order to find plexan parasites and oomycetes share common infection genes putatively involved in plant pathogenesis, A. strategies [22]. Finally, the proteome of Arabidopsis thal- euteiches sequences were compared to the proteome of the iana was also added to analysis. fungal pathogen Nectria haemetococca.Toxoplasma gondi [20] and Plasmodium falciparum [21] proteomes were Domain searches using InterProscan program (release 4.2) [23] were performed locally with HMM searches Table 1: Statistics on AphanoDB ESTs status. against Pfam protein database (16.0) [24]. 45% of sequences showed a known Pfam domain with an E-value Total number of quality ESTs ≤ 1e-5 (Table 1).

Library MYC 9,224 To classify the sequences according to the Gene Ontology Library INT 9,460 classification scheme [25], Pfam domains with InterPro Total number of unigenes accession number were linked to GO molecular function, biological process and cellular component terms using Contigs 2,843 the interpro2go file [26]. Finally, 42% of the sequences Singletons 5,134 were assigned to a GO molecular function term, 43% to a Mean number of ESTs per contig 4.73 biological process and 24% to a cellular component (Table 2). Unigenes annotation (%) Gene Ontology SQL database format was downloaded NCBI nr (E value ≤ 1e-10) 61.5 from the GO web site [27] and added to AphanoDB. Links PFAM (E value ≤ 1e-5) 45 between GO terms and the Enzyme Nomenclature terms GO db (E value ≤ 1e-5) 41.5 [28] were established using ec2go mapping [29], and

Page 3 of 7 (page number not for citation purposes) BMC Genomics 2007, 8:471 http://www.biomedcentral.com/1471-2164/8/471

Table 2: Classification of unigenes based on gene ontology (GO) and consensus sequences. The dynamic structure enables mappings. Mappings of the InterPro domains to terms in the GO addition of new sequences of different oomycete species hierarchy were used to assign GO terms to the unigenes. Sequences for which a protein domain was predicted with an E and associated features. The database is available through value < 1e-5 were selected for this analysis. an Apache Web server running on Fedora core 6 Linux. The web interface is based on the PHP, JavaScript and GO term % HTML languages; it enables dynamic MySQL queries with a user-friendly graphical interface. Biological process 43.07 metabolic process 19.12 cellular process 14.97 Utility and discussion establishment of localization 3.6 User interface localization 3.6 AphanoDB provides a complete summary sheet contain- biological regulation 0.95 ing all annotation results for each predicted unigene (Fig- response to stimulus 0.49 ure 2). The BLASTX results against the nr database, HMM developmental process 0.29 search results against Pfam database and the Gene Ontol- biological adhesion 0.04 ogy assignments are displayed on this summary sheet. immune system process 0.01 multicellular organismal process 0.01 BLASTX alignment details are also provided and will be Molecular function 41.53 updated yearly. The summary sheet also contains the catalytic activity 20.71 sequence of the unigene, the link to the ESTs alignment, binding 16.71 to the Ace file and another link to a multiFASTA file of the transporter activity 2.34 contig components. structural molecule activity 0.56 motor activity 0.36 Users can query the database for a given sequence by pro- transcription regulator activity 0.18 enzyme regulator activity 0.15 viding its accession number, EST name or gene ID. antioxidant activity 0.14 Searches on the Gene Ontology annotation are possible molecular transducer activity1 0.01 with graphical bars representing GO subfamilies (Figure Cellular component (%) 23.79 2A). For the GO catalytic activity subfamilies, EC links cell 8.66 and KEGG metabolic pathway map links are provided. cell part 8.66 Function searches are allowed by queries by InterPro or organelle 2.78 macromolecular complex 2.22 Pfam domain names or accession numbers. BLASTX organelle part 1.02 results stored in the database can be queried using organ- extracellular region 0.34 ism name or putative function (Figure 2B–C). Queries on envelope 0.06 repeat sequence types and sizes are also available as well membrane-enclosed lumen 0.04 as on expression profile in a specific growth condition. For expression profiles, the output shows only significant results with a P-value lower than the Benjamini and Hoch- KEGG metabolic pathway map links [30] were also added berg cut-off [33]. Users can submit their own sequences to the database. for BLAST searches against the A. euteiches sequences using BLASTN, TBLASTN and TBLASTX. The BLAST output page Repeat sequences were detected using RepeatMasker [31] displays one summary sheet for each hit on the A. with default parameters in order to identify microsatellite euteiches sequences. markers and result outputs were added to the database. Utilities and extensions To estimate differences in gene expression levels between AphanoDB provides molecular data about A. euteiches the saprophytic and the pathogenic growth conditions, a transcripts. The database contains 18,684 high quality statistical analysis was performed based on EST frequency sequences and allows direct applications for functional in each library. We used the test described by Susko et al. and comparative genomic approaches. AphanoDB is con- [32] to calculate the p-value and false discovery rate constructed in such a way that it can absorb a large number of trol (FDR) for multiple test correction [33] (false positive additional sequences from other oomycete species, such rate is controlled at less than α = 0.05). as S. parasitica, for which large scale cDNA sequencing projects are under way. Database implementation AphanoDB is a MySQL database containing features, Conclusion cleaned ESTs and deduced contigs. At the end of each step AphanoDB represents a major contribution to assist of the AphanoDB pipeline, information was stored in the genomic studies on Oomycetes and other related organ- related table and linked to the core tables containing EST isms such as diatoms and brown algae. Addition of new

Page 4 of 7 (page number not for citation purposes) BMC Genomics 2007, 8:471 http://www.biomedcentral.com/1471-2164/8/471

WebFigure interface 2 Web interface. A. Hierarchical browsing of Ontologies including distribution of the genes in the subcategories. B. Domain description query output with e value cut-off. First output clusters the genes by InterPro domain prediction. C. Part of gene report sheet.

Page 5 of 7 (page number not for citation purposes) BMC Genomics 2007, 8:471 http://www.biomedcentral.com/1471-2164/8/471

sequences from other Aphanomyces species and other Sap- 2. Fry W, Smart C: The return of Phytophthora infestans, a potato pathogen that just won't quit. Potato Res 1999, 42:279-282. rolegniales is planned in the near future. AphanoDB will 3. van West P: Saprolegnia parasitica, an oomycete pathogen facilitate gene prediction and annotation for the future with a fishy appetite: new challenges for an old problem. whole genome sequencing of Saprolegniales species. Aph- Mycologist 2006, 20:99-104. 4. Jönsson-Belyazio U, Rosengren U: Can Phytophthora quercina anoDB contains cleaned, assembled and annotated ESTs have a negative impact on mature pedunculate oaks under which will serve the oomycete research community. The field conditions? Ann For Sci 2006, 63:661-672. database provides comprehensive tools for comparative 5. Dick M: In Straminipilous Fungi. KA; 2001. 6. Kamoun S: Nonhost resistance to Phytophthora: novel pros- approaches that might lead for example to leading to the pects for a classical problem. Curr Opin Plant Biol 2001, 4:295-300. identification of pathogenicity factors. 7. Tyler BM, Tripathy S, Zhang X, Dehal P, Jiang RH, Aerts A, Arre- dondo FD, Baxter L, Bensasson D, Beynon JL, Chapman J, Damasceno CM, Dorrance AE, Dou D, Dickerman AW, Dubchak IL, Garbelotto Availability and requirements M, Gijzen M, Gordon SG, Govers F, Grunwald NJ, Huang W, Ivors AphanoDB is freely available to academic and non aca- KL, Jones RW, Kamoun S, Krampis K, Lamour KH, Lee MK, McDon- ald WH, Medina M, Meijer HJ, Nordberg EK, Maclean DJ, Ospina- demic users at http://www.polebio.scsv.ups-tlse.fr/aph Giraldo MD, Morris PF, Phuntumart V, Putnam NH, Rash S, Rose JK, ano/. A browser supporting frames must be used (Firefox, Sakihama Y, Salamov AA, Savidor A, Scheuring CF, Smith BM, Sobral BW, Terry A, Torto-Alalibo TA, Win J, Xu Z, Zhang H, Grigoriev IV, Netscape 2.0, Internet Explorer 3.0 or higher). cDNA Rokhsar DS, Boore JL: Phytophthora genome sequences clones can be obtained upon request at http://cnrgv.tou uncover evolutionary origins and mechanisms of pathogene- louse.inra.fr/ENG/. All ESTs can be downloaded from sis. Science 2006, 313:1261-1266. 8. Govers F, Gijzen M: Phytophthora genomics: the plant destroy- AphanoDB. They have been also deposited in dbEST ers' genome decoded. Mol Plant Microbe Interact 2006, (accession numbers CU357053 to CU361296). 19:1295-1301. 9. Gajendran K, Gonzales MD, Farmer A, Archuleta E, Win J, Waugh ME, Kamoun S: Phytophthora functional genomics database List of abbreviations (PFGD): functional genomics of Phytophthora-plant interac- EST: expressed sequence tag tions. Nucleic Acids Res 2006, 34:D465-70. 10. Torto-Alalibo TA, Tripathy S, Smith BM, Arredondo FD, Zhou L, Li H, Chibucos MC, Qutob D, Gijzen M, Mao C, Sobral BW, Waugh ME, GO: Gene Ontology Mitchell TK, Dean RA, Tyler BM: Expressed sequence tags from Phytophthora sojae reveal genes specific to development and infection. Mol Plant Microbe Interact 2007, 20:781-793. cDNA: complementary DNA 11. Randall TA, Dwyer RA, Huitema E, Beyer K, Cvitanich C, Kelkar H, Fong AM, Gates K, Roberts S, Yatzkan E, Gaffney T, Law M, Testa A, nr: non redondant Torto-Alalibo T, Zhang M, Zheng L, Mueller E, Windass J, Binder A, Birch PR, Gisi U, Govers F, Gow NA, Mauch F, van West P, Waugh ME, Yu J, Boller T, Kamoun S, Lam ST, Judelson HS: Large-scale KEGG: Kyoto Encyclopedia of Genes and Genomes gene discovery in the oomycete Phytophthora infestans reveals likely components of phytopathogenicity shared with true fungi. Mol Plant Microbe Interact 2005, 18:229-243. HMM: Hidden Markov Model 12. Torto-Alalibo T, Tian M, Gajendran K, Waugh ME, van West P, Kamoun S: Expressed sequence tags from the oomycete fish pathogen Saprolegnia parasitica reveal putative virulence fac- Authors' contributions tors. BMC Microbiol 2005, 5:46-58. MAM designed the database and the web interface and 13. Gaulin E, Jacquet C, Bottin A, Dumas B: Root rot disease of legumes caused by Aphanomyces euteiches. Molecular Plant Pathol wrote the pipeline programs. EG constructed the Aphano- 2007, 8:539-548. myces euteiches cDNA libraries and coordinated the 14. Malvick D, Grau C: Characteristics and frequency of Aphano- sequencing project. CM and HSC cooperated in structur- myces euteiches races 1 and 2 associated with alfalfa in the Midwestern United States. Plant dis 2001, 85:740-744. ing database and designed the pipeline draft. AC and PW 15. Petersen A: Use of polyclonal antibodies to detect oospores of managed the sequencing of the cDNA clones. BD led the Aphanomyces. Mycol Res 1996, 100:495-499. AphanoDB project, helped to draft the manuscript and 16. Ewing B, Green P: Base-calling of automated sequencer traces using Phred. II. Error probabilities. Genome Res 1998, participated to the design of the database. All authors 8:186-194. tested the database and revised the manuscript. 17. Huang X, Madan A: CAP3: a DNA sequence assembly program. Genome Res 1999, 9:868-877. 18. Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, Miller W, Lip- Acknowledgements man DJ: Gapped BLAST and PSI-BLAST: a new generation of We thank Arnaud Bottin and Martina Rickauer (SP2 INP-ENSAT, Tou- protein database search programs. Nucleic Acids Res 1997, louse) for helpful discussions and critically reading the manuscript. We also 25:3389-3402. 19. Armbrust EV, Berges JA, Bowler C, Green BR, Martinez D, Putnam thank Didier Laborie, David Allouche, Jean-Marc Larre and all members the NH, Zhou S, Allen AE, Apt KE, Bechner M, Brzezinski MA, Chaal BK, Bioionformatic Platform of the Genopole (Toulouse, France) for the com- Chiovitti A, Davis AK, Demarest MS, Detter JC, Glavina T, Goodstein puting technical support. Part of this work was supported by the FP6 Grain D, Hadi MZ, Hellsten U, Hildebrand M, Jenkins BD, Jurka J, Kapitonov Legume Integrated Project. MAM received a pre-doctoral scholarship from VV, Kroger N, Lau WW, Lane TW, Larimer FW, Lippmeier JC, Lucas S, Medina M, Montsant A, Obornik M, Parker MS, Palenik B, Pazour the CNRS. Sequencing was supported by CNRG. GJ, Richardson PM, Rynearson TA, Saito MA, Schwartz DC, Thamat- rakoln K, Valentin K, Vardi A, Wilkerson FP, Rokhsar DS: The References genome of the diatom Thalassiosira pseudonana: ecology, 1. Fry W, Goodwin S: Re-emergence of potato and tomato late evolution, and metabolism. Science 2004, 306:79-86. blight in the United States. Plant Dis 1997, 81:1349-1357.

Page 6 of 7 (page number not for citation purposes) BMC Genomics 2007, 8:471 http://www.biomedcentral.com/1471-2164/8/471

20. Kissinger JC, Gajria B, Li L, Paulsen IT, Roos DS: ToxoDB: access- ing the Toxoplasma gondii genome. Nucleic Acids Res 2003, 31:234-236. 21. Bahl A, Brunk B, Crabtree J, Fraunholz MJ, Gajria B, Grant GR, Gins- burg H, Gupta D, Kissinger JC, Labo P, Li L, Mailman MD, Milgram AJ, Pearson DS, Roos DS, Schug J, Stoeckert CJ Jr., Whetzel P: Plas- moDB: the Plasmodium genome resource. A database inte- grating experimental and computational data. Nucleic Acids Res 2003, 31:212-215. 22. Bhattacharjee S, Hiller NL, Liolios K, Win J, Kanneganti TD, Young C, Kamoun S, Haldar K: The malarial host-targeting signal is conserved in the Irish potato famine pathogen. PLoS Pathog 2006, 2:e50. 23. Zdobnov EM, Apweiler R: InterProScan - an integration platform for the signature-recognition methods in InterPro. Bio- informatics 2001, 17:847-848. 24. Bateman A, Coin L, Durbin R, Finn RD, Hollich V, Griffiths-Jones S, Khanna A, Marshall M, Moxon S, Sonnhammer EL, Studholme DJ, Yeats C, Eddy SR: The Pfam protein families database. Nucleic Acids Res 2004, 32:D138-41. 25. Harris MA, Clark J, Ireland A, Lomax J, Ashburner M, Foulger R, Eil- beck K, Lewis S, Marshall B, Mungall C, Richter J, Rubin GM, Blake JA, Bult C, Dolan M, Drabkin H, Eppig JT, Hill DP, Ni L, Ringwald M, Balakrishnan R, Cherry JM, Christie KR, Costanzo MC, Dwight SS, Engel S, Fisk DG, Hirschman JE, Hong EL, Nash RS, Sethuraman A, Theesfeld CL, Botstein D, Dolinski K, Feierbach B, Berardini T, Mun- dodi S, Rhee SY, Apweiler R, Barrell D, Camon E, Dimmer E, Lee V, Chisholm R, Gaudet P, Kibbe W, Kishore R, Schwarz EM, Sternberg P, Gwinn M, Hannick L, Wortman J, Berriman M, Wood V, de la Cruz N, Tonellato P, Jaiswal P, Seigfried T, White R: The Gene Ontology (GO) database and informatics resource. Nucleic Acids Res 2004, 32:D258-61. 26. interpro2go file [http://www.geneontology.org/external2go/ interpro2go] 27. Gene Ontology SQL database [http://www.geneontology.org/ GO.downloads.shtml] 28. Nomenclature committee of the international union of biochemistry and molecular biology (NC-IUBMB), Enzyme Supplement 5 (1999). Eur J Biochem 1999, 264:610-650. 29. ec2go file [http://www.geneontology.org/external2go/ec2go] 30. Kanehisa M: The KEGG database. Novartis Found Symp 2002, 247:91-101; discussion 101-3, 119-28, 244-52. 31. Bedell JA, Korf I, Gish W: MaskerAid: a performance enhance- ment to RepeatMasker. Bioinformatics 2000, 16:1040-1041. 32. Susko E, Roger AJ: Estimating and comparing the rates of gene discovery and expressed sequence tag (EST) frequencies in EST surveys. Bioinformatics 2004, 20:2279-2287. 33. Benjamini Y, Hochberg Y: Controlling the false discovery rate: a practical and powerful approach to multiple testing. J R Statist Soc 1995, 57:289-300.

Publish with BioMed Central and every scientist can read your work free of charge "BioMed Central will be the most significant development for disseminating the results of biomedical research in our lifetime." Sir Paul Nurse, Cancer Research UK Your research papers will be: available free of charge to the entire biomedical community peer reviewed and published immediately upon acceptance cited in PubMed and archived on PubMed Central yours — you keep the copyright

Submit your manuscript here: BioMedcentral http://www.biomedcentral.com/info/publishing_adv.asp

Page 7 of 7 (page number not for citation purposes) Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

58 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 1 : Inroduction -

Conclusion

AphanoDB constitue un outil pouvant être utilisé par toute la communauté scientifique désirant avoir accès aux ESTs annotées d’A. euteiches . L’interface web et les outils de recherche associés (GO, BLAST, mots-clés) permettent de rechercher efficacement des ESTs.

La facilité de recherche et d’accès aux séquences permettra d’identifier les gènes d’A. euteiches qui peuvent représenter un interêt pour l’étude de l’interaction plante-parasite, mais également de réaliser des études comparatives entre génomes eucaryotes. Cette base de données pourra à l’avenir incorporer des nouvelles ressources génomiques (autres banques

EST, séquences génomiques..) afin d’offrir à la communauté scientifique un outil bioinformatique plus performant.

59 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 3 : Identification d’effecteurs et de voies métaboliques chez A. euteiches -

60 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 3 : Identification d’effecteurs et de voies métaboliques chez A. euteiches -

Chapitre 3 : Identification d’effecteurs et de voies métaboliques chez Aphanomyces euteiches

61 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 3 : Identification d’effecteurs et de voies métaboliques chez A. euteiches -

62 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 3 : Identification d’effecteurs et de voies métaboliques chez A. euteiches -

Introduction

L’existence d’effecteurs chez les oomycètes est bien connue et largement étudiée chez les organismes du genre Phytophthora et Hyaloperonospora. Etant données qu’A. euteiches appartient également à la classe des oomycètes l’hypothèse de l’existance de telles protéines chez A. euteiches a été faite. Afin de valider cette hypothèse, nous avons entrepris d’identifier in silico les gènes d’A. euteiches pouvant potentiellement intervenir dans le pouvoir pathogène. En se basant sur les outils disponibles, essentiellement AphanoDB, une fouille de données a été effectué dans le but d’identifier les gènes considérés comme étant potentiellement des effecteurs. Par ailleurs, la distance évolutive qui sépare Phytophthora d’Aphanomyces nous a permis également d’émettre l’hypothèse qu’il pourrait exister des différences métaboliques en Aphanomyces et Phytophthora observables en comparant les

ESTs d’Aphanomyces aux génomes des Phytophthora. Ce chapitre présente sous la forme d’un article les résultats de cette fouille de données et des travaux de génomique comparative.

63 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 3 : Identification d’effecteurs et de voies métaboliques chez A. euteiches -

A. euteiches Transcriptome

Until recently, oomycetes genomics focussed only on Phy- method none was in the frame in agreement with tophthora spp. with the completion of genome sequencing projects BLASTX matches. and large scale identification of expressed sequences [12–17]. - Search for the regular expression RxLx[EDQ]-x(1,40)- These data, combined to functional studies, led to the identifica- [ED][ED][KR] (with the fuzzpro program from EM- tion of new factors of pathogenicity such as the large family of BOSS suite) in the first 100 residues downstream of the RxLR effectors which are thought to manipulate the plant cell signal peptide cleavage site. The RxLx[EDQ] motif was upon their translocation into the host cytoplasm [18]. However the original signal required for secretion identified in little is known about the biology and pathology of other Plasmodium falciparum [25]: 2 out of the 3 resulting oomycetes, notably those belonging to the Saprolegniales. To fill sequences were discarded because of inconsistency of the this gap, we have undertaken a large scale sequencing of A. euteiches strand relatively to similarity searches. cDNAs. This microorganism is of interest since it is able to interact with the model legume Medicago truncatula, offering the opportunity Multiple alignments were conducted using the program to engage genetic approaches for deciphering this interaction [9]. CLUSTALW [26] and visualized with BOXSHADE (http:// Here we report on the characterization of an EST collection www.ch.embnet.org/software/BOX_form.html). CLUSTALW comprising 18,684 EST assembled into 7,977 unique sequences results were submitted to the WebLogo server [27] (http:// from two different cDNA libraries. A systematic comparative weblogo.berkeley.edu). strategy was engaged to identify specific A. euteiches gene sets absent in Phytophthora species. This work greatly expands our knowledge of Results this group of destructive pathogens and points to the large evolutionary divergence within the oomycete lineage. cDNA libraries, cDNA sequencing and functional annotation Materials and Methods Two unidirectionnal cDNA libraries were constructed using mRNAs isolated from mycelium of A. euteiches cultivated either in Aphanomyces euteiches growth conditions vitro in a liquid medium (MYC library) or grown in contact to M. Aphanomyces euteiches (ATCC201684) was maintained on Corn truncatula roots (INT library). A total of 18,684 high-quality Meal Agar medium (8.5 g/l) at 28uC in the dark. Synthetic sequences (9,224 for the MYC library and 9,460 for the INT medium [19] supplemented with pectin from apple (10 g/l) was library) corresponding to the 59 end of cDNA inserts were used to perform growth assay on pectin. acquired. A 7,977 unigene set was assembled from EST data. Among the unigenes, 2,843 consensus sequences were assembled cDNA libraries construction from multiple sequence reads and 5,134 were singlets. Two unidirectional cDNA libraries from A. euteiches were The 7,977 unigene set was annotated by comparison to the prepared from mycelium grown on medium containing yeast NCBI non-redundant (nr) protein database (5-17-2007 Version) extract/glucose (library MYC) and from mycelium in interaction using BLAST analyses [28]. Proteomes of seven fully sequenced with Medicago truncatula roots (library INT) [20]. A total of 18,684 organisms were added to the analysis. These include the expressed sequence tags (9,224 from library MYC and 9,460 from proteomes from two oomycetes (P. sojae and P. ramorum), the library INT) were submitted to the EBI databank for accession diatom Thalassiosira pseudonana, the pathogenic fungus Nectria number assignation and were assembled into 7,977 unigenes [20]. haematococca, the model plant Arabidopsis thaliana and the apicomplexa parasites Toxoplasma gondii and Plasmodium falciparum. Overall, Sequence analysis and database searches about 70% of the sequences showed homology to previously Sequences describe here could be downloaded from the described genes in the NCBI non-redundant protein database Aphanomyces database AphanoDB ([19], http://www.polebio.scsv. using a BLASTX E value cut-off of 1025 (Figure 1). As expected, a ups-tlse.fr/aphano/) and cDNA clones are available at the large proportion of sequences (80%, E value cut-off of ,1025) had CNRGV (http://cnrgv.toulouse.inra.fr/ENG/). Data searches significant similarities to Phytophthora predicted proteins. Interest- and analyses have been conducted on AphanoDB using local tools. ingly, about the same fraction (50%, E value cut-off of 1025)ofA. For detection of RxLR effectors, all open reading frames euteiches sequences showed homology to a plant, diatom, apicom- (ORFs) encoding at least 100 amino acids (delimited by two stops) plexa or fungal sequence whereas these organisms are distantly were extracted. This led to 136,617 putative ORFs. Signal related (Figure 1). The unigene set was then annotated by peptides were predicted with SignalP version 3.0 [21], with a comparisons with the Pfam database of protein domains [29]. 45% hidden Markov model probability cutoff of 0.8 and 10,131 of the sequences showed homology with a protein domain with an candidate secreted proteins were obtained. E value,1025. All the data were stored in a public database called Three independent strategies were used to look for the RxLR AphanoDB (www.polebio.scsv.ups-tlse.fr/aphano/) which is de- motif over all these sequences: scribed elsewhere [20]. Consensus and singlet sequences were named with a unique identifier with the prefix ‘Ae’ for the species, - Search for the regular expression RxLR-x(1,40)- 3 digits for the number of EST included in the contig, the 2 digits [ED][ED][KR] (with the fuzzpro program from EM- ‘AL’ for the strain and 5 digits as unique number. BOSS suite [22]) in the first 100 residues downstream of the signal peptide cleavage site. Genes highly represented in the interaction library This led to the identification of 5 sequences, among Determination of the number of sequences specific of each which only two were retained as being in the same frame library provided a good indication that the two growth conditions as the BLASTX matches. used for library construction allowed the expression of divergent -SearchwithHMMprofilesperformedwiththe transcriptomes. More than 40% of the sequences appeared to be hmmsearch program from the HMMer 2.2 package specific for one library (Table 1). To identify unigenes with a [23] with two alternative profiles, RdEER [24] and statistical difference in transcript abundance, we used a method cropped [18]. From the 2 sequences obtained with this described in [30] based upon the frequencies which genes occur in

PLoS ONE | www.plosone.org 2 March 2008 | Volume 3 | Issue 3 | e1723 A. euteiches Transcriptome

Figure 1. Comparison of A. euteiches sequences to the non redundant protein database at NCBI and proteomes of fully sequenced organisms. Unigene sequences were blasted using the BLASTX software to the nr database and to the proteome of P. sojae (Ps), A. thaliana (At), N. haematococca (Nh), T. pseudonana (Tp) and T. gondii (Tg). For each class of e-value the percentage of unigenes showing homology is indicated. doi:10.1371/journal.pone.0001723.g001 each library and false discovery rate control for multiple test playing a role in adhesion (mucin-like proteins), in protein corrections [31]. Eight genes abundantly represented (p-value,B- degradation and in drug resistance (ABC and PDR-like ABC H cutoff) in the interaction library were identified (Table 2). transporter, cytochrome P450 enzymes). Interestingly, 4 genes encode putative proteins with significant similarity with transporters: 2 sucrose transporters (Ae_48AL7986 Adhesion and Ae_29AL7339), a protein with an oligopeptide transporter One of the most well-characterized protein playing a key role in domain (Ae_21AL7132; InterPro domain IPR004813), and a oomycete adhesion to plant surface component is a cell wall gene coding a probable mitochondrial substrate carrier protein isolated from P. parasitica named CBEL (for Cellulose (Ae_97AL5378). This latter gene is of interest since it has been Binding Elicitor Lectin) [33,34]. CBEL contains two fungal type I shown that a gene encoding a mitochondrial carrier protein is Cellulose Binding Domains (CBD or CBM_1; InterPro domain required for pathogenicity of the soil-borne fungus Fusarium IPR000254) which are involved in cellulose binding but which are oxysporum [32]. also perceived by the host cells as pathogen associated molecular patterns [35]. CBEL also harbours two regions with similarities to Genes encoding potential pathogenicity proteins the N/apple PAN domain (IPR000177), a conserved domain Plant pathogens express a large array of genes playing various involved in protein-protein or protein-carbohydrate interactions roles in pathogenesis. These genes can be roughly classified into [36]. cDNA sequences showing typical CBEL features, i.e CBDs eight major categories according to a scheme established for P. associated to N/apple PAN domains, were not found in A. euteiches sojae and P. parasitica [16,17]. To facilitate comparative analyses, A. ESTs. Accordingly, antigens were not detected with antibodies euteiches unigenes were classified following the same criteria. The directed against CBEL, when mycelium extracts were probed by results obtained with the A. euteiches ESTs were compared to those western blot analysis (data not shown). However, CBDs were obtained from P. sojae ESTs described in [16] since in this later detected in a large gene family coding proteins showing similarities study about the same number of ESTs as in A. euteiches was to a mucin-like protein identified in the soybean root nematode analysed (26,943 ESTs assembled into 7,863 unigenes). This Heterodera glycines (GenBank accession number AAC62109). More comparative approach revealed striking differences between A. than 150 ESTs were assembled into 32 unigenes, the largest contig euteiches and P. sojae (Figure 2). Gene families over-represented in A. containing 39 ESTs (Ae_39AL5321). Similarity between A. euteiches euteiches compared to P. sojae include genes encoding proteins and H. glycines proteins is restricted to a domain originally found in cyst germination proteins of P. infestans (Figure 3; [37]). The full length sequence of Ae_10AL7886 was determined and domain Table 1. Number of expressed sequence tags and unigenes organization of the predicted protein was deduced (Figure 3). specific to a given library. SignalP analysis of the predicted protein identified a 15-amino acids putative signal peptide. Four domains showing typical features of fungal cellulose binding domains were found in the N- Specific ESTs Specific terminal and C-terminal ends of the protein. The central part Library Singlets Per contigsa Total (%) unigenesb showed similarities to the H. glycines mucin-like protein and the cyst INT 2,932 1,652 4,584 48.40 3,576 germination proteins of P. infestans. The combination of these two MYC 2,202 1,772 3,974 43.08 2,755 modules was not detected so far and suggests a role of this protein in cell adhesion. a Number of ESTs per contigs made of ESTs from a single library. Eight distinct cDNA sequences showed similarity to CBEL bTotal number of unigenes (singlets or contigs made of ESTs from a single library) found in a given library; centered on the N/apple PAN domain. This domain is of interest doi:10.1371/journal.pone.0001723.t001 since it has been found in surface proteins of apicomplexan

PLoS ONE | www.plosone.org 3 March 2008 | Volume 3 | Issue 3 | e1723 A. euteiches Transcriptome

Table 2. Unigenes highly represented in the INT library.

ESTs number Unigene ID INT/MYC Best BLASTX matcha E value Species Pfam domain

Ae_97AL5378 93/4 Solute carrier family 5.10241 Danio rerio Mitochondrial substrate carrier Ae_48AL7986 45/3 Probable sucrose transport protein 7.10212 A. thaliana No hit Ae_21AL7132 20/1 Metal-nicotianamine transporter 1.10270 A. thaliana Oligopeptide transporter Ae_29AL7339 27/2 Probable sucrose transport protein 6.10213 A. thaliana No hit Ae_19AL5526 18/1 No hit Phosphatidylinositol kinase Ae_57AL5693 44/13 Elongation factor 7.102179 Solanum lycopersicum Elongation factor tu Ae_44AL7441 39/5 No hit No hit Ae_47AL5766 46/1 No hit No hit

aBLASTX was done against the SwissProt database doi:10.1371/journal.pone.0001723.t002 parasites essential for attachment to host cells [38]. Whereas the Other glycosidases from A. euteiches, potentially involved in role of this domain in oomycete proteins is still unclear, it can be degradation of plant cell wall polysaccharides such as xyloglucans, speculated that it can interact with host targets to promote xylans or galacto(gluco)mannans, were represented by 24 unigenes pathogenesis. cDNAs coding for proteins with N/Apple domains encoding GH family 1, 3 and 30 enzymes. However, GH family fell into two categories. The first category included predicted 12 endoglucanases, potentially involved in xyloglucan degradation protein sequences for which no other protein domains were found and represented by a family of 8 to 10 genes in P. ramorum and P. except one or several N/Apple domains. A representative example sojae [45], and GH family 10 xylanases, represented by more than is Ae_1AL0128 which was fully sequenced (Figure 3). It includes 5 genes in the P. ramorum and P. sojae genomes, were missing in the three N/Apple domains and a predicted transmembrane domain database. located at the C-terminus end. Interestingly, a transmembrane Surprisingly, no EST related to pectin metabolism was found, domain was also detected in the P. falciparum surface protein despite the fact that P. sojae and P. ramorum genomes contain AMA1 which was shown to contain two N/Apple PAN domains numerous pectinase genes [15], and bona-fide pectinase genes were (Figure 3, [39]). The second category included predicted protein found in P. infestans, P. cinnamomi and P. parasitica [12,46–48]. The sequences for which N/apple domains were associated with a lack of sequences related to pectin degradation is correlated with catalytic domain. Two of these unigenes (Ae_7AL7989 and the lack of pectinase activity observed in yeast extract/glucose Ae_1AL5080) were predicted to encode proteins with a peptidase medium (data not shown) and the failure to grow A. euteiches on a domain associated to one (Ae_1AL5080) or five (Ae_7AL7989) N/ synthetic medium containing pectin as sole carbon source, whereas apple domains. Finally, three unigenes were identified showing P. parasitica, which produces an inducible polygalacturonase [47], several copies of a thrombospondin type I motif, a conserved 50 grew equally well on glucose or pectin medium (Figure 4). These amino acid sequence found in surface proteins of Phytophthora and results showed that pectinase genes were poorly expressed in the apicomplexan parasites [40,41] and putatively involved in growth conditions we used, and that pectinase genes are differently adhesion. expressed in A. euteiches and Phytophthora species.

Cell wall degrading enzymes (CWDEs) Proteases and protease inhibitors Sequences encoding enzymes potentially involved in degrada- A large set of A. euteiches sequences were predicted to encode tion of plant cell walls were selected, by looking for the presence of proteases (Figure 2). Serine, aspartyl and cysteine proteases were glycoside hydrolase (GH) domains of enzymes hydrolysing identified, the largest family being the cysteine protease family. substrates that can be found in plant cell walls, such as b-1,4- Comparison with the P. sojae ESTs collection revealed that the and b-1,3-glucanases, pectinases, xylosidases, arabinosidases and number of protease genes is significantly higher in A. euteiches than glucosidases of various specificities [42]. A collection of 53 in P. sojae. For example, 17 unigenes (67 ESTs) of A. euteiches were potential CWDE unigenes out of 7977 unigenes, a proportion predicted to encode serine carboxypeptidase (IPR001563) whereas similar to what was recorded in P. sojae or ramorum [15] was one unigene (1 EST) was found in P. sojae. Another example is obtained. All but one A. euteiches CWDE unigenes had a represented by cysteine proteases (IPR000668) for which 25 Phytophthora homolog with an E value lower than 10240. unigenes (125 ESTs) were found whereas only 5 unigenes (41 b-1,4-glucanases and b-1,3-glucanases mainly of GH families 5 ESTs) were detected in the P. sojae EST collection. Moreover, two and 81 potentially involved in degradation of plant cellulose and types of proteases belonging to the cysteine protease family, callose were represented by 29 unigenes. Among the putative b- peptidase c1b (IPR004134) and peptidase c14 (caspase, 1,3-glucanases from A. euteiches, an homolog (Ae_2AL6121) of a IPR011600) were found only in A. euteiches and not in other previously described GH family 17 endo-1,3-b-glucanase from oomycetes. This analysis showed that A. euteiches is clearly distinct Saprolegnia parasitica [43] and P. infestans (PiENDO1; [44]) was from Phytophthora species with respect to protease production, and found, as well as two unigenes (Ae_2AL7302 and Ae_12AL7443) this is in accordance with the detection of a high protease activity showing high similarity to the GH family 5 exo-1,3-b-glucanase in culture medium (data not shown). PiEXO3 from P. infestans [44]. Interestingly, the latter unigenes are By contrast with the large number of proteases genes, only two exclusively composed of ESTs from the interaction library, genes (13 ESTs) encoding protease inhibitors were detected. These suggesting that they are involved in the interaction with the plant. include a cystein protease inhibitor of the cystatin family

PLoS ONE | www.plosone.org 4 March 2008 | Volume 3 | Issue 3 | e1723 A. euteiches Transcriptome

of 1.0. Similarity searches of the predicted protein against the NCBI non-redundant database using the BLASTP program revealed a weak similarity (E value = 6.1023) to the P. infestans cystatin EPIC4, centered on the predicted active site. Multiple alignment using ClustalW [26] was done using cystatin domains from P. infestans (EPIC1, EPIC2A, EPIC2B, EPIC3 and EPIC4) and the two domains from Ae_2AL5945 (Ae_2AL5945_1 and Ae_2AL5945_2). Cystatin domains from A. euteiches are clearly distinct from P. infestans sequences except in the highly conserved sites of cystatins, i.e. the N terminal trunk and the L1 binding loop (Figure 5). However, the second binding loop is divergent in A. euteiches sequences.

Effectors A class of oomycete effectors which could be delivered inside plant cells during infection was recently characterized. Effectors from Hyaloperonospora parasitica, P. infestans and P. sojae do not show extensive similarity except a conserved RxLR motif downstream of the signal peptide, followed by an EER motif. The A. euteiches unigene collection was mined for putative RxLR effectors looking for matches either to a sequence pattern or to HMM profiles. We end up with two unigenes containing the RxLR-dEER motif (Ae_1AL5059, Ae_1AL1390) and one with a RxLx[EDQ]-dEER motif (Ae_40AL5333), which is close to the Plasmodium motif. Ae_1AL5059 and Ae_1AL1390 showed homology to a putative P. sojae and P. ramorum genes but appeared to be incomplete. Ae_40AL5333 encodes a putative lysine rich protein with no homology to known protein sequence. A distinct class of putative cytoplasmic effectors is the Crinkling and Necrosis (CRN) family first described in P. infestans [48]. While Phytophthora CRNs lack an RxLR motif, some H. parasitica CRNs show an RxRL sequence overlapping another conserved motif LxFLAK [24]. Several sequences showing high similarity with Phytophthora CRN were detected in A. euteiches. The largest groups of CRNs showed strong similarity to P. infestans CRN5 (14 unigenes) or CRN13 (9 unigenes). Interestingly, the conserved LxLFLAK sequence was not present in A. euteiches genes, but a closely related motif, F/LxLYLALK, was detected (Figure 6). This is the first time that CRN genes are found in an organism distinct from Peronosporales suggesting that this class of effectors plays an important role in oomycete pathogenicity. Other oomycete effector genes include genes coding necrosis- inducing peptides (NPP family; [51,52]) and elicitins [53,54]. No ortholog of NPP was found and only one divergent sequence encoding a putative elicitin-like protein was detected (Ae_1AL4317). Figure 2. Classification of unigenes based on eight functional categories involved in pathogenicity. A. euteiches unigenes (black bars) for which a putative function was assigned were classified into Transporters defined categories according to [17] and [16]. For each category the A large number of sequences were predicted to encode proteins number of ESTs (A) and the number of unigene (B) is shown. For involved in transport of molecules. The largest family encodes comparison to Phytophthora, analysis of a EST collection from P. sojae ABC transporters (84 unigenes and 342 ESTs) and PDR-like ABC was added to the figure [16] (white bars). transporters (28 unigenes and 86 ESTs). Interestingly, two doi:10.1371/journal.pone.0001723.g002 oligopeptide transporter genes (Ae_21AL7132 and Ae_1AL0658) encoding putative proteins with an OPT domain (IPR004813) (Ae_2AL5945; IPR000010) and a serine protease inhibitor were found. Two distinct, proton-coupled peptide transport (Ae_11AL6547) containing Kazal domains (IPR002350). These systems have been described in eukaryotic organisms: the PTR two types of protease inhibitors and their potential role in defense- (peptide transport) system, specific for di- and tripeptides, and the counterdefense mechanisms were studied in P. infestans [49,50]. OPT (oligopeptide transport) system, which transports tetra- and Five domains containing typical features of Kazal motifs were pentapeptides. Homolog of di-/tripeptide transporters are found found in Ae_11AL6547. However, more domains could be present in virtually all organisms, whereas the oligopeptide transporters since the sequence appeared to be incomplete. The predicted are limited to fungi and plants (reviewed in [55,56]). While translation product of Ae_2AL5945 were analysed with SignalP the PTR system is well represented in Phytophthora proteomes (8 leading to the identification of a 17 amino acid signal peptide with genes in P. sojae), the OPT proteins are absent, suggesting that a significant mean S value of 0.90 and hidden Markov probability OPT dependant oligopeptide transport is not widely found in

PLoS ONE | www.plosone.org 5 March 2008 | Volume 3 | Issue 3 | e1723 A. euteiches Transcriptome

Figure 3. Protein domain organisation of cell surface proteins from oomycetes and apicomplexa. Two proteins from Phytophthora, CBEL and CAR which are localized at the cell surface [33,37] are represented. CBEL contains two closely associated domains, a cellulose binding domain (CBD) and a N/apple PAN domain (PAN). CAR proteins are composed of a mucin-like region and a N-terminal region (CAR) with conserved cysteine residues. AMA1 is a P. falciparum protein with two PAN domains [39]. doi:10.1371/journal.pone.0001723.g003

oomycetes. However, Ae_21AL7132 and Ae_1AL0658 show strong similarity with an A. thaliana sequence (E value = 6.10272 and 5.10238 respectively) encoding a metal-nicotianamine transporter. This class of plant transporters is involved in iron– phytosiderophore uptake by roots but exhibits also significant sequence similarity to several functionally characterized yeast transporters of the OPT family [57,58]. Thus it cannot be excluded that Ae_21AL7132 and Ae_1AL0658 encoded proteins are involved in uptake of phytosiderophore-Fe complex. Interest- ingly, ESTs assembled into Ae_21AL7132 were found almost exclusively in the interaction library (20 ESTs in the interaction library and 1 in the mycelium library; Table 2) suggesting a role for this class of transporters in pathogenesis.

Identification of A. euteiches genes without orthologs in Phytophthora Identification of unigenes without any similarity to Phytophthora sequences but with similarity to sequences from trypanosamatid parasites led to the identification of a family of proteins putatively involved in the synthesis of trypanothione, a compound playing a key role in defense against oxidative stress in trypanosomatids [59]. Trypanothione is synthesized by conjugation of the polyamine Figure 4. Growth of A. euteiches on synthetic media. A. euteiches spermidine and the tripeptide glutathione. The biosynthesis of and Phytophthora parasitica mycelium were grown on synthetic medium containing Glucose (SM-Glc) or Pectin (SM-Pect) as carbon trypanothione starts with the formation of glutathionylspermidine source. Photos were taken 15 days after inoculation. (Gsp) which then reacts with a second GSH molecule to form doi:10.1371/journal.pone.0001723.g004 trypanothione (Figure 7A). These two biosynthetic steps are

PLoS ONE | www.plosone.org 6 March 2008 | Volume 3 | Issue 3 | e1723 A. euteiches Transcriptome

Figure 5. A cystatin-like protease inhibitor in A. euteiches. A, domain organisation of the deduced protein sequence of Ae_2AL5945. A putative signal peptide (SP) and two domains similar to cystatin domain are shown. B, alignment of cystatin domains from P. infestans cystatins (EPIC1, EPIC2A, EPIC2B , EPIC3 and EPIC4) and from Ae_2AL5945. The active sites of cystatins, including the N-terminal trunk (NT), first binding loop (L1), and second binding loop (L2), are shown. doi:10.1371/journal.pone.0001723.g005

Figure 6. Identification of conserved amino acid residues at the N-terminal extremities of P. infestans and A. euteiches CRN sequences. A, multiple alignment of A. euteiches like CRNs and P. infestans CRNs (CRN1, CRN5, CRN11, CRN14) showing the highest homology to A. euteiches sequences. B, consensus sequence pattern calculated using Weblogo showing the most conserved amino acid residues. doi:10.1371/journal.pone.0001723.g006

PLoS ONE | www.plosone.org 7 March 2008 | Volume 3 | Issue 3 | e1723 A. euteiches Transcriptome

Figure 7. Identification of A. euteiches genes putatively involved in trypanothione synthesis. A, trypanothione biosynthesis starts with the formation of glutathione catalysed by g-glutamyl synthetase and glutathione synthetase. Trypanothione is synthesized from glutathione and spermidine either in two successive steps catalysed by glutathionyl spermidine synthase and trypanothione synthase. It has been shown in some cases that trypanothione synthase is able to catalysed the two reactions. Unigenes predicted to code enzymes belonging to this pathway are indicated. B, multiple alignment of gluthationyl spermidine synthetase from E. coli (GSP_ECOLI), from Crythidia fasciculata (TRYS CRIFA) and Ae_2AL7562. doi:10.1371/journal.pone.0001723.g007 catalysed by two distinct enzymes, glutathionylspermidine synthe- function and without known protein domains. Interestingly, 3 of tases and trypanothione synthetases. However, it has been shown the remaining sequences (Ae_1AL0272, Ae_2AL7741 and that trypanothione syntethase can catalyse the entire synthesis of Ae_1AL3374) showed a strong similarity to hydrolytic enzymes trypanothione in Trypanosoma cruzi and Crithidia fasciculata [60,61]. (glucan hydrolases and lipase) and 3 (Ae_1AL1763, Ae_1AL3400 Glutathionylspermidine has also been identified in E. coli where it and Ae_1AL0931) to non-ribosomal peptide synthetases (NRPS). could be involved in regulating the intracellular level of spermidine These latter enzymes are of outstanding importance since their and glutathione. Six A. euteiches unigenes were found encoding products have been shown to be involved in fungal pathogenesis proteins with a typical glutathionylspermidine syntethase domain [64,65] (Table 3). Four putative NRPS genes were detected in P. (IPR005494) and similarity to trypanothione syntethase sequences sojae and P. ramorum genomes [15]. However these genes are not from trypanosomatids (E value,10210). Moreover, one sequence related to the A. euteiches sequences. These data suggests that A. (Ae_2AL7562) contains a second domain found in trypanothione euteiches could be able to produce secondary metabolites distinct synthetases and bacterial bifunctional glutathionylspermidine from those synthesized by Phytophthora species. synthetase/amidase, the CHAP (cysteine, histidine dependant Comparative analysis of A. euteiches sequences with a high amidohydrolase/peptidase) domain (IPR007921). Alignment of BLASTX score to a A. thaliana or T. pseudonana sequences allowed the protein sequence with an E. coli bifunctional glutathionylsper- the identification of two biosynthetic pathways which are absent in midine synthetase [62] and a trypanothione synthetase from the Phytophthora species but present in Aphanomyces (Table 3). One insect parasite C. fasciculata [63] is shown on Figure 7B. These sequence (Ae_1AL0450) showed significant similarity to a results suggest the presence of a glutathionylspermidine based thiamine biosynthetic enzyme from plants (top hit to protein defense mechanism against oxidative stress in A. euteiches that is AAP03875, E value = 1.102110) and a thiamine biosynthesis Thi4 absent in other oomycetes such as P. sojae and P. ramorum. protein domain (IPR002922). This enzyme is involved in the To find A. euteiches genes which could be absent in other synthesis of the thiamine precursor, thiazole. Members of the oomycetes but present in fungal plant pathogens, all the unigenes genus Phytophthora are thiamine auxotrophs and consequently lack sequences were compared to the pea root pathogen N. haematococca. this biosynthetic enzyme whereas A. euteiches and other Saproleg- The sequences showing an E value greater than 0.1 to a niales such as Saprolegnia parasitica are able to synthesize thiamine. Phytophthora sequence and lower than 10210 to a sequence from Accordingly, the sequence from A. euteiches is highly similar to the the N. haematococca proteomes were selected. About half of the S. parasitica gene (SPM2G2; 93% identity at the protein level) sequences (19 unigenes) matched to sequences of unknown described in [43].

PLoS ONE | www.plosone.org 8 March 2008 | Volume 3 | Issue 3 | e1723 A. euteiches Transcriptome

Table 3. A. euteiches unigenes showing a BLASTX match to fungal, plant or diatom proteins (E value,1.10210) and not to Phytophthora proteins (E value.0.1).

Unigene ID Best hit Best BLASTX match nr databank E value Species Pfam domain

Ae_1AL1763 N. haematococca nonribosomal peptide synthetase 2.10235 Omphalotus olearius Condensation domain Ae_1AL0931 non-ribosomal peptide synthetase 8.10246 Granulibacter bethesdensis No hit Ae_1AL3400 unnamed protein product 1.10217 Aspergillus oryzae Condensation domain Ae_1AL0272 b 1,3-glucanase 3.10219 Strongylocentrotus purpuratus No hit Ae_2AL7741 hypothetical protein 1.10236 Phaeosphaeria nodorum GH 71 Ae_1AL3374 hypothetical protein 1.10214 Gibberella zeae Lipolytic enzyme Ae_2AL7237 A. thaliana hypothetical protein 9.10223 Oryza sativa HMGCoA reductase Ae_8AL7813 HMG-CoA reductase 6.10298 Gossypium hirsutum No hit Ae_1AL1432 HMG-CoA reductase 5.10282 Gossypium hirsutum HMGCoA reductase Ae_1AL0818 cycloartenol synthase 5.10288 Betula platyphylla No hit Ae_1AL0450 thiazole biosynthetic protein 1.102110 Nicotiana tabacum thiamine biosynthesis thi4 protein Ae_1AL1432 T. pseudonana HMG-CoA reductase 5.10282 Gossypium hirsutum HMGCoA reductase Ae_2AL7237 hypothetical protein 9.10223 Oryza sativa HMGCoA reductase Ae_3AL7274 lanosterol synthase 8.10272 Homo sapiens Prenyltransferase/squalene oxidase Ae_2AL7738 unnamed protein product 8.10263 Tetraodon nigroviridis Squalene/phytoene synthase

doi:10.1371/journal.pone.0001723.t003

Phytophthora species being sterol auxotrophs, key genes coding for similarity to a Phytophthora predicted protein sequence. About 20% enzymes involved in sterol biosynthesis were not identified in of unigenes did not have any ortholog in P. sojae or P. ramorum. More Phytophthora genomes [15]. By contrast, Saprolegniales species such surprisingly, we found that similar proportions of unigenes have an as A. euteiches are able to grow in minimal media without exogenous ortholog in the plant A. thaliana, the fungus N. haematococca,the sterols. Accordingly, several genes coding for putative sterol diatom T. pseudonana and the apicomplexa T. brucei. These sequences biosynthesis enzymes were identified. These include two cycloar- were examined in more detail with a particular emphasis to those tenol synthases (Ae_3AL7274; Ae_1AL0818) and a cytochrome with no orthologs in Phytophthora genomes. This revealed the P450 enzyme belonging to the CYP51 family (Ae_5AL7244) presence of genes involved in biosynthetic pathways which are which strongly matched (E values,10270) plant enzymes. Each known to be absent in Phytophthora. For example, it is known that gene has also closed orthologs in the diatom T. pseudonana Phytophthora species, but not Aphanomyces species, are thiamine suggesting that the sterol biosynthetic is ancient in the oomycete auxotrophs. Accordingly, a gene coding a thiamine biosynthetic lineage and has been lost by Phytophthora species. enzyme was identified, showing homology with a S. parasitica sequence [43]. Another highly significant example concerns sterol Discussion metabolism. Among oomycetes, members of the Saprolegniale order can synthesize sterols de novo whereas species belonging to In this study we describe an extensive characterization of an Pythiales are sterol auxotrophs. We found several genes encoding EST collection of A. euteiches, an economically important plant proteins showing high similarity to enzymes involved in sterol pathogen. The closest oomycete specie which was the subject of a biosynthesis. This pathway is a major target for chemical inhibitors genomic approach is the fish pathogen S. parasitica, with the and a large number of fungicides have been developed acting sequencing of 1,510 cDNA clones (1,279 unigenes) obtained from mainly on a demethylation step catalysed by a cytochrome p450 one library constructed from mycelium grown axenically [43]. The enzyme of the CYP51 family. The identification of this class of current study is more expansive in terms of number of cDNA proteins in A. euteiches will allow the development of new compounds clones sequenced (18,684) and constructed libraries (2) and adds to acting on Saprolegniale pathogens. The ability of A. euteiches to the EST resources available for other oomycetes such as P. sojae synthesize its own sterols could be correlated with the fact that one (7,863 unigenes) [16], P. infestans (18,256 unigenes) [12] and P. elicitin-like sequence has been detected and no antigen was detected parasitica (4734 unigenes from two libraries) [17,66]. Comparison with anti elicitin antibodies when culture filtrates were probed by between the unigene contents of the two A. euteiches libraries western blot analysis (data not shown). Elicitins are proteins found showed that they reflected two divergent expression programs. only in oomycetes where they were proposed to act as sterol carriers The procedure used to cultivate A. euteiches mycelium in contact to [67]. In Phytophthora, elicitins represent a major class of secreted M. truncatula roots avoided contamination of pathogen mRNAs protein and are highly expressed. For example, 210 ESTs, with plant mRNAs [20]. Nevertheless, perception of plant root corresponding to 16 elicitin genes were detected in the P. sojae tissue by the pathogen occurred, leading to the induction of a EST collection [16]. Moreover, elicitins can be perceived by the specific subset of genes. These include 4 transporter genes which host cell, leading to a strong induction of defense reactions, and are could be involved in nutrient uptake during infection. thought to play a role in plant-pathogen specificity [53]. Thus, the Comparative analysis of A. euteiches unigene sequences to low expression of elicitins in A. euteiches could be linked to its ability to proteomes derived from fully sequenced organisms provided a synthesize its own sterols. global view of sequence similarities distribution among organisms Classification of putative pathogenicity factors into 8 categories which are distantly related. As expected, most of sequences showed revealed other striking differences between A. euteiches and

PLoS ONE | www.plosone.org 9 March 2008 | Volume 3 | Issue 3 | e1723 A. euteiches Transcriptome

Phytophthora species. These include qualitative and quantitative infection. These gene products all contain an RxLR motif which differences for gene encoding hydrolases, effectors or proteins has been shown to be essential for the effective transport of these involved in adhesion, drug resistance and oxidative stress. effectors [18]. While no clear homolog of effectors belonging to the Adhesion of pathogens to the surface of host tissues is a critical RxLR class were identified in A. euteiches, their presence cannot be step in the establishment of oomycete pathogenesis [68]. Although fully excluded. It has been shown that these proteins are under a several adhesins produced by fungal pathogens have been strong positive selection [24] and can thus escape in silico analyses. characterized, molecular mechanisms involved in adhesion of However, genes showing strong similarity with a second class of oomycetes plant pathogens are still largely unknown. These effectors belonging to the crinkler family were identified. Up to include cyst germination proteins from P. infestans which share now, these proteins were found only in Phytophthora species where homology with mucins [37], Phytophthora surface proteins contain- they represent a large superfamily with 40 genes in the genome of ing thrombospondin repeats [40] and P. parasitica CBEL [34]. A P. sojae [15]. CRNs were issued from a large screen aiming at functional approach demonstrated the essential role of CBEL in identifying extracellular proteins from P. infestans able to induce adhesion. Inhibition of CBEL gene expression in transgenic P. symptoms when expressed in plant tissues [48]. While the exact parasitica strains led to a dramatic reduction in adhesion of the function of CRNs is still unclear, conservation of these sequences mycelium to cellulosic substrates [69]. Several sequences showing in all pathogenic oomycetes examined so far indicates that they similarity with Phytophthora adhesins were found in A. euteiches but probably play a specific role in oomycete pathogenesis. with specific features. Of particular interest is a highly expressed Finally, comparison of A. euteiches sequences to protein sequences family of proteins composed of a combination of cellulose binding from tryponosomatids led to the identification of protein sequences domains (CBM_1) similar to those present in CBEL, and acidic with strong similarity to enzymes involved in synthesis of domains found in the N-terminal part of the P. infestans cyst antioxidant compounds, glutathionylspermidine and trypa- germination proteins. These proteins can represent a novel class of nothione. Trypanothione has been identified as an essential redox oomycete adhesins. intermediate and its role in defense against oxidative stress has Analysis of the EST collection revealed expansion of gene been demonstrated in the human pathogens Trypanosoma brucei and families in A. euteiches such as genes encoding proteases. Proteases Leishmania donovani, [72,73]. Since the oxidative burst is one of the and protease inhibitors play an important role in the molecular earliest observable plant defense response against pathogen dialogue which establishes between the pathogen and its host. In invasion (for review see [74]), the production of antioxidant Phytophthora, several protease inhibitors have been shown to target compounds will constitute an efficient defense mechanism for the plant proteases during infection [49,50]. Expansion of proteases pathogen. gene families in A. euteiches indicates that these proteins are probably major players of A. euteiches pathogenicity. Thus, protein In conclusion this work greatly expands our knowledge of a degradation and utilization is probably a major metabolic pathway genus which includes plant and animal pathogens and more related to pathogenesis in A. euteiches. Others genes showing generally illustrates the diversity which can exist among the expansion and diversification in A. euteiches comprise ABC oomycete. The repertoire of expressed genes described here will be transporters whose role in mediating resistance to plant toxins used as source of candidate genes for functional studies aiming at and fungicide has been suggested in Phytophthora [70]. By contrast, identifying essential factors of A. euteiches pathogenicity. some gene families which are well represented in Phytophthora were not detected in A. euteiches. This is the case for pectinases for which Acknowledgments their role as pathogenicity factors has been demonstrated for We thank Didier Laborie, David Allouche, Jean-Marc Larre and all several plant pathogens. The lack of ESTs showing homology to members of the Bioinformatic Platform of the Genopole (Toulouse, France) pectinases is correlated to the weak production of extracellular for computing technical support. pectinolytic activity in vitro and the absence of A. euteiches growth on a medium containing pectin as sole carbon source. Recently, Author Contributions sequencing of a 192 bp genomic DNA fragment of A. euteiches revealed similarity with a P. capsici polygalacturonase [71]. Thus it Conceived and designed the experiments: EG. Performed the experiments: cannot be definitively concluded from our results that pectinase PW AC EG MM AB CJ. Analyzed the data: PW BD MM AB CM. Contributed reagents/materials/analysis tools: PW AC MM AB CJ CM. genes are not present in A. euteiches. Wrote the paper: BD. Another group of oomycete pathogenicity factors are proteins which are translocated into the cytoplasm of the host cell during

References 1. Delwich PA, Grau CR, Holub EB, Perry JB (1987) Characterization of 7. So¨derha¨ll K, Cerenius L (1999) The crayfish plague fungus: history and recent Aphanomyces euteiches isolates recovered from alfalfa in Wisconsin. Plant Dis 71: advances. Freshwater Crayfish 12: 11–35. 155–161. 8. Blazer VS, Lilley JH, Schill WB, Kiryu Y, Densmore C, et al. (2002) Aphanomyces 2. Levenfors JP, Wikstrom M, Persson L, Gerhardson B (2003) Pathogenicity of invadans in Atlantic menhaden along the east coast of the United States. J Aquat Aphanomyces spp. from different leguminous crops in Sweden. Eur J Plant Pathol Anim Health 14: 1–10. 109: 535–543. 9. Gaulin E, Jacquet C, Bottin A, Dumas B (2007) Root rot disease of legumes 3. Wicker E, Rouxel F (2001) Specific behaviour of French Aphanomyces euteiches caused by Aphanomyces euteiches. Mol Plant Pathol 8: 539–548. Drechs. populations for virulence and aggressiveness on pea, related to isolates 10. Martin HL (2003) Management of soilborne diseases of beetroot in Australia: a from Europe, America and New Zealand. Eur J Plant Pathol 107: 919–929. review. Aust J Exp Agri 43: 1281–1292. 4. Mitchell JE, Yang CY (1966) Factors affecting growth and development of 11. Kamoun S (2001) Nonhost resistance to Phytophthora: novel prospects for a Aphanomyces euteiches. Phytopathology 56: 917–922. classical problem. Curr Opin Plant Biol 4: 295–300. 5. Larsson M (1994) Pathogenicity, morphology and isozyme variability among 12. Randall TA, Dwyer RA, Huitema E, Beyer K, Cvitanich C, et al. (2005) Large- isolates of Aphanomyces spp. from weeds and various plants. Mycol Res 98: scale gene discovery in the oomycete Phytophthora infestans reveals likely 231–240. components of phytopathogenicity shared with true fungi. Mol Plant Microbe 6. Pilet-Nayel ML, Muehlbauer FJ, McGee RJ, Kraft JM, Baranger A, et al. (2005) Interact 18: 229–243. Consistent quantitative trait loci in pea for partial resistance to Aphanomyces 13. Gajendran K, Gonzales MD, Farmer A, Archuleta E, Win J, et al. (2006) euteiches isolates from the United States and France. Phytopathology 95: Phytophthora functional genomics database (PFGD): functional genomics of 1287–1293. Phytophthora-plant interactions. Nucleic Acids Res 34: 465–470.

PLoS ONE | www.plosone.org 10 March 2008 | Volume 3 | Issue 3 | e1723 A. euteiches Transcriptome

14. Waugh M, Hraber P, Weller J, Wu Y, Chen G, et al. (2000) The Phytophthora 43. Torto-Alalibo T, Tian M, Gajendran K, Waugh M, van West P, et al. (2005) genome initiative database: informatics and analysis for distributed pathoge- Expressed sequence tags from the oomycete fish pathogen Saprolegnia parasitica nomic research. Nucleic Acids Res 28: 87–90. reveal putative virulence factors. BMC Microbiol 2: 5–46. 15. Tyler BM, Tripathy S, Zhang X, Dehal P, Jiang RH, et al. (2006) Phytophthora 44. McLeod A, Smart CD, Fry WE (2003) Characterization of 1,3-b-glucanase and genome sequences uncover evolutionary origins and mechanisms of pathogen- 1,3;1,4-b-glucanase genes from Phytophthora infestans. Fungal Genet Biol 38: 250–263. esis. Science 313: 1261–1266. 45. Costanzo S, Ospina-Giraldo MD, Deahl KL, Baker CJ, Jones RW (2006) Gene 16. Torto-Alalibo TA, Tripathy S, Smith BM, Arredondo FD, Zhou L, et al. (2007) duplication event in family 12 glycosyl hydrolase from Phytophthora spp. Fungal Expressed sequence tags from Phytophthora sojae reveal genes specific to Genet Biol 43: 707–714. development and infection. Mol Plant Microbe Interact 20: 781–793. 46. Gotesson A, Marshall JS, Jones DA, Hardham AR (2002) Characterization and 17. Panabie`res F, Amselem J, Galiana E, Le Berre J (2005) Gene identification in the evolutionary analysis of a large polygalacturonase gene family in the oomycete oomycete pathogen Phytophthora parasitica during in vitro vegetative growth plant pathogen Phytophthora cinnamomi. Mol Plant Microbe Interact 15: 907–921. through expressed sequence tags. Fungal Genet Biol 42: 611–623. 47. Yan HZ, Liou RF (2005) Cloning and analysis of pppg1, an inducible 18. Whisson SC, Boevink PC, Moleleki L, Avrova AO, Morales JG, et al. (2007) A endopolygalacturonase gene from the oomycete plant pathogen Phytophthora translocation signal for delivery of oomycete effector proteins into host plant parasitica. Fungal Genet Biol 42: 339–350. cells. Nature 450: 115–118. 48. Torto TA, Li S, Styer A, Huitema E, Testa A, et al. (2003) EST mining and 19. Papavizas G, Davey C (1960) Some factors affecting growth of Aphanomyces functional expression assays identify extracellular effector proteins from the plant euteiches in synthetic media. Amer J Bot 47: 758–765. pathogen Phytophthora. Genome Res 13: 1675–1685. 20. Madoui MA, Gaulin E, Mathe´C, San Clemente H, Couloux A, et al. (2007) 49. Tian M, Huitema E, Da Cunha L, Torto-Alalibo T, Kamoun S (2004) A Kazal- like extracellular serine protease inhibitor from Phytophthora infestans targets the AphanoDB: a genomic resource for Aphanomyces pathogens. BMC Genomics 8: tomato pathogenesis-related protease P69B. J Biol Chem 279: 26370–26375. 471. 50. Tian M, Win J, Song J, van der Hoorn R, van der Knaap E, et al. (2007) A 21. Bendtsen JD, Nielsen H, von Heijne G, Brunak S (2004) Improved prediction of Phytophthora infestans cystatin-like protein targets a novel tomato papain-like signal peptides: SignalP 3.0. J Mol Biol 340: 783–795. apoplastic protease. Plant Physiol 143: 364–377. 22. Rice P, Longden I, Bleasby A (2000) EMBOSS: the European Molecular 51. Fellbrich G, Romanski A, Varet A, Blume B, Brunner F, et al. (2002) NPP1, a Biology Open Software Suite. Trends Genet 16: 276–277. Phytophthora-associated trigger of plant defense in parsley and Arabidopsis. Plant J 23. Eddy SR (1998) Profile hidden Markov models. Bioinformatics 14: 755–763. 32: 375–390. 24. Win J, Morgan W, Bos J, Krasileva KV, Cano LM, et al. (2007) Adaptive 52. Qutob D, Kamoun S, Gijzen M (2002) Expression of a Phytophthora sojae necrosis- evolution has targeted the C-terminal domain of the RXLR effectors of plant inducing protein occurs during transition from biotrophy to necrotrophy. Plant J pathogenic oomycetes. Plant Cell 19: 2349–2369. 32: 361–373. 25. Hiller NL, Bhattacharjee S, van Ooij C, Liolios K, Harrison T, et al. (2004) A 53. Ponchet M, Panabie`res F, Milat ML, Mikes V, Montillet JL, et al. (1999) Are host-targeting signal in virulence proteins reveals a secretome in malarial elicitins cryptograms in plant-Oomycete communications? Cell Mol Life Sci 56: infection. Science 306: 1934–1937. 1020–1047. 26. Thompson JD, Higgins DG, Gibson TJ (1994) CLUSTAL W: improving the 54. Jiang RH, Tyler BM, Whisson SC, Hardham AR, Govers F (2006) Ancient origin sensitivity of progressive multiple sequence alignment through sequence of elicitin gene clusters in Phytophthora genomes. Mol Biol Evol 23: 338–351. weighting, position-specific gap penalties and weight matrix choice. Nucleic 55. Stacey G, Koh S, Granger C, Becker JM (2002) Peptide transport in plants. Acids Res 22: 4673–4680. Trends Plant Sci 7: 257–263. 27. Crooks GE, Hon G, Chandonia JM, Brenner SE (2004) WebLogo: A sequence 56. Hauser M, Narita V, Donhardt AM, Naider F, Becker JM (2001) Multiplicity logo generator. Genome Res 14: 1188–1190. and regulation of genes encoding peptide transporters in Saccharomyces cerevisiae. 28. Altschul SF, Madden TL, Schaffer AA, Zhang J, Zhang Z, et al. (1997) Gapped Mol Membr Biol 18: 105–112. BLAST and PSI-BLAST: a new generation of protein database search 57. Le Jean M, Schikora A, Mari S, Briat JF, Curie C (2005) A loss-of-function programs. Nucleic Acids Res 25: 3389–3402. mutation in AtYSL1 reveals its role in iron and nicotianamine seed loading. 29. Bateman A, Coin L, Durbin R, Finn RD, Hollich V, et al. (2004) The Pfam Plant J 44: 769–782. protein families database. Nucleic Acids Res 32: D138–141. 58. Yen MR, Tseng YH, Saier MH Jr (2001) Maize Yellow Stripe1, an iron- 30. Susko E, Roger AJ (2004) Estimating and comparing the rates of gene discovery phytosiderophore uptake transporter, is a member of the oligopeptide and expressed sequence tag (EST) frequencies in EST surveys. Bioinformatics transporter (OPT) family. Microbiology 147: 2881–2883. 20: 2279–2287. 59.FairlambAH,BlackburnP,UlrichP,ChaitBT,CeramiA(1985) 31. Benjamini Y, Hochberg Y (1995) Controlling the false discovery rate: a practical Trypanothione: a novel bis(glutathionyl)spermidine cofactor for glutathione and powerful approach to multiple testing. J R Stat Soc Ser B 57: 289–300. reductase in trypanosomatids. Science 227: 1485–1487. 32. Inoue I, Namiki F, Tsuge T (2002) Plant colonization by the vascular wilt fungus 60. Oza SL, Tetaud E, Ariyanayagam MR, Warnon SS, Fairlamb AH (2002) A Fusarium oxysporum requires FOW1, a gene encoding a mitochondrial protein. single enzyme catalyses formation of trypanothione from glutathione and Plant Cell 14: 1869–1883. spermidine in Trypanosoma cruzi. J Biol Chem 277: 35853–35861. 33. Se´jalon-Delmas N, Villalba Mateos F, Bottin A, Rickauer M, Dargent R, et al. 61. Comini M, Menge U, Wissing J, Flohe L (2005) Trypanothione synthesis in (1997) Purification, elicitor activity, and cell wall localization of a glycoprotein Crithidia revisited. J Biol Chem 280: 6850–6860. from Phytophthora parasitica var. nicotianae, a fungal pathogen of tobacco. 62. Bollinger JM Jr, Kwon DS, Huisman GW, Kolter R, Walsh CT (1995) Phytopathology 87: 899–909. Glutathionylspermidine metabolism in Escherichia coli. Purification, cloning, 34. Villalba-Mateos F, Rickauer M, Esquerre´-Tugaye´ MT (1997) Cloning and overproduction, and characterization of a bifunctional glutathionylspermidine characterization of a cDNA encoding an elicitor of Phytophthora parasitica var. synthetase/amidase. J Biol Chem 270: 14031–14041. nicotianae that shows cellulose-binding and lectin-like activities. Mol Plant- 63. Alphey MS, Leonard GA, Gourley DG, Tetaud E, Fairlamb AH, et al. (1999) Microbe Interact 10: 1045–1053. The high resolution crystal structure of recombinant Crithidia fasciculata tryparedoxin-I. J Biol Chem 274: 25613–25622. 35. Gaulin E, Drame´ N, Lafitte C, Torto-Alalibo T, Martinez Y, et al. (2006) 64. Lee BN, Kroken S, Chou DY, Robbertse B, Yoder OC, et al. (2005) Functional Cellulose binding domains of a Phytophthora cell wall protein are novel pathogen- analysis of all nonribosomal peptide synthetases in Cochliobolus heterostrophus associated molecular patterns. Plant Cell 18: 1766–1777. reveals a factor, NPS6, involved in virulence and resistance to oxidative stress. 36. Tordai H, Banyai L, Patthy L (1999) The PAN module: the N-terminal domains Eukaryot Cell 4: 545–555. of plasminogen and hepathocyte growth factor are homologous with the apple 65. Johnson RD, Johnson L, Itoh Y, Kodama M, Otani H, et al. (2000) Cloning and domains of the prekallikrein family and with a novel domain found in numerous characterization of a cyclic peptide synthetase gene from Alternaria alternata apple nematode proteins. FEBS Lett 461: 63–67. pathotype whose product is involved in AM-toxin synthesis and pathogenicity. 37. Gornhardt B, Rouhara I, Schmelzer E (2000) Cyst germination proteins of the Mol Plant Microbe Interact 13: 742–753. potato pathogen Phytophthora infestans share homology with human mucins. Mol 66. Le Berre JY, Engler G, Panabieres F (2007) Exploration of the late stages of the Plant Microbe Interact 13: 32–42. tomato-Phytophthora parasitica interactions through histological analysis and 38. Brecht S, Carruthers V, Ferguson D, Giddings O, Wang G, et al. (2001) The generation of expressed sequence tags. New Phytol. pp 1–11. toxoplasma micronemal protein MIC4 is an adhesin composed of six conserved 67. Mikes V, Milat ML, Ponchet M, Panabieres F, Ricci P, et al. (1998) Elicitins, apple domains. J Biol Chem 276: 4119–4127. proteinaceous elicitors of plant defense, are a new class of sterol carrier proteins. 39. Bai T, Becker M, Gupta A, Strike P, Murphy VJ, et al. (2005) Structure of Biochem Biophys Res Commun 245: 133–139. AMA1 from Plasmodium falciparum reveals a clustering of polymorphisms that 68. Hardham AR (2007) Cell biology of plant-oomycete interactions. Cell Microbiol surround a conserved hydrophobic pocket. Proc Natl Acad Sci USA 102: 9: 31–39. 12736–12741. 69. Gaulin E, Jauneau A, Villalba F, Rickauer M, Esquerre´-Tugaye´ MT, et al. 40. Robold AV, Hardham AR (2005) During attachment Phytophthora spores secrete (2002) The CBEL glycoprotein of Phytophthora parasitica var-nicotianae is involved proteins containing thrombospondin type 1 repeats. Curr Genet 47: 307–315. in cell wall deposition and adhesion to cellulosic substrates. J Cell Sci 115: 41. Anantharaman V, Iyer LM, Balaji S, Aravind L (2007) Adhesion molecules and 4565–4575. other secreted host-interaction determinants in Apicomplexa: insights from 70. Judelson HS, Senthil G (2006) Investigating the role of ABC transporters in comparative genomics. Int Rev Cytol 262: 1–74. multifungicide insensitivity in Phytophthora infestans. Mol Plant Pathol 7: 17–29. 42. Henrissat B, Davies G (1997) Structural and sequence-based classification of 71. Akamatsu HO, Grunwald NJ, Chilvers MI, Porter LD, Peever TL (2007) glycoside hydrolases. Curr Opin Struct Biol 7: 637–644. Development of codominant simple sequence repeat, single nucleotide

PLoS ONE | www.plosone.org 11 March 2008 | Volume 3 | Issue 3 | e1723 A. euteiches Transcriptome

polymorphism and sequence characterized amplified region markers for the pea 73. Tovar J, Wilkinson S, Mottram JC, Fairlamb AH (1998) Evidence that root rot pathogen, Aphanomyces euteiches. J Microbiol Methods 71: 82–86. trypanothione reductase is an essential enzyme in Leishmania by targeted 72. Krieger S, Schwarz W, Ariyanayagam MR, Fairlamb AH, Krauth-Siegel RL, et replacement of the tryA gene locus. Mol Microbiol 29: 653–660. al. (2000) Trypanosomes lacking trypanothione reductase are avirulent and show 74. Wojtaszek P (1997) Oxidative burst: an early plant response to pathogen increased sensitivity to oxidative stress. Mol Microbiol 35: 542–552. infection. Biochem J 322: 681–692.

PLoS ONE | www.plosone.org 12 March 2008 | Volume 3 | Issue 3 | e1723 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 3 : Identification d’effecteurs et de voies métaboliques chez A. euteiches -

Conclusion

Les résultats de la recherche in s ilico d’effecteurs chez A. euteiches permet de valider l’hypothèse émise précédement quant à l’existence de protéines homologues de Phytophthora, pouvant potentiellement intervenir dans les mécanismes infectieux. Certaines des protéines identifiées chez A. euteiches pourraient constituer de bons candidats à une analyse fonctionelle qui viendrait compléter l’approche bioinformatique et valider ainsi leurs rôles d’effecteurs. D’autres part, la comparaison des séquences d’A. euteiches avec les génomes et les protéomes de Phytophthora a débouché sur l’identification de différentes voies de synthèses absentes chez les Phytophthora, dont celle des stérols. Ces résultats suggèrent de l’existence de différences métaboliques entre Phytophthora et Aphanomyces.

77 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

78 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

Chapitre 4 : Synthèse de sterols chez A. euteiches

79 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

B A

C D

HOHOHO HOHOHO

Figure 10 : Représentation de la structure chimique des stérols. A. Noyau tétracyclique représentant la base de la structure d’un stérol. B. Numérotation des carbones sur une molécules de cholestérols, le groupement OH est proté par le carbone 3, l’insaturation par les carbones 5 et 6 et la ramification par le carbone 17. C Sitostérol. D. Ergostérol

80 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

Introduction aux stérols

L'analyse comparative des séquences d’A. euteiches présentes dans AphanoDB a mis en

évidence la présence de gènes codant des enzymes intervenant dans la synthèse de stérols, absents ches les autres oomycètes en particulier ceux du genre Phytophthora. Dans ce chapitre nous nous proposons de présenter les caractéristiques générales des stérols. Les structures chimiques, les fonctions biologiques, et les voies de synthèse connues des stérols chez les organismes vivants y sont décrites. Puis nous présentons l’étude des caractéristiques biochimiques, génomiques et évolutives de la voie de synthèse de stérols chez A. euteiches.

Structure chimique et nomenclature des stérols

Les stérols sont des molécules lipidiques possédant une structure tétracyclique, un groupement hydroxyle sur le troisième carbone (Figure 10.A) et une chaîne aliphatique sur le

17ième carbone (Figure 10.B). La structure des stérols varie essentiellement au niveau de la nature de la chaîne aliphatique en C17 (nombre de carbone, alkylation et insaturation) ainsi qu’au niveau de la position et du nombre d’insaturation sur les cycles. La structure chimique de deux stérols majeurs, le sitostérol (stérol de plantes) et l’ergostérol (stérol de champignons), sont illustrés sur la figure 10 (C et D).

En utilisant la nomenclature des stérols officielle IUPAC (www.iupac.org), la dénomination d’un stérol se fait d’abord en fonction de la structure du noyau tétracyclique. On distingue trois types de noyaux (cholest(a), ergost(a), stigmast(a)) auxquel on ajoute les préfixes et les suffixes usuels de la nomenclature IUPAC. Seuls les stérols les plus communs sont nommés par un nom trivial. Par exemple, c’est le cas du cholest-5-en-3 -ol (cholestérol), du stigmasta-5,22-dien-3-beta-ol (stigmastérol), et du (22E)-ergosta-5,7,22-trien-3-beta-ol

(ergostérol).

81 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

Tableau 6 : Diversité des stérols chez les organismes vivant. La première colonne définie les super-groupes (selon la classification phylogénique actuelle) auxquels appartiennent les organismes. La seconde colonne correspond à la classe ou au phylum considéré. La dernière colonne comporte les stérols majeurs de la classe (ou du phylum considéré) par ordre d’abondance décroissante. Tous les stérols ne sont pas présents chez tous les organismes. Les stérols sont noté CxΔy où x est le nombre de carbone et y le nombre d’insaturation. Entre parenthèse est mentionné le non courant du stérols. Les stérols mentionnés peuvent être absent chez certains organismes de la classe ou du phylum considéré. Supergroupes Phyla / Classes Stérols majeurs

5 Mammalia C27Δ (cholestérol) 5,24(28) Mollusca C28Δ (24-methylènecholestérol) Echinodermata C Δ5, C Δ7 Opistokonta 27 27 5 5 5 Poriferata C30Δ (isopropylcholestérol),C27Δ , C29Δ 5,7,22 7 5,7,22 Eumycota C28Δ (ergostérol), C28Δ , C27Δ 5,7,9(11),22 Choanozoa C27Δ 5 5 5,22 Streptophyceae C29Δ (sitostérol), C28Δ (campestérol), C29Δ 5,22 5,24(28) (stigmastérol), C28Δ (brassicastérol), C29Δ (Δ5- Plantae avenastérol) 5 5,7,22 7,22 5,22 5 Chlorophyceae C28Δ , C28Δ , C28Δ , C29Δ , C29Δ

5 5,22 Rhodophyceae C27Δ , C27Δ

5,7,22 ,7,22 Heteroblosea C28Δ , 4-methyl-C28Δ Excavata 5,7,24(28) 7,24(28), Euglenozoa C28Δ ,C28Δ

5,22 Amoebozoa Dictyostelia C29Δ (Dictyostérol) 5,24(28) Pheophyceae C29Δ (Fucostérol) 5,22 5,24(28) 5 5 5,22 Bacillariophyceae C28Δ , C28Δ ,C27Δ , C29Δ , C27Δ , 5 5 Xanthophyceae C29Δ , C27Δ 5,24(28) 5,22 5 Chromalveolata Pelagophyceae C30Δ (24 propylidènecholesterol) , C29Δ , C29Δ , 5,24(28) C28Δ 5 5,7,22 5,24(28) Oomycetes C27Δ , C28Δ , C28Δ 5 5,22 Raphidophyceae C27Δ ,C27Δ 5,22 5,22 5 Chrysophyceae C28Δ , C29Δ , C29Δ , 5,22 5,22 5,22 5,22 5,22 Haptophyceae C28Δ , C28Δ , C28Δ , C28Δ , C28Δ , 5,22 5,22 5,22 5,22 Cryptophyceae C28Δ , C28Δ , C28Δ , C28Δ , 5,22 Dinophyceae C30Δ (Dinostérol) 8 Methylococcal 4-methyl-C27Δ Bacteria 8 Mycobacterial 4-4-dimethyl-C27Δ Rhodobacterial 4-4-dimethyl-C Δ8 27

y,z Une manière simple mais non officielle de nommer les stérols est la suivante : CxΔ où x représente le nombre total de carbone et y et z la position des doubles liaisons, par exemple le

5 cholesterol se notera C27Δ . Dans cet exemple seul le carbone 5 est mentioné comme ayant une double liaison, par défaut cela signifie que le deuxième carbone portant la double liaison est le carbone 6. Dans le cas du fucostérol, une double liaison se situe entre les carbones 5 et 6

82 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

5,24(28) et une seconde entre les carbones 24 et 28, le fucostérol se note alors C29Δ .

Les stérols peuvent être aussi naturellement estérifiés ou établir une liaison O-glycoside au niveau de leur groupement hydroxyle du carbone 3. En effet, des acides gras, des monosaccharides ainsi que des groupements sulfates peuvent se greffer sur le groupement alcool du carbone 3. Les méthodes appropriées pour l’analyse des stérols sont principalement la chromatographie en phase gazeuse (Bligh and Dyer 1959) sur des extraits lipidiques couplée à une analyse en spectrométrie de masse.

Diversité des stérols chez les organismes vivants

La diversité des stérols est très grande et elle est souvent utilisée comme marqueur biologique.

L’inventaire des différents stérols que l’on trouve dans la nature est illustré dans le tableau 5.

Le stérol des mammifères le plus connu est le cholestérol. Ce stérol a la particularité de ne pas posséder de double liaison au niveau de la chaîne aliphatique ainsi que de ne pas avoir de groupement alkyl sur le carbone 24. D’autres stérols d’animaux possèdent des alkylations sur le carbone 24 et d’autres insaturations que celle des carbones 5 et 6 : c’est le cas du stérol

5,22 majoritaire des spongiaires, C30Δ , qui possède un groupement isopropyl sur le carbone 24.

C’est aussi le cas de nombreux mollusques qui possèdent le 24-methylène-cholesterol (ou ergosta-5,24(28)-diène-3β-ol) comme stérol majoritaire (Fagerlund and Idler 1961). On trouve aussi des stérols alkylés sur le carbone 24 chez de nombreux invertébrés marins comme les échinodermes ou les spongiaires (Do et al. 2009; Smith, Rubinstein, and Goad

1973).

83 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

Chez la plupart des champignons étudiés, le stérol majoritaire, l’ergostérol (Hendrix 1970), possède un groupement méthyl sur le carbone 24 (Figure 10.D). Chez les champignons mycorhyziens le stérol majoritaire est le 24-ethylcholesterol (Campagnac et al. 2008) aussi appelé sitosterol qui est un stérol très abondant chez les plantes.

Parmi les stérols de plantes, on trouve une grande variabilité d’une famille de plantes à une autre (Benveniste 1986; Goad and Goodwin 1966). Les stérols les plus communs chez les plantes supérieures sont le sitostérol, le brassicastérol, le campestérol et le stigmastérol. Une grande diversité de stérols est observée chez les microorganismes marins (Volkman 2003).

Les algues vertes contiennent quasiment les mêmes stérols que les stérols de plantes

5,22 supérieures (Tableau 5). Chez les algues rouges le stérol majoritaire serait le C28Δ devant le

5,22 cholesterol (Dunstan, Brown, and Volkman 2005), le même C28Δ serait également le stérol majoritaire des diatomés, des cryptophytes et des haptophytes, tout trois membres des chromalvéolés.

C’est au sein du super-groupe des Chromalvéolés que l’on trouve la plus grande diversité de stérols. En effet, les algues brunes (Pheophyceae) synthétisent en majorité un stérol

5,24(28) particulier, C29Δ ou fucostérol en référence au genre Fucus (Goad and Goodwin 1969).

Ce stérol possède un groupement éthylène sur le carbone 24. Un autre stérol très particulier

5,24(28) est le dinostérol, C30Δ (Kaku and Hiraga 2003) qui a la particularité d’être méthylé une fois sur le cycle et deux fois sur la chaîne alphatique. Chez les algues dorées (Pelagophyceae), la distribution en stérols est très spécifique puisque le stérol majoritaire est le 24- propylidènecholestérol. Les analyses de stérols chez les oomycètes du genre Phytophthora a montré la présence, par ordre d’abondance, de cholestérol, desmostérol et de 24- methylènecholestérol (Nes and Stafford 1983).

Chez les Protistes appartenant au super groupe des excavates comme Leishmania et

5,7,24(28) Toxoplasma (Goad, Holz, and Beach 1984) les stérols majoritaires sont le C28Δ

84 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

7,24(28) (ergosta-5,7,24(28)-trien-3 beta-ol), C28Δ (ergosta-7,24(28)-dien-3 beta-ol). Alors que chez les protistes du genre Naegleria qui appartiennent également aux Excavates, les stérols

7,22 les plus abondants sont l’ergostérol ainsi qu‘un 4-méthylstérol (4-methyl-C28Δ )

(Raederstorff and Rohmer 1987). Chez les Amibes comme Dictyostelium le stérol majortaire

5,22 est le dictyosterol, C29Δ (Nes et al. 1990).

Très peu de bactéries sont connues pour synthétiser des stérols. Cependant les stérols ont pu

être identifiés chez les Mycobactériales, les Méthylobactériales, et les Planctomycétales

(Pearson, Budin, and Brocks 2003). Contrairement aux autres organismes, les stérols synthétisés chez les bactéries sont des protostérols comme le lanostérol, le parkeol (un isomère du lanostérol) et le 4-desméthylstérol ou le 4-4-diméthyméthylstérols qui sont des intermédiaires biosynthétique chez la plupart des autres organismes.

En faisant l’inventaire des stérols identifiés chez les êtres vivants, on remarque la grande diversité structurale des stérols. La présence ubiquitaire de cette molécule chez tous les eucaryotes et sa diversité sont synonymes d’un rôle biologique majeur pour la cellule.

Fonctions biologiques des stérols

Les stérols sont des composés essentiels que l’on trouve chez presque tous les eucaryotes et

également chez certains procaryotes (Lamb et al. 1998). Le cholestérol est un lipide amphiphile. Il se positionne comme intercalant et joue un rôle majeur dans la fluidité membranaire (Figure 11) (Cooper 1978). La présence de cholestérol dans la bicouche lipidique diminue la viscosité et la densité facilitant ainsi le movement de protéines dans la membrane au sein d’une même couche mais également les passages d’une couche à l’autre

(flip-flop) (Rog et al. 2009).

85 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

Figure 11 : Représentation schématique de la membrane plasmique. Le cholestérol est représenté en jaune intercalé entre les phospholipides de la bicouche. La partie hydrophile (groupement OH du carbone 3) du cholestérol est situé vers vers le cytoplasme, pour la couche interne, et vers le l’extérieur pour la couche externe. (Source encyclopédie britanica www.britanica.com)

Figure 12 : Observations microscopiques de mycélium de P. cactorum. Le mycélium est cultivé en présence de cholestérol. La présence de cholestérol dans le milieu induit la formation d’oogones (Nes and Stafford, 1983) chez P. cactorum. Les oogones sont pointés par des flèches.

86 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

L’étude de mutants de levure Saccharomyces cerevisae incapables de synthétiser de l’ergostérol, a révélé le caractère létal de certaines mutations, notament celle du mutant

ERG11 (Hendrix 1970). La létalité de ces mutations est liée à l’accumulation d’intermédiaires

biosynthétiques tels que le lanostérol qui provoque une augmentation de la viscosité membranaire (Groll, De Lucca, and Walsh 1998).

Les stérols jouent également un rôle majeur en tant que précurseurs dans la synthèse d’hormones appelées hormones stéroïdiennes ou stéroïdes (Haslewood 1939), aussi bien chez chez les plantes (brassinosteroides), chez les animaux (hormones stéroides) et chez certains oomycètes du genre Achlya (oogoniol et antheridiol). Chez ce dernier, l’hyphe femelle sécrète un stéroïde appelé anthéridiol qui est perçu par l’hyphe mâle. Ce dernier forme alors des anthéridies et secréte de l’oogoniol. (Edwards et al. 1969). Cette hormone stéroïdienne est perçue par l’hyphe femelle qui forme alors les oogonies. Par ce mécanisme hormonal, Achlya régule la réalisation de son cycle sexuel (Mullins and Ellis 1974). Parmi les autres oomycètes

étudiés, les Phytophthora et les Pythium se sont avérés incapables de synthétiser leurs propres stérols. Cependant, il est apparu que les Phytophthora sont capables de se développer sur un milieu sans stérol mais la présence de stérols comme le cholestérol dans le milieu extérieur est cependant nécessaire à la formation d’organe sexuel chez P. cactorum . Ces résultats sont illustrés sur la figure 12 (Nes and Stafford 1983).

Les Phytophthora sont connus pour fabriquer des protéines transporteurs de lipides capables de récupérer des stérols dans le milieu extérieur. Parmi les transporteurs de ces stérols, on trouve les élicitines également identifiées comme capables d’induire des réponses de défense chez le tabac (Blein et al. 2002; Ricci et al. 1989).

87 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

Figure 13 : Schématisation des voies de synthèse de stérols connues, d’après Kodner et al,. 2008. L’époxide squalène (4) est le dernier métabolite commun à toutes les voies de synthèse. La voie encadrée en vert correspond à la voie utilisée par les plantes et les organismes utilisant l’obtusifoliol comme substrat de la CYP51. Elle mène aux produit finaux comme le campéstérol (18) sitostérol (19). La voie utilisée par les champignons est encadré en bleu, elle mène à l’ergostérol (3) et passe par la fabrication de l’épistérol (11). La voie utilisée par les animaux est encadrée en jaune et mène au cholestérol (17). En marron, est encadré le stérol majoritaire des spongiaires, le

24-isopropylcholestérol (20). En rouge les trois stérols majoritaires rencontrés chez Choanoflagellés (1, 2, 3).

88 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

Voies de synthèse de stérols

Les voies de synthèse de stérols ont fait l’objet d’étude depuis plus de cinquante ans, cependant elles se sont focalisées essentiellement sur celles des animaux, des plantes et des champignons. La figure 13 représente les 3 grandes voies de synthèses étudiées. La synthèse de stérols chez les plantes passe par un intermédiaire métabolique, l’obtusifoliol. Les voies de synthèses de stérols végétaux mènent toutes à la production de 24-methylenelophenol qui est le point de départ de deux seqments biosynthétiques (Goad and Goodwin 1966). Le premier faisant intervenir une stérol methyltransférase capable de méthyler le carbone 24 de la chaîne latérale (Benveniste 1986; Nes 2000), ceci correspondant à la synthèse de 24-

éthylidènelophénol qui est ensuite métabolisé en 24-éthylstérol, comme le sitostérol ou le stigmastérol. La seconde voie de synthèse mène à la production de brassicastérol et de campestérol qui est le précurseur des hormones végétales appelées les brassinostéroïdes

(Teixeira ZulloI and Adam 2002).

La plupart des champignons produisent des stérols, dont l’ergostérol est le représentant majeur (Karst and Lacroute 1977). La synthèse de stérols chez les champignons est différente de celle rencontrée chez les plantes. L’étape de déméthylation en C14 effectuée par le cytochrome P450 de la famille 51 (CYP51) s’effectue directement après la cyclisation de l’époxide squalène, le substrat de cette enzyme étant le lanostérol (contrairement à l’obtusifoliol chez les plantes). Cependant les deux voies de synthèse (plantes et champignons) mènent toutes deux à la formation d’un même intermédiaire, l’épistérol (figure

13) (Veen and Lang 2005). L’étude de cette voie de biosynthèse fongique a été en grande partie élaborée grâce à l’analyse de mutants de levure qui sont appelés mutants ERG car déficients en ergosterol. Chez les animaux, il existe trois voies de synthèse du cholestérol. Les trois voies mènent à la production de zymostérol. Il est ensuite converti en lathosterol ou en

89 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

5α-cholesta-7,24-dien-3β-ol qui peut être alors converti en lathosterol ou en 7- dihydrodesmosterol.

Les études portant sur la voie de synthèse des stérols chez les oomycètes ont été menées sur

Phytophthora et certains stérols ont été identifiés. A la suite du séquençage du génome de

Phytophthora, l’absence de CYP51, enzyme clé dans la voie de synthèse, a été mis en

évidence (Tyler et al. 2006). La voie de synthèse qui avait été proposée pour les Phytophthora

(Warner et al. 1982) n’est pas appuyée par les analyses génomiques.

Suite à l’identification in silico de gènes impliqués dans la synthèse de stérols chez

A. euteiches, la caractérisation des stérols fabriqués par le parasite a été engagée.

L’identification d'une enzyme CYP51 chez A. euteiches nous a conduit à rechercher l'effet de

Demethylase Inhibitors (DMIs) couramment utilisées en tant que fongicides en agriculture, sur la croissance d'A. euteich es et l'accumulation d'intermédiaires biosynthétiques. En effet, la majorité des fongicides sont des inhibiteurs de la voie de synthèse des stérols (Barrett-Bee and Dixon 1995) qui vont spécifiquement inhiber l'étape de déméthylation catalysée par la

CYP51 (aussi appelé ERG11 chez la levure). Dans l’hypothèse de leur efficacité, ces inhibiteurs pourraient également constituer un moyen de lutte contre A. euteiches.

Une étude phylogénique des séquences protéiques d’enzyme comme la CYP51 identifirait l’origine d’une voie de synthèse des stérols chez A. euteiches. L’ensemble des cas travaux est présenté sous la forme d’un article actuellement soumis pour publication.

90 Research

BlackwellOxford,NPHNew0028-646X1469-8137©289510.1111/j.1469-8137.2009.02895.xMay00291???300???Rapid The 2009Phytologistreport reportAuthors UK Publishing (2009). Ltd Journal compilation © New Phytologist (2009) Rapid reportRapid report Sterol metabolism in the oomycete Aphanomyces euteiches, a legume root pathogen

Author for correspondence: Mohammed-Amine Madoui1,2, Justine Bertrand-Michel3, Elodie Gaulin1,2* Bernard Dumas and Bernard Dumas1,2* Tel.: +33 (0) 5 62 19 35 03 Email: [email protected] 1Université de Toulouse, UPS, Surfaces Cellulaires et Signalisation chez les Végétaux, 24 chemin 2 Received: 3 March 2009 de Borde Rouge, BP42617, Auzeville, F-31326, Castanet-Tolosan, France; CNRS, Surfaces Accepted: 30 April 2009 Cellulaires et Signalisation chez les Végétaux, 24 chemin de Borde Rouge, BP42617, Auzeville, F-31326, Castanet-Tolosan, France; 3INSERM, Institut Claude de Préval, IFR30, Plateau technique de Lipidomique, Toulouse, F-31300, France

Summary

New Phytologist (2009) 183: 291–300 • Sterols are isoprenoid-derived molecules that have essential functions in eukaryotes doi: 10.1111/j.1469-8137.2009.02895.x but whose metabolism remains largely unknown in a large number of organisms. Oomycetes are fungus-like microorganisms that are evolutionarily related to Key words: isoprenoids, legumes, lipids, stramenopile algae, a large group of organisms for which no sterol metabolic Medicago, oomycete, soil pathogen, pathway has been reported. Here, we present data that support a model of sterol Stramenopila. biosynthesis in Aphanomyces euteiches, an oomycete species causing devastating diseases in legume crops. • In silico analyses were performed to identify genes encoding enzymes involved in the conversion of the isoprenoid precursor 3-hydroxy-3-methylglutaryl coenzyme A to isoprenoids. Several metabolic intermediates and two major sterol end-products were identified by gas chromatography–mass spectroscopy. • We show that A. euteiches is able to produce fucosterol (a sterol initially identified in brown algae) and cholesterol (the major animal sterol). Mycelium development is inhibited by two sterol demethylase inhibitors used as fungicides, namely tebuconazole and epoxiconazole. • We propose the first sterol biosynthetic pathway identified in a stramenopile species. Phylogenetic analyses revealed close relationships between A. euteiches enzyme sequences and those found in stramenopile algae, suggesting that part of this pathway could be conserved in the Stramenopila kingdom.

2000). They fall within the kingdom Straminopila, which Introduction contains saprophytic marine organisms such as diatoms and Oomycetes are fungal-like eukaryotic microorganisms brown algae (Baldauf et al., 2000). Most oomycete pathogens that are widely considered as major threats for agriculture are classified into two groups: the Peronosporales, comprising and natural ecosystems. Phylogenetic studies have shown that the potato Irish famine pathogen Phytophthora infestans oomycetes are distantly related to true fungi (Baldauf et al., and the grape downy mildew pathogen Plasmopara viticola; and the Saprolegniales, in which most animal pathogenic *These authors contributed equally to this work. oomycetes are found (Dick et al., 1999; Riethmueller et al.,

No claim to original French government works New Phytologist (2009) 183: 291–300 291 Journal compilation © New Phytologist (2009) www.newphytologist.org 291 292 Research Rapid report

2002). This latter group includes devastating pathogens of major sterols and some of their intermediates. Finally, results aquatic organisms, fish and crustaceans (Phillips et al., 2008). showing that the sterol pathway could be an efficient target True fungi and oomycetes being phylogenically distinct, as for controlling Saprolegniale pathogens are also provided. a result, most fungicides used in medicine and agriculture are ineffective in the treatment of plant and animal disease Materials and Methods caused by oomycete pathogens. This is particularly the case for molecules targeting enzymes involved in sterol synthesis. This Strains, media and culture conditions class of fungicides is represented by triazoles, the most important class of fungicides, which target a sterol-demethylation step A. euteiches strain ATCC201684 is a Danish pea isolate that catalyzed by the CYP51 group of cytochrome P450 enzymes was kindly provided by Dr F. Krajinski (Hannover University, (Lamb et al., 1999; Odds et al., 2003). Phytophthora sp. and Germany). A. euteiches was maintained on 1.7% corn meal agar other oomycete species are sterol auxotrophs (Marshall et al., (CMA; Sigma-Aldrich) by routine subculture in the dark at 2001), and accordingly lack functional CYP51 genes in their 24°C. For long-term storage, mycelium explants were kept under genome (Tyler et al., 2006). sterilized source water (Volvic®; France) at 15°C in the dark. As sterols are essential for mycelial development and Zoospores were obtained as previously described (Badreddine reproduction, sterol auxotrophic oomycetes must acquire et al., 2008). Briefly, 20 mycelium explants were transferred from sterol precursors from their host during infection. A large a 10–15-d-old CMA plate to an Erlenmeyer flask containing family of extracellular proteins that are structurally related to 50 ml of sterile peptone glucose (PG) broth (peptone, 20 g l−1; lipid transfer proteins and are specifically found in oomycetes glucose, 5 g l−1) and incubated for 3 d in the dark. The PG play a major role as sterol transporters during infection. These broth was then removed under sterile conditions and the proteins were named elicitins because they were initially mycelial mats were rinsed twice for 2 h, and once for 16–20 h, characterized for their high plant defence-eliciting activity with 30 ml of sterilized source water. Motile zoospores were (Blein et al., 2002). Elicitins are widespread in Phytophthora counted using a Malassez haemocytometer and diluted with species and the closely related Pythium species but are absent distilled water to the concentration required for the various from any other organism studied so far, leading to the hypothesis experiments. To measure the effect of triazoles on A. euteiches, that the expansion of a large elicitin gene family originated PG medium containing 10 mg l−1 of triazoles were distributed from the requirement of oomycete organisms to acquire into the wells of a 96-well microtiter plate (100 µl per well) exogenous sterols from their environment (Vauthrin et al., and subsequently inoculated with 5000 zoospores per well. 1999; Jiang et al., 2006). Eight replicates were prepared for each condition. The plates Aphanomyces euteiches Drechs. is a soil-borne oomycete were incubated in the dark at 24°C for 5 d and the hyphal pathogen belonging to the Saprolegniales, which causes severe density was determined by measuring the optical density root rot of several legumes, including pea, common bean and (OD) at 595 nm. For some conditions, the medium was alfalfa (Gaulin et al., 2007). The Aphanomyces genus includes supplemented with β−sitosterol (Sigma) at 20 mg l−1. animal pathogens that are involved in serious outbreaks in the aquatic environment. Aphanomyces invadans has been reported Statistical analyses to be implicated in ulcerative mycosis affecting both wild and farmed fish, often leading to mass mortality (Vandersea et al., Inhibition bioassay data analyses were performed using R 2006). Aphanomyces astaci, originating from America, is the 2.8.1 language and environment (R Core Team, 2008). The causative agent of crayfish plague that repeatedly devastated effects of three biological replicates and six treatments (sterols European populations of freshwater crayfish (Söderhäll & or/and inhibitors) on mycelial growth (measured by the Cerenius, 1999). This parasite is now considered to be among OD) were evaluated using a two-way ANOVA. The residue the 100 most harmful invading species (Global Invasive distribution values were tested for normality using the Shapiro– Species Database, http://www.issg.org/database/). Wilk test (P > 0.05) and also by a graphical view of the residue Recently, a large expressed sequence tag (EST) collection distributions on a Q-Q plot (data not shown). The variance was developed on A. euteiches (Madoui et al., 2007). Comparative homogeneity of the residue values was tested using Levene’s analyses revealed that most A. euteiches genes absent in test (P > 0.05). To compare each treatment with each other, Phytophthora sojae and Phytophthora ramorum were predicted the treatment significancy effect was tested using the Tukey to be involved in sterol biosynthesis (Gaulin et al., 2008). As honestly significant difference method (P > 0.05). no sterol biosynthetic pathway was described for any oomycete, we undertook the characterization of sterol metabolism in Rapid amplification of cDNA ends–polymerase chain A. euteiches. Initially, genes involved in sterol biosynthesis reaction were detected through data mining, using AphanoDB, a database for A. euteiches ESTs (Madoui et al., 2007). Specific primers were designed from ESTs available in the Then, biochemical analyses were performed to identify AphanoDB databank. 5′-Rapid amplification of cDNA ends

New Phytologist (2009) 183: 291–300 No claim to original French government works www.newphytologist.org Journal compilation © New Phytologist (2009) Rapid report Research 293

(RACE) was performed using the Invitrogen GeneRacer Kit. Total proteins were measured by Bradford using the Bio- Gene-specific primers for 5′-RACE were designed using Rad protein assay kit (CA, USA). The dried lipid extracts unigene sequences available in AphanoDB: Ae_5AL7244 for were submitted to alkaline hydrolysis treatment in 0.1 N AeCYP51. 5′-RACE on AeCYP51 was performed using the methanolic KOH (1.5 ml) for 1 h at 60°C, and then water gene-specific primer ATAGGTTCGGAGCGACGTACG-c was added (1 ml). Sterols were extracted three times with and the nested gene-specific primer TCCAGGGCCGAA- hexane (2 ml) and evaporated to dryness. Sterols were CACTGGCGTCATA. 5′-RACE on AeSMT was performed silylated in N,O-Bis(trimethylsilyl)trifluoroacetamide (1% using the gene-specific primer CAAGGGCAGCAGC- trimethylchlorosilane-pyridine) (80 µl, 1 : 1, v/v) for 1 h at GATGGCACCC and the nested gene-specific primer 55°C. The products (1 µl) were directly analyzed using GCAGCGACTGAGTAGAAGATCGCC. gas–liquid chromatography on a 5890 Hewlett Packard system using RTX-50 fused silica capillary columns (30 m × 0.32 µm internal diameter, 0.1 µm film thickness, Bioinformatics analyses Restek, Lisses, France). The oven temperature was programmed Data mining of Aphanomyces sequences was performed using from 180 to 225°C (1 min), at a rate of 0.5°C min−1, and AphanoDB (Madoui et al., 2007). CYP51 sequences were the carrier gas was hydrogen (0.5 bar). The injector and the obtained from the NCBI (National Center for Biotechnology detector were at temperatures of 260°C and 300°C, respectively. Information, http://www.ncbi.nlm.nih.gov/) and the databases The sterol structures were checked by gas chromatography– dedicated to genome sequences of the corresponding organisms. mass spectrometry (GC-MS) with silylated fraction analysis, For diatoms and brown algae sterol methyl transferase (SMT) using a Trace Thermo finnigan gas chromatograph sequences, the gene prediction on their genomes was performed (Thermo Scientific, Waltham, MA, USA), equipped with locally using the fgenesh+ algorithm (Salamov & Solovyev, a programmed vaporization injection system (PTV), in 2000). Multiple alignments were performed by ClustalW combination with a Quadripole Thermo Finnigan Mass V2.0 (Larkin et al., 2007) using the PAM weight matrix. For detector and a Varian (Varian Inc, Palo Alto, CA, USA) CYP51, sequences corresponding to the IPR001128 cytochrome fused-silica capillary column FACTOR FOUR VF-17 ms P450 domain were used for alignment. For SMTs, alignment (30 m, 0.25 mm internal diameter, 0.15 µm film thickness). was performed on the concatenation of the IPR013216 The temperature in the injector was 50–260°C for the methyltransferase type 11 and the IPR013705 sterol transfer phase. The oven temperature was programmed from methyltransferase c-terminal domains. We used mrbayes 230 to 280°C (2 min) at a rate of 1°C min−1 with a helium 3.1 (Huelsenbeck et al., 2001) to infer phylogenetic trees constant pressure of 50 kPa. The electroionization–mass from protein alignments. For bayesian trees inference, the spectrometry (EI-MS) conditions used were an ionization approximation of clade posterior probabilities is allowed by voltage of 70 eV, an ion current of 150 µA and an ion source the Metropolis-coupled Markov chain Monte Carlo (or MC3) temperature of 250°C. algorithm of MrBayes that runs multiple Markov chains. For CYP51 and SMT trees, a run with two chains (one cold Results chain and one heated chain) was performed for 100 000 generations under a Whelan and Golding amino acid Identification of A. euteiches sterol biosynthetic genes substitution matrix model (Whelan & Goldman, 2001). The burnin gave a convergence diagnostic of < 0.01 for the Data mining of a large collection of A. euteiches ESTs (Madoui CYP51 tree and of < 0.001 for the SMT tree. The customized et al., 2007) led to the identification of 10 unigenes tree was drawn using mega 3.1 (Kumar et al., 2004) from the (putatively involved in the biosynthesis of isoprenoids), newick output file of MrBayes. For the CYP51s analysis, the from the precursor 3-hydroxy-3-methylglutaryl coenzyme A tree was rooted by the Methylococcus CYP51 sequence. For (HMG-CoA) (Table 1). As expected, no ortholog for these the SMTs, the tree was rooted by the Arabidopsis SMT1. genes was found in other oomycete species (Phytophthora sp., Hyaloperonospora arabidopsidis), except for a sequence encoding a putative Δ7 sterol reductase (Table 1). Mining Sterol analyses of a Saprolegnia parasitica EST collection (Torto-Alalibo et al., Sterol was extracted from fresh A. euteiches mycelium. After 2005) did not give a positive result, indicating that sterol homogenization in methanol/5 mM EGTA (3 ml, 2 : 1, v/v) genes are missing from this collection. Data mining on the with FAST-PREP (MP BioMedicals, Solon, CA, USA), two fully sequenced diatom genomes, Thalassiosira pseudonana lipids (corresponding to 400 mg of dry mycelium) were extracted (Armbrust et al., 2004) and Phaeodactylum tricornutum according to Bligh & Dyer (1959) in chloroform/methanol/ (Bowler et al., 2008) allowed the identification of orthologous water (2.5 : 2.5 : 2.1, v/v/v) with 5αcholestane (5 µg) as the genes for most of the enzymatic steps, except for the squalene internal standard. Aliquots (100 µl) were evaporated and dry epoxidase, the Δ4 methyl sterol oxidase and the Δ24 sterol pellets were dissolved in 0.25 ml of NaOH (0.1 m) overnight. reductase (Table 1).

No claim to original French government works New Phytologist (2009) 183: 291–300 Journal compilation © New Phytologist (2009) www.newphytologist.org 294 Research Rapid report

Table 1 Aphanomyces euteiches sequences involved in sterol biosynthesis

GenBank Accession Id/Sim Id/Sim accession number Best-hit SwissProt Best-hit organism number Id/Sim (%) e-value P. so j a e (%) P. tricornutum (%)

CU360127 HMG-CoA reductase Gossypium hirsutum O64967 52/69 3e-117 ND NA 16 870 58/73 CAQ55982 Squalene synthase Rattus norvegicus Q02769 43/60 7e-67 ND NA 36 291 54/70 CAQ55983 Squalene epoxidase Panax ginseng O48651 43/55 2e-70 ND NA ND NA CAQ55984 Oxidosqualene cyclase Dictyostelium discoideum Q55D85 47/63 1e-152 ND NA 13 507 44/60 CAQ55977 14α-demethylase (CYP51) Sorghum bicolor P93846 43/60 8e-104 ND NA 41 566 49/61 CAQ55985 Δ14 sterol reductase Mus musculus Q71KT5 53/68 6e-77 ND NA 42 205 64/74 CAQ55986 Δ4 methyl oxydase Sus scrofa Q6UGB2 50/67 3e-69 ND NA ND NA CAQ55978 Δ24 methyltransferase Oryza sativa Q6ZIX2 46/64 2e-85 ND NA 33 870 49/79 CAQ55988 Δ24 reductase Tribolium castaneum Q15392 56/75 1e-123 ND NA ND NA CAQ55987 Δ7 reductase Arabidopsis thaliana Q9LDU6 57/70 8e-93 127861 73/83 23 338 55/64

GenBank accession numbers of A. euteiches sequences encoding putative sterol biosynthesis enzymes are indicated in the first column. Each sequence was blasted using the BLASTP program to the Swiss Prot database and to the proteomes of Phytophthora sojae (oomycete) and Phaeodactylum tricornutum (diatom). The accession or identity numbers for the best hits are indicated as well as the percentages of identity and similarity (Id/Sim %). HMG-CoA, 3-hydroxy-3-methylglutaryl coenzyme A; NA, not applicable; ND, not determined.

tebuconazole, inhibits growth (Tukey test, P < 0.05) at a final concentration of 10 mg l−1 (Fig. 1), corresponding to the concentration used for the inhibition of growth of true fungi. The effect of the inhibitors was partially reversed by the addition of β-sitosterol (Tukey test, P < 0.05), confirming the specific effect of these chemicals on sterol biosynthesis.

Fucosterol and cholesterol are synthesized through the production of lanosterol Sterol composition in A. euteiches mycelia grown in sterol-free media was analysed using gas–liquid chromatography (Fig. 2). Fucosterol (70%) and, to a lesser extent, cholesterol (15%) were identified as the two major sterols. Identification of these Fig. 1 Effect of sterol biosynthesis inhibitors on Aphanomyces growth. Aphanomyces euteiches zoospores were incubated in wells sterols was established by comparison with the mass spectra of enzyme-linked immunosorbent assay (ELISA) plates containing of true standards. Two cholesterol precursors – lathosterol and a sterol-free medium as control, a β-sitosterol-containing medium 7-dehydrocholesterol – were also identified as well as a small or a triazole-containing medium (tebuconazole or epoxiconazole, amount of lanosterol (2% of the total sterol extract). respectively), as indicated, and the optical density (OD) was Lanosterol is a substrate for animal and fungal CYP51 measured at 595 nm. The SD was calculated using three biological replicates and statistical analyses were performed as described in the enzymes, whereas plant enzymes use obtusifoliol. It has been Materials and Methods section. shown that substrate preference is linked to the amino acid sequence of an essential recognition site (the B’ helix) present in the N-terminal region of CYP51 enzymes (Gotoh, 1992; Lepesheva et al., 2006). Alignment of the AeCYP51 B’ helix A euteiches growth is inhibited by specific sterol with 44 CYP51 sequences from plant, animal, fungi, trypano- inhibitors somatids and bacteria revealed the presence of a Leu residue To test whether A. euteiches was indeed able to synthesize its (Leu114) that is also present in all the enzymes using own sterols, mycelial growth was quantified in sterol-free lanosterol as a substrate, whereas in plant enzymes a Phe media and in media supplemented with a mix of plant sterols residue is present at that position (Supporting Information (sitosterol, stigmasterol and campesterol). No significant Fig. S1). difference (Tukey test, P > 0.05) on mycelial development To determine the effect of azole inhibitors on sterol was observed between the two types of media (Fig. 1). The composition, A. euteiches mycelia were grown for 5 d on addition of molecules known to inhibit the demethylation sterol-free media and transferred to a medium containing step catalyzed by the CYP51 enzymes, epoxiconazole and tebuconazole. Analysis of the sterol composition showed

New Phytologist (2009) 183: 291–300 No claim to original French government works www.newphytologist.org Journal compilation © New Phytologist (2009) Rapid report Research 295

Fig. 2 Identification of Aphanomyces sterols by gas–liquid chromatography and mass spectrometry. Sterols were extracted from Aphanomyces euteiches mycelia cultivated in the absence (Control) or the presence of the CYP51 enzyme inhibitor tebuconazole (10 mg l−1). Tebuconazole was added after 5 d of growth on a sterol-free medium and the mycelia were harvested 2 d after addition of the inhibitor. (a) The gas chromatography– mass spectrometry (GC-MS) profile of A. euteiches. Sterols were separated and analysed as described in the Materials and Method section. The positions corresponding to fucosterol and cholesterol are indicated, as well as the metabolic intermediates, lathosterol and lanosterol (IS, internal standard). Sterols were identified by MS using the corresponding standards. The formula of fucosterol is shown. (b) Identification of A. euteiches sterols by GC-MS. The bar chart illustrates the percentage of different sterols identified by GC-MS. The control (black bars) corresponds to the sterol content of mycelia grown for 7 d on a sterol-free medium. The tebuconazole-treated condition (grey bars) corresponds to the sterol content of mycelia grown for 5 d on a sterol-free medium and then for 2 d on a sterol-free medium containing 10 mg l−1 of tebuconazole. The SD was calculated using two biological replicates. that this treatment led to an accumulation of lanosterol and a Sterol biosynthesis in A. euteiches: an evolutionary significant decrease of the end sterols fucosterol and cholesterol perspective (Fig. 2a). Quantification of these products confirmed the dramatic increase of the amount of lanosterol obtained in The demethylation step catalyzed by CYP51 enzymes has mycelium treated with tebuconazole, reaching c. 50% of total been found in all biological kingdoms (Lepesheva & sterols (Fig. 2b). Waterman, 2007) because it is a key step in sterol biosynthesis. From this inhibition assay and in silico analyses, we CYP51 enzymes are thus particularly well-suited for use in concluded that lanosterol is the major substrate of the phylogenetic analyses. We used a protein sequence derived A. euteiches CYP51, leading to the demethylated product from a full-length complete cDNA of a putative A. euteiches 4,4-dimethylcholesta-8,14,24-trienol. sterol demethylase CYP51 (CAQ55977; AeCYP51), obtained

No claim to original French government works New Phytologist (2009) 183: 291–300 Journal compilation © New Phytologist (2009) www.newphytologist.org 296 Research Rapid report

Fig. 3 The phylogenetic tree of CYP51 and sterol methyl transferase (SMT) proteins. Full protein sequences of different kingdoms were aligned using CLUSTALW2 and the trees were inferred using the Bayesian method (MrBayes; Huelsenbeck et al., 2001); values above the nodes are clades posterior probabilities. The CYP51 tree (a) was rooted by specifying the Methylococcus capsulatus CYP51 sequence as an outgroup. The SMT tree (b) was rooted by the Arabidopsis SMT1 sequence.

by RACE-PCR, to align the deduced protein sequence to Plant and fungal sterols differed from mammalian sterols CYP51 sequences from Stramenopiles, plants, animals and by the presence of an extra alkyl group at C24 (Schäller, 2003) fungi (Fig. S2). The phylogenetic tree (Fig. 3a) shows that and the addition of alkyl groups is catalyzed by sterol methyl AeCYP51 clustered with sequences from brown algae transferases. Because the addition of an ethyl group at C24 is (Ectocarpus siliculosus) and diatoms (P. tricornutum). This result required to synthesize fucosterol, an SMT sequence was indicates that AeCYP51 evolved from a common Straminopila studied in more detail. The complete sequence of an SMT ancestor CYP51 gene. (CAQ55978; AeSMT) was obtained by RACE-PCR. By

New Phytologist (2009) 183: 291–300 No claim to original French government works www.newphytologist.org Journal compilation © New Phytologist (2009) Rapid report Research 297 contrast to SMT found in plants, yeast or fungi, tmhmm major target for developing molecules affecting this pathway searches on AeSMT revealed the presence of two transmem- (Waterman & Lepesheva, 2005). brane domains located in the N-terminus of the protein (data A first branch of the A. euteiches sterol pathway leads to the not shown). Transmembrane domains were also detected in production of cholesterol, probably through the production the SMTs of the diatom T. pseudonana. A phylogenetic tree of zymosterol. This part of the pathway is supported by the inferred with AeSMT and SMT sequences from plant, fungi identification of cholesterol as one of the major end-sterols, a and trypanosomatid parasites showed that the Stramenopiles finding supported by the identification of two metabolic SMTs form a monophyletic group (Fig. 3b). Two regions intermediates (lathosterol and 7-dehydrocholesterol) and by involved in sterol and S-adenosyl methionine binding are the identification of a sequence encoding a putative dehydro- conserved in the AeSMT sequence, and alignment with other cholesterol Δ24 sterol reductase with strong similarities to SMTs shows stronger homology to fungal SMTs than to an insect sequence (Tribolium castaneum) and other animal plant SMTs, supporting the hypothesis that AeSMT is able to sequences. This enzyme catalyzes the formation of 5α-cholest- methylate zymosterol to produce fecosterol (Fig. S3) in order 8-en-3β-ol from zymosterol, namely the first step of the to obtain fucosterol. conversion of zymosterol to cholesterol. No ortholog of this gene was detected in the diatom P. tricornutum (Table 1) or by mining the draft of the E. silicolosus genome sequence. Thus, Discussion the branch leading to cholesterol in A. euteiches may be absent The sterol biosynthesis pathway described here is the first in diatoms and brown algae. Accordingly, only trace amounts oomycete sterol pathway characterized. Integration of genomic of cholesterol were detected in diatoms (Cvejic & Rohmer, and biochemical analyses allowed us to propose an A. euteiches 2000). Additionally, this branch of the pathway can be sterol pathway (Fig. 4) that shows several homologies to involved in specific oomycete steroid hormones because it is sterol biosynthesis in animals and protozoa and provides known that these organisms need steroid compounds to novel insights into the evolution of Stramenopiles. induce sexual and asexual reproduction (Riehl & Toft, 1985). The identification of an HMG-CoA reductase sequence A second branch involves an enzymatic step catalyzed by a suggests that synthesis of isoprenoid compounds occurs via Δ24 sterol methyltransferase (AeSMT) leading to the major the mevalonate route, leading to the synthesis of isopentenyl product, fucosterol. Sterols with an alkyl substitution at C24 phosphate. It has been recently shown that isopentenyl are present in plant, fungal and parasitic protozoa, but absent phosphate can also be synthesized by a nonmevalonate route in animals (Bouvier-Nave et al., 1998; Diener et al., 2000; in diatoms (Massé et al., 2004); however, this alternative Roberts et al., 2003). In higher plants, the presence of pathway is preferentially used for nonsterol metabolites such 24-ethyl sterols results from two distinct methyl transfers as terpenoids or chloroplastic isoprenoids in higher plants and from S-adenosyl-l-methionine. It is generally assumed green algae (Lichtenthaler et al., 1997), and is thus unlikely to that cycloartenol is the substrate of the first methylation occur in A. euteiches. reaction, resulting in 24-methylene cycloartenol, whereas 24- A key step in the production of sterols is the demethylation methylenelophenol is the preferred substrate for the second reaction catalyzed by CYP51 enzymes. The 14α-demethylated methylation reaction, resulting in 24-ethylidene lophenol. In products of the CYP51-catalyzed reaction are intermediates in Saccharomyces cerevisiae, the methyltransferase catalyzes the the pathway leading to cholesterol in animals, ergosterol in transfer of the methyl group from S-adenosyl-l-methionine, fungi and a variety of 24-alkylated sterols in plants, algae and converting zymosterol to fecosterol. As zymosterol is a precursor protozoa. The preferred substrate of animal and fungal of cholesterol, we favour the hypothesis that fucosterol is CYP51 enzymes is the C4-double methylated intermediate synthesized through the production of fecosterol resulting lanosterol, whereas plant CYP51 enzymes demethylate from the methylation of zymosterol. This hypothesis is preferentially the C4-monomethylated substrate obtusifoliol. strengthened by the homology of AeSMT to fungal SMT. The biochemical and molecular evidence presented here Further studies are needed to firmly identify the substrate strongly support lanosterol as a substrate for an A. euteiches used by this enzyme and to clarify the possibility that the two sterol demethylase and an intermediate in fucosterol biosyn- methylation steps required to obtain the C24-ethyl group thesis because (1) addition of a specific demethylase inhibitor present in fucosterol can be catalyzed by a single enzyme. led to a dramatic increase of lanosterol in A. euteiches mycelium Phylogenetic analyses using CYP51 and sterol methyltrans- and (2) the A. euteiches CYP51 sequence shows specific ferase sequences strongly support the presence of the sterol amino acid residues involved in lanosterol substrate specificity pathway very early in the evolution of Stramenopiles. The and that are also found in animal and fungal enzymes. A. euteiches sterol pathway displays similarities to those Identification of a CYP51 enzyme in A. euteiches has several found in diatoms, but the final sterol composition could be important implications in terms of evolution of the sterol different in these organisms. Epibrassicasterol was found to biosynthesis pathway and potential development of anti- be the major sterol in the diatom P. tricornutum (Cvejic & oomycete chemicals because CYP51 enzymes are the Rohmer, 2000), whereas fucosterol is the major end sterol

No claim to original French government works New Phytologist (2009) 183: 291–300 Journal compilation © New Phytologist (2009) www.newphytologist.org 298 Research Rapid report

Fig. 4 An oomycete sterol biosynthetic pathway. Genes encoding sterol biosynthetic enzymes detected in Aphanomyces euteiches are indicated in italic and bold characters. Sterols identified by gas chromatography– mass spectrometry (GC-MS) are on a grey background. Orthologous sequences detected in the diatom Phaeodactylum tricornutum are indicated with dots, and genes present in metazoan genomes are shown with squares. The demethylation step inhibited by azole fungicides is indicated.

found in A. euteiches. This stramenopile sterol pathway processes has been recently observed in parasitic species was probably lost in plant pathogenic oomycetes, such as belonging to the chromoalveolates, a large group of organisms Phytophthora sp., during a transition to a parasitic lifestyle. that includes the parasitic apicomplexans, the plastid-less A massive loss of genes playing a role in basic metabolic ciliates, the dinoflagellate algae and the stramenopiles

New Phytologist (2009) 183: 291–300 No claim to original French government works www.newphytologist.org Journal compilation © New Phytologist (2009) Rapid report Research 299

(Martens et al., 2008). This loss was probably compensated division of the Saprolegniaceae sensu lato into the Leptolegniaceae and by the expansion of the elicitin or elicitin-like genes in parasitic Saprolegniaceae. Mycological Research 103: 1119–1125. oomycete genomes (Jiang et al., 2006). It has been proposed Diener AC, Li H, Zhou W, Whoriskey WJ, Nes WD, Fink GR. 2000. Sterol methyltransferase 1 controls the level of cholesterol in plants. that these extracellular proteins can play a role of sterol The Plant Cell 12: 853–870. transporters (Blein et al., 2002). In accordance with the Gaulin E, Jacquet C, Bottin A, Dumas B. 2007. Root rot disease of legumes ability of A. euteiches to synthesize its own sterols, only one caused by Aphanomyces euteiches. Molecular Plant Pathology 8: 539–548. very divergent elicitin gene was found in the A. euteiches Gaulin E, Madoui MA, Bottin A, Jacquet C, Mathé C, Couloux A, Wincker transcriptomes (Gaulin et al., 2008). However, inhibition P, Dumas B. 2008. Transcriptome of Aphanomyces euteiches: new oomycete putative pathogenicity factors and metabolic pathways. of sterol biosynthesis in A. euteiches by a CYP51 inhibitor PLoS ONE 3: e1723. can be partially complemented by added plant sterols in the Gotoh O. 1992. Substrate recognition sites in cytochrome P450 family 2 growth medium, suggesting that A. euteiches is also able to (CYP2) proteins inferred from comparative analyses of amino acid and acquire and to metabolize exogenous sterols. Further studies coding nucleotide sequences. The Journal of Biological Chemistry 267: will aim to clarify this point, which will be of primary 83–90. Huelsenbeck JP, Ronquist F, Nielsen R, Bollback JP. 2001. Bayesian importance for the effect of specific sterol inhibitors on inference of phylogeny and its impact on evolutionary biology. Science plant infection. 294: 2310–2314. Jiang RH, Tyler BM, Whisson SC, Hardham AR, Govers F. 2006. Ancient origin of elicitin gene clusters in Phytophthora genomes. Molecular Biology Acknowledgements of Evolution 23: 338–351. M.-A. M. was supported by a predoctoral fellowship from the Kumar S, Tamura K, Nei M. 2004. MEGA3: Integrated software for molecular evolutionary genetics analysis and sequence alignment. Centre National de la Recherche Scientifique (CNRS). Bioinformatics 5: 150–163 We thank Hubert Schaller (IBMP-CNRS Strasbourg, France) Lamb D, Kelly D, Kelly S. 1999. Molecular aspects of azole antifungal action for helpful discussions, Marc Cock (Roscoff, France) for and resistance. Drug Resistance Update 2: 390–402. access to unpublished Ectocarpus siliculosus genomic data and Larkin MA, Blackshields G, Brown NP, Chenna R, McGettigan PA, Marie-Pascale Latorse (Bayer CropScience, France) for the McWilliam H, Valentin F, Wallace IM, Wilm A, Lopez R et al. 2007. Clustal W and Clustal X version 2.0. Bioinformatics. generous gift of demethylase inhibitors. 23: 2947–2948. Lepesheva GI, Waterman MR. 2007. Sterol 14α-demethylase cytochrome References P450 (CYP51), a P450 in all biological kingdoms. Biochimistry and Biophysical Acta 1770: 467–477. Armbrust EV, Berges JA, Bowler C, Green BR, Martinez D, Putnam NH, Lepesheva GI, Zaitseva NG, Nes WD, Zhou W, Arase M, Liu J, Hill GC, Zhou S, Allen AE, Apt KE, Bechner M et al. 2004. The genome of the Waterman MR. 2006. CYP51 from Trypanosoma cruzi: a phyla-specific diatom Thalassiosira pseudonana: ecology, evolution, and metabolism. residue in the B’ helix defines substrate preferences of sterol Science 306: 79–86. 14α-demethylase. The Journal of Biological Chemistry 281: 3577–3585. Badreddine I, Lafitte C, Heux L, Skandalis N, Spanou Z, Martinez Y, Lichtenthaler HK, Schwender J, Disch A, Rohmer M. 1997. Esquerré-Tugayé MT, Bulone V, Dumas B, Bottin A. 2008. Cell wall Biosynthesis of isoprenoids in higher plant chloroplasts proceeds via a chitosaccharides are essential components and exposed patterns of the mevalonate-independent pathway. FEBS Letters 400: 271–274. phytopathogenic oomycete Aphanomyces euteiches. Eukaryotic Cell 7: Madoui MA, Gaulin E, Mathé C, San Clemente H, Couloux A, Wincker 1980–1993. P, Dumas B. 2007. AphanoDB: a genomic resource for Aphanomyces Baldauf SL, Roger AJ, Wenk-Siefert I, Doolittle WF. 2000. pathogens. BMC Genomics 8: 471. A kingdom-level phylogeny of eukaryotes based on combined protein Marshall JA, Dennis AL, Kumazawa T, Haynes AM, Nes WD. 2001. data. Science 290: 972–977. Soybean sterol composition and utilization by Phytophthora sojae. Blein JP, Coutos-Thevenot P, Marion D, Ponchet M. 2002. From elicitins Phytochemistry 58: 423–428. to lipid-transfer proteins: a new insight in cell signalling involved in plant Martens C, Vandepoele K, Van de Peer Y. 2008. Whole-genome analysis defence mechanisms. Trends in Plant Science 7: 293–296. reveals molecular innovations and evolutionary transitions in Bligh EG, Dyer WJ. 1959. A rapid method of total lipid extraction and chromalveolate species. Proceedings of the National Academy of Sciences, purification. Canadian Journal of Biochemistry and Physiology 37: 911–917. USA 105: 3427–3432. Bouvier-Nave P, Husselstein T, Benveniste P. 1998. Two families of sterol Massé G, Belt ST, Rowland SJ, Rohmer M. 2004. Isoprenoid biosynthesis methyltransferases are involved in the first and the second methylation in the diatoms Rhizosolenia setigera (brightwell) and Haslea ostrearia steps of plant sterol biosynthesis. European Journal of Biochemistry 256: (simonsen). Proceedings of the National Academy of Sciences, USA 101: 88–96. 4413–4418. Bowler C, Allen AE, Badger JH, Grimwood J, Jabbari K, Kuo A, Maheswari Odds FC, Brown AJ, Gow NA. 2003. Antifungal agents: mechanisms of U, Martens C, Maumus F, Otillar RP et al. 2008. The Phaeodactylum action. Trends in Microbiology 11: 272–279. genome reveals the evolutionary history of diatom genomes. Nature. 456: Phillips AJ, Anderson VL, Robertson EJ, Secombes CJ, van West P. 2008. 239–244. New insights into animal pathogenic oomycetes. Trends in Microbiology

Cvejic JH, Rohmer M. 2000. CO2 as main carbon source for 16: 13–19. isoprenoid biosynthesis via the mevalonate-independent methylerythritol R Core Team. 2008. R: A language and environment for statistical 4-phosphate route in the marine diatoms Phaeodactylum tricornutum and computing. R Foundation for Statistical Computing. Available from Nitzschia ovalis. Phytochemistry 53: 21–28. http://www.r-project.org. Dick M, Vick M, Gibbings J, Hedderson T, Lopez-Lastra C. 1999. 18s Riehl RM, Toft DO. 1985. Effect of culture medium composition on rDNA for species of Leptolegnia and other Peronosporomycetes: justification pheromone receptor levels in Achlya ambisexualis. Journal of Steroid for the subclass taxa Saprolegniomycetidae and Peronosporomycetidae and Biochemistry 23: 483–489.

No claim to original French government works New Phytologist (2009) 183: 291–300 Journal compilation © New Phytologist (2009) www.newphytologist.org 300 Research Rapid report

Riethmueller A, Voglmayr H, Goeker M, Weiss M, Oberwinkler F. 2002. Waterman MR, Lepesheva GI. 2005. Sterol 14α-demethylase, an abundant Phylogenetic relationships of the downy mildews (Peronosporales) and and essential mixed-function oxidase. Biochemistry and Biophysical Research related groups based on nuclear large subunit ribosomal DNA sequences. Communications 338: 418–422. Mycologia 94: 834–849. Whelan S, Goldman N. 2001. A general empirical model of Roberts CW, McLeod R, Rice DW, Ginger M, Chance ML, Goad LJ. protein evolution derived from multiple protein families using a 2003. Fatty acid and sterol metabolism: Potential antimicrobial targets in maximum-likelihood approach. Molecular Biology and Evolution apicomplexan and trypanosomatid parasitic protozoa. Molecular and 18: 691–699. Biochemical Parasitology 126: 129–142. Salamov A, Solovyev V. 2000. Ab initio gene finding in Drosophila Genomic DNA. Genome Research 10: 516–522. Supporting Information Schäller H. 2003. The role of sterols in plant growth and development. Progress in Lipid Research 42: 163–175. Additional supporting information may be found in the online Söderhäll K, Cerenius L. 1999. The crayfish plague fungus: history and version of this article. recent advances. Fresh Cray. 12: 11–35. Torto-Alalibo T, Tian M, Gajendran K, Waugh ME, van West P, Kamoun S. 2005. Expressed sequence tags from the oomycete fish pathogen Fig. S1 Alignment of CYP51 orthologs in the region of the Saprolegnia parasitica reveal putative virulence factors. BMC Microbiology B’ helix. 5: 46. Tyler BM, Tripathy S, Zhang X, Dehal P, Jiang RH, Aerts A, Arredondo Fig. S2 Alignement of AeCYP51 protein sequence to plant, FD, Baxter L, Bensasson D, Beynon JL et al. 2006. Phytophthora genome fungal, animal, and stramenopiles CYP51 sequences. sequences uncover evolutionary origins and mechanisms of pathogenesis. Science 313: 1261–1266. Vandersea MW, Litaker RW, Yonnish B, Sosa E, Landsberg JH, Pullinger Fig. S3 Alignment of sterol methyltransferase amino acid C, Moon-Butzin P, Green J, Morris JA, Kator H et al. 2006. Molecular sequences. assays for detecting Aphanomyces invadans in ulcerative mycotic fish lesions. Applied and Environmental Microbiology 72: 1551–1557. Please note: Wiley-Blackwell are not responsible for the content Vauthrin S, Mikes V, Milat ML, Ponchet M, Maume B, Osman H, Blein JP. 1999. Elicitins trap and transfer sterols from micelles, liposomes and or functionality of any supporting information supplied by plant plasma membranes. Biochimistry and Biophysical Acta 1419: the authors. Any queries (other than missing material) should 335–342. be directed to the New Phytologist Central Office.

About New Phytologist

• New Phytologist is owned by a non-profit-making charitable trust dedicated to the promotion of plant science, facilitating projects from symposia to open access for our Tansley reviews. Complete information is available at www.newphytologist.org.

• Regular papers, Letters, Research reviews, Rapid reports and both Modelling/Theory and Methods papers are encouraged. We are committed to rapid processing, from online submission through to publication ‘as-ready’ via Early View – our average submission to decision time is just 29 days. Online-only colour is free, and essential print colour costs will be met if necessary. We also provide 25 offprints as well as a PDF for each article.

• For online summaries and ToC alerts, go to the website and click on ‘Journal online’. You can take out a personal subscription to the journal for a fraction of the institutional price. Rates start at £139 in Europe/$259 in the USA & Canada for the online edition (click on ‘Subscribe’ at the website).

• If you have any questions, do get in touch with Central Office ([email protected]; tel +44 1524 594691) or, for a local contact in North America, the US Office ([email protected]; tel +1 865 576 5261).

New Phytologist (2009) 183: 291–300 No claim to original French government works www.newphytologist.org Journal compilation © New Phytologist (2009)

Fig. S1 Alignment of CYP51 orthologs in the region of the B’ helix. Sorghum 1 ------MDLADIPQQQRLMAGLALVVATVIFLKLLLSFR--SGG Solanum 1 ------MELGDN----KILNVGLLLVATLLVAKLISALI--MPR Arabidopsis 1 ------MDWDYY----TLLKTSVAIIIVFVVAKLITSSK--SKK Aureococcus 1 ------MALVVIAAAVFC--LTCCLWMLMSGKFR--PAK Phaeodactylum 1 ------MIVALVVVTG--LTALWFFLLRPRTG--GKH Ectocarpus 1 ------MPPTDLLAGAA--LVACVFLALIAAFRRSPKN Aphanomyces 1 ------MLSLTELFAEHSQLLVGFLVAFLVLVFVTSPKK Naegleria 1 ------MDEIGVLDIVLALVVAGFLFLVIRYFS----S Leishmania 1 ------MIGELLLLLIAGLALYGWYFCKS----F Trypanosoma 1 ------MFIEAIVLGLTALILYSVYSVKS----F Bostaurus 1 ------MLDLLQAGGSVLGQAMEQVTGGNLASMLLIACAFTLSLVYLFRLAVGHLAPP Homo 1 MAAAAGMLLLGLLQAGGSVLGQAMEKVTGGNLLSMLLIACAFTLSLVYLIRLAAGHLVQ- Gallus 1 ------MKALDIWINKNQA------LTYGEMIEK Danio 1 ------MTILEVGSQLIESAVLQMS---LTSVLLTASVFTLTLGYISKLLFTQHSS- Strongylocentrotus 1 ------MANSVNIFESVGGVFGEMTLATMILVSTIFVLGIAWAFKSLLGPQNK- Monosiga 1 ------MDKLPAAVVPYAEAAQEALVSLHETLGRPSTTTYLATSAVALGIWKYIRGN Penicillium 1 ------MDLVPLVTGQIKCIAYYTTGLVLASIVLNVIKQLVF-- Aspergillus 1 ------MVPMLW-----LTAYMAVAVLTAILLNVVYQLFFRL Erysiphe 1 ------MYIADILSD---LLTQQTTRYGWIFMVTSIAFSIILLAVGLNVLSQLLFR- Mycosphaerella 1 ------MGLLQEVLA---QFDAQFGQTSLWKLVGLGFLAFSTLAILLNVLSQLLFR- Saccharomyces 1 ------MSATKSIVGEALEYVNIGLSHFLALPLAQRISLIIIIPFIYNIVWQLLYS- Candida 1 ------MAIVETVID------GINYFLSLSVTQQISILLGVPFVYNLVWQYLYS-

Sorghum 37 --GKKRLPPTIPGAP-VVGGLVKFMRGPIPMIREQYAALG-SVFTVPIITRRITFLIGPE Solanum 33 --SKKRLPPVIKALP-IVGGLIRFLKGPIVMLRQEYPKLG-SVFTLNLLNKNITFFIGPE Arabidopsis 33 KTSVVPLPPVLQAWPPFIGSLIRFMKGPIVLLREEYPKLG-SVFTVKLLHKNITFLIGPE Aureococcus 30 APPHVSEGPPIV--GNLMGFALGP-RGPLDFIKRNFEVHG-GAYSMRVAHKTLTFLVGPK Phaeodactylum 28 APPVVTSSPLVP--IPVIGHIVEFFRSPHFMMQRCLKDHG-KVFTIPIFHKRLTFLIGPE Ectocarpus 31 APPVVRMG------VPVFGNFAAFIRSPLNMIRECYEKYG-AVYTVPLMGFNFTFLVGPE Aphanomyces 34 HPAGVKLPPVLPYWIPFVGSFPSFAANPIQMILDGYKQKG-HCFTAKMFGQDLTFLIGPL Naegleria 29 QKGKKSEPPRVPNFLPYFGSFVGFAKNPVGFIIENSKKYG-DVFTATILGKEMTFLNHPK Leishmania 25 NTTRPTDPPVIHCTTPFVGHIIQFGKDPLGFMLSAKKKYG-GIFTMNICGNRITIVGDVH Trypanosoma 25 NTTRPTDPPVYPVTVPFLGHIVQFGKNPLEFMQRCKRDLKSGVFTISIGGQRVTIVGDPH Bostaurus 53 LPTGAKSPPYIVSPIPFLGHAIAFGKSPIEFLEDAYEKYG-PVFSFTMVGKTFTYLLGSE Homo 60 LPAGVKSPPYIFSPIPFLGHAIAFGKSPIEFLENAYEKYG-PVFSFTMVGKTFTYLLGSD Gallus 23 LIRMLNHPPHIPSSIPFLGHAIAFGKSPIEFLENAYDKYG-PVFSFTMVGKTFTYLLGSD Danio 48 --EHTKYPPHIPSSLPFLGQAVAFGRSPIEFLEKAYEQYG-PVVSFTMVGKTFTYLLGSD Strongylocentrotus 48 ---DVKLPPRLPTGIPFLGQAVAFNQSPIDFLEDAYEKYG-DVFSFTMVGKTFTYLIGSE Monosiga 52 YLRPAKAPPKVPSQVPWLGCIFAFGQSPIEFMIDCYKKYG-PVYSFVMFGTEVTYLLGSE Penicillium 37 --YNRKEPPVVFHWIPFIGSTVAYGMDPYQFFFASRAKYG-NIFTFILLGKKTTVYLGVE Aspergillus 32 --WNRTEPPMVFHWVPFLGSTISYGIDPYKFFFACREKYG-DIFTFILLGQKTTVYLGVQ Erysiphe 48 ---RPYEPPVVFHWFPIIGSTISYGIDPYKFYFDCRAKYG-DIFTFILLGKKVTVYLGLQ Mycosphaerella 48 --GKSSDPPLVFHWVPFIGSTITYGIDPYKFFFSCREKYG-DVFTFILLGKKTTVCLGTK Saccharomyces 51 --LRKDRPPLVFYWIPWVGSAVVYGMKPYEFFEECQKKYG-DIFSFVLLGRVMTVYLGPK Candida 43 --LRKDRAPLVFYWIPWFGSAASYGQQPYEFFESCRQKYG-DVFSFMLLGKIMTVYLGPK

Sorghum 93 VSAHFFKGNEAEMSQQEVYR-FNVPTFGPGVVFDVDYSVRQ-EQFRFFTEALRANKLRSY Solanum 89 VSAHFFKAPETDLSQQEVYQ-FNVPTFGPGVVFDVDYTIRQ-EQFRFFTEALRVTKLKGY Arabidopsis 92 VSSHFFNAYESELSQKEIYK-FNVPTFGPGVVFDVDYPVRM-EQFRFFSSAL------Aureococcus 86 ASAPFFQNRDDVFSQPEVYG-FMTQVFGKGVVYDATPAKRK-AQNVHMSRGLRADRLKSY Phaeodactylum 85 AQEIFFKANDDVLSQSEVYD-FTRPVFGNDVVYDASKKNRQ-VQFQTMANGLRTARLKAY Ectocarpus 84 AQAPFFKLNDETMSQNEVYGRYTKPVFGADVVYAADPKKRN-QQMQHMAYGLRTARLKSY Aphanomyces 93 AHEAFFKPNDDYLSQSEVYK-LMTPVFGPGLVYDATPKRRA-QQMQFMANGLRTSRLRTY Naegleria 88 ILETFFKATDNELSLRDVYK-FMRPVFGAGVVYDADSTERMMEQVKFVSSGLTTARFRVF Leishmania 84 QHSKFFTPRNEILSPREVYR-FMVPVFGEGVAYAAPYPRMR-EQLNFLAEELTVAKFQNF Trypanosoma 85 EHSRFFSPRNEILSPREVYT-IMTPVFGEGVAYAAPYPRMR-EQLNFLAEELTIAKFQNF Bostaurus 112 AAALLFNSKNEDLNAEEVYSRLTTPVFGKGVAYDVPNTVFL-EQKKMLKSGLNIAHFRQH Homo 119 AAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNPVFL-EQKKMLKSGLNIAHFKQH Gallus 82 AAALLFNSKNEDLNAEDVYSRLTTPVFGKGVAYDVPNVVFL-EQKKMLKTGLNIAQFKQH Danio 105 AAALMFNSKNEDLNAEDVYARLTTPVFGKGVAYDVPNPLFL-EQKKMLKTGLNIAQFKQH Strongylocentrotus 104 ASALLFNSKNENLNAEEVYSNLTVPVFGKGVAYDVPNPVFV-EQKKMLKTGLNIQQFKRH Monosiga 111 ASSRFWSTHNDVLNAEDLYANITVPVFGEGVAYAVEHKIFS-EQKQMAKEGLTIDRFKAY Penicillium 94 GNEFILNGKLKDVNAEEIYGKLTTPVFGSDVVYDCPNSKLM-EQKKFIKYGLSQEALESY Aspergillus 89 GNEFILNGKLKDVNAEEVYSPLTTPVFGSDVVYDCPNSKLM-EQKKFIKYGLTQSALESH Erysiphe 104 GNNFILNGKLKDVNAEEIYTNLTTPVFGRDVVFDCPNSKLM-EQKKFMKTALTIEAFHSY Mycosphaerella 105 GNDFILNGKLKDVNAEEIYSPLTTPVFGKDVVYDCPNSKLM-EQKKFVKYGLTTSALQSY Saccharomyces 108 GHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLM-EQKKFVKGALTKEAFKSY Candida 100 GHEFVFNAKLSDVSAEEAYKHLTTPVFGTGVIFDCPNSRLM-EQRKFAKFALTTDSFKRY Sorghum 151 VDQMVAEAEEYFSK------WGESG-TVDLKYELEHLIILTASRCLLGREVREKLF-DDV Solanum 147 VDQMVTEAEEYFSK------WGESG-EVDLKYELEHLIILTASRCLLGEEVRNKLF-DDV Arabidopsis 142 ------KDYFSK------WGESG-EVDLKAELERLITLTASRCLLGREVRDQLF-DDV Aureococcus 144 IPKILMETKKYMGDR-----WAEDG-ACDVLKALSELTILTASRCLHGDDVRETLF-EEV Phaeodactylum 143 IPKIEQETRAYIKN------WGDAG-QIDLLKALSELTILTASRCLHGEDVRTHIF-KEV Ectocarpus 143 VPMIEKETRNFLKT------WGDSG-EVDLASALSRLTILTASRCLHGDEVRENLF-EEV Aphanomyces 151 VDKIRSETELYFKA------FPDES-TVNLKKTFAELAILTASRALLGDEVREHLF-KEV Naegleria 147 VDIFEDEVRRRVDV------LGKEG-TVNIVELLSDLIIFTASRCLLGDEVREYLSSKNL Leishmania 142 APSIQHEVRKFMKAN-----WNKDEGEINILDDCSAMIINTACQCLFGEDLRRRLDARQF Trypanosoma 143 VPAIQHEVRKFMAEN-----WKEDEGVINLLEDCGAMIINTACQCLFGEDLRKRLNARHF Bostaurus 171 VSIIEKETKEYFKSWG------ESGEKNLFEALSELIILTASHCLHGKEIRSQLN-EKV Homo 178 VSIIEKETKEYFESWG------ESGEKNVFEALSELIILTASHCLHGKEIRSQLN-EKV Gallus 141 VTLIEEETKEYFKAWG------ESGERNLFEAFSELIILTASHCLHGKEIRSLLN-EKV Danio 164 VEIIEEETKDYFRRWG------ESGERNLFDALSELIILTASRCLHGCEIRSLLD-ERV Strongylocentrotus 163 IPLIEEETREYFNRWG------DSGEKNLFVALSELIILTASRCLHGKEIRSMLD-EEV Monosiga 170 TSMIEKETNGFIERWG------QTGTIDFFDNMARMIIYTATRCLHGNETREDFD-EDV Penicillium 153 VPLIADEISSYIKSS---PSFKGQSGTIDLVPAMAEITTFTAARTLQGEEVRSKLT-TEF Aspergillus 148 VPLIEKEVLDYLRDS---PNFQGSSGRMDISAAMAEITIFTAARALQGQEVRSKLT-AEF Erysiphe 163 VTIIQNEVEAYINNC---VSFQGESGTVNISKVMAEITIYTASHALQGEEVRENFD-SSF Mycosphaerella 164 VTLIAAETRQFFDRNNPHKKFASTNGTIDLPPALAELTIYTASRSLQGKEVREGFD-SSF Saccharomyces 167 VPLIAEEVYKYFRDSKNFRLNERTTGTIDVMVTQPEMTIFTASRSLLGKEMRAKLD-TDF Candida 159 VPKIREEILNYFVTDESFKLKEKTHGVANVMKTQPEITIFTASRSLFGDEMRRIFD-RSF

Sorghum 203 SALFHDLDNGIQPISVLFP---YLPIPAHKRRDKARARLAEIFATIIKSRKASG------Solanum 199 SALFHDLDNGMLPISVIFP---YLPIPAHRRRDNARKKLAEIFANIINSRKRTG------Arabidopsis 186 APLFHDLDKGMQPISVIFP---KLPIPAHNCRDRARGKIAKIFSNIIATRKRSGD----- Aureococcus 197 ADIYHDLDKGITPLSFFWP---TAPVEGHRKRDAARVRMVELFRGVIDARRTQTR----- Phaeodactylum 195 QELYHDLDHGLTPLTVFWP---TAPSQAHRKRDVARKEMVRLFTKVIEERQLHP------Ectocarpus 195 ARLFHDLDEGMTPLSVFLP---HAPIPAHFRRDKARKEMVTVLSSVISARRAEQASG--- Aphanomyces 203 SSLYNDLDGGTTAFSFFFP---YAPTPAHKRRDAARAKMDELFSAVIKARRDSGK----- Naegleria 200 GKLYHDIDEGISPLSFFYP---SLPAG---RRDTARKAIGEIFQELLDKRREEHKKNPER Leishmania 197 AQLLAKMESCLIPAAVFLPWILKLPLPQSYRCRVARAELQEILSEIIIAREKEEAQK--- Trypanosoma 198 AQLLSKMESSLIPAAVFMPWLLRLPLPQSARCREARAELQKILGEIIVAREKEEASK--- Bostaurus 223 AQLYADLDGGFSHAAWLLPG--WLPLPSFRRRDRAHREIKNIFYKAIQKRR--ESGEKID Homo 230 AQLYADLDGGFSHAAWLLPG--WLPLPSFRRRDRAHREIKDIFYKAIQKRR--QSQEKID Gallus 193 AQLYADLDGGFTHAAWLLPA--WLPLPSFRRRDRAHRAIKNIFYKVIQKRR--SSEEKED Danio 216 AQLYADLDGGFTHAAWLLPG--WLPLPSFRRRDRAHLEIKKIFYNVIKKRR--EDTEKHD Strongylocentrotus 215 AQLYADLDGGFTHLAWLAPS--WIPFPSFLRRDRAHRKIKQIFYKAIAKRR--ETG-VEN Monosiga 222 AKLYHALDGGFTPQAWFFPP--WLPLPSFRRRDRAHRELKERFYKIIDRRRQKAEEGTQT Penicillium 209 AKLFHDLDLGFTPINFMLP---WAPLPQNRKRDRAHRRMREIYVDIIQARREAGEEANDN Aspergillus 204 ADLYHDLDKGFTPINFMLP---WAPLPHNKKRDAAHARMRSIYVDIINQRRLDGDKDSQK Erysiphe 219 AALYHDLDMGFTPINFTFY---WAPLPWNRARDHAQRTVARTYMNIIQARREEKRSGENK Mycosphaerella 223 ADLYHYLDMGFTPINFMLP---WAPLPQNRRRDYAQKKMSETYMSIIQKRRESKTGEHEE Saccharomyces 226 AYLYSDLDKGFTPINFVFP---NLPLEHYRKRDHAQKAISGTYMSLIKERRKNNDIQ-DR Candida 218 AQLYSDLDKGFTPINFVFP---NLPLPHYWRRDAAQKKISATYMKEIKSRRERGDIDPNR

Sorghum 254 ----QSEEDMLQCFID-SKYKN---GRPTTEGEVTGLLIAALFAGQHTSSITSTWTGA-Y Solanum 250 ----KAENDMLQCFID-SKYKD---GRPTTEGEITGLLIAALFAGQHTSSITSTWTGS-Y Arabidopsis 238 ----KSENDMLQCFID-SKYKD---GRETTESEVTGLLIAGLFAGQHTSSITATWTGA-Y Aureococcus 249 -EQADARTDILQVFVD-MKYKD---GTMATTDEITGLLIALLFAGQHTSSITSTWTTL-F Phaeodactylum 246 -ERSDG-TDILSLFMD-IKYKD---GSAVTMDQVTGLLIALLFAGQHTSCITSTWTSL-F Ectocarpus 249 -TSTVEKTDLLQVFVD-MKYKD---GSTNTDDQVVGLLIALLFAGQHTSSITSTWTTL-L Aphanomyces 255 -----RCDDILDTFMN-SEYKDT-PGVNIPDQHVVGLLIALLFAGQHTSSLTLTWAVIEL Naegleria 254 -LLDESKMDVVDHLLT-QKYKD---GQELTDVHRIGVLIAGLFAGQHTSSITSSWTLM-S Leishmania 254 ---DSNTSDLLAGLLG-AVYRD---GTRMSQHEVCGMIVAAMFAGQHTSTITTTWSLLHL Trypanosoma 255 ---DNNTSDLLGGLLK-AVYRD---GTRMSLHEVCGMIVAAMFAGQHTSTITTSWSMLHL Bostaurus 279 ------DILQTLLE-STYK---DGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGF-F Homo 286 ------DILQTLLD-ATYK---DGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGF-F Gallus 249 ------DMLQTLLD-ASYK---DGRPLTDDEIAGMLIGLLLAGQHTSSTTSAWLGF-F Danio 272 ------DILQTLID-ATYK---DGRPLSDDEIAGMLIGLLLAGQHTSSTTSAWMGF-F Strongylocentrotus 270 ------DMLQTLID-SKYK---SGRPLSDDEIAGMCIGLLLAGQHTSSTTSAWLGF-F Monosiga 280 ------DLMHTFMT-TPYKNVEDGRHLTTDEVSGMMIALLMAGQHTSSTVSSWLTC-F Penicillium 266 GRDKTKGTDMISNLMR-CVYR---DGTPIPDKEIAHLMITLLMAGQHSSASISCWILL-R Aspergillus 261 ------SDMIWNLMN-CTYK---NGQQVPDKEIAHMMITLLMAGQHSSSSISAWIML-R Erysiphe 276 ------HDIMWELMR-STYK---DGTPVPDREIAHMMIALLMAGQHSSSSTSSWIML-W Mycosphaerella 280 ------DMIHNLMQ-CKYK---DGNAIPDKEIAHMMIALLMAGQHSSSATESWITL-R Saccharomyces 282 ------DLIDSLMKNSTYK---DGVKMTDQEIANLLIGVLMGGQHTSAATSAWILL-H Candida 275 ------DLIDSLLIHSTYK---DGVKMTDQEIANLLIGILMGGQHTSASTSAWFLL-H Sorghum 305 MLRFKQYFAEAVEEQKDVMK-----RHGDKIDHD-ILAEMDVLYRCIKEALRLHPPLIML Solanum 301 LLTNNKYMSAVVDEQKNLMK-----KHGNKVDHD-ILSEMDVLYRCIKEALRLHPPLIML Arabidopsis 289 LIQNKHWWSAALDEQKKLIG-----KHGDKIDYD-VLSEMDFLFRSAKEALRLHPPKILL Aureococcus 303 ILHDAKLKARLLEEQRQIFGAG--DIRDAPMSFD-DLNKMEILHNCVKETLRMHPPLIML Phaeodactylum 299 IANDPTLVSRILAEQKTVLG-G--DLN-KPIEYE-DLQNMELLHNCMREALRMCPTFIMI Ectocarpus 303 TTRDPKMLERLLEEQETVLK----DTQNTPLTWE-HLGEMELLHDCMRETLRMYPPLILL Aphanomyces 308 VLLQPGMIPKILEEQKQVLG----DAGNDNLTFE-NLNNMPVLHACIKETLRLTPPLILL Naegleria 308 VIADKRVLGKVRAEQDEIMG------SDAKLDYE-KVMKMDYLEACMKEALRMYPPLIMI Leishmania 307 MDPRNKRRLAKLHQEIDEFP------AQLNYDNAMEEMPFAEQCARESIRRDPPLVML Trypanosoma 308 MHPKNKKWLDKLHKEIDEFP------AQLNYDNVMDEMPFAERCVRESIRRDPPLLMV Bostaurus 326 LARDKTLQEKCFLEQKTVCGEN-----LPPLTYD-QLKDLNLLDRCIKETLRLRPPIMTM Homo 333 LARDKTLQKKCYLEQKTVCGEN-----LPPLTYD-QLKDLNLLDRCIKETLRLRPPIMIM Gallus 296 IARDKAIQEQCYAEQKAVCGDD-----LPPLTYD-QLKDLSLLDRCLKETLRLRPPIMTI Danio 319 LARDRALQERCYSEQKSVCGEE-----LPPLHYD-QLKDLSLLDRCLKETLRLRPPIMTM Strongylocentrotus 317 LARDKEVQDRCNAEQIKVCGDA-----STEVSYD-QLKDMQLLDHCVKEALRLRPPIMTM Monosiga 330 ITTTPGLEEKLYQEQVELFKRR-----PGPLSYE-HINEMPLLWACIRETLRLRPPIMSI Penicillium 321 LASQPEMTEKLFAEQVNNLG-----ADLPPLQYK-DLDKLPLHRNVIKETLRLHSSIHTL Aspergillus 309 LASQPKVLEELYQEQLANLGPAGPDGSLPPLQYK-DLDKLPFHQHVIRETLRIHSSIHSI Erysiphe 324 LAARPDIMEELYEEQLRIFGS---EKPFPPLQYE-DLSKLQLHQNVLKEVLRLHAPIHSI Mycosphaerella 327 LASRPDIQDELLQEQKDMLGVN-ADGSIKELTYA-NLSKLTLLNQVVKETLRIHGPVHSI Saccharomyces 330 LAERPDVQQELYEEQMRVLD-----GGKKELTYD-LLQEMPLLNQTIKETLRMHHPLHSL Candida 323 LGEKPHLQDVIYQEVVELLKEK--GGDLNDLTYE-DLQKLPSVNNTIKETLRMHMPLHSI

Sorghum 359 LRQSHSDFTVTTKEGKEYDIPKGHIVATSPSFANRLPHIYKNP-DSYDPDRFGPGR---- Solanum 355 LRSSHSDFSVTTREGKEYDIPKGHIVATSPAFANRLPHIFKNP-ESYDPDRFGPGR---- Arabidopsis 343 LRTVHSDFTVTTREGKQYEIPKGHIVATSPAFANRLPHVYKDP-ENFDPDRFSKER---- Aureococcus 360 MRKAMQDVPIETDAGLKYVIPKGDIVFTSPAVAGRLDMVFKDP-DAFDPDRYAPPR---- Phaeodactylum 354 LRKAERDVKIQSE-GKSYVIPQGDMVVVSPTVSMRMKETFADP-DTYDPDRFAAPR---- Ectocarpus 358 LRMAKKDFTVTSK-GQSFTVPKGHFVGTSPHVAMRLPTVFKNP-DEFDPDRFGPER---- Aphanomyces 363 MRKVMKD--IECG---DYTIPEGHIVFASPAAANRLDDYWGNP-DSYDPMRFLDGRN--- Naegleria 361 MRMARKP-----RQCEEFIIPKGNILVVSPSVAGRCTDTFTSP-DVFRPERLTEDK---- Leishmania 359 MRKVLKPVQVG-----KYVVPEGDIIACSPLLSHQDEEAFPNP-REWNP------Trypanosoma 360 MRMVKAEVKVG-----SYVVPKGDIIACSPLLSHHDEEAFPNP-RLWDP------Bostaurus 380 MRLAKTPLTVAG-----YTIPPGHQVCVSPTVNQRLKDSWVER-LDFNPDRYLEDSP--- Homo 387 MRMARTPQTVAG-----YTIPPGHQVCVSPTVNQRLKDSWVER-LDFNPDRYLQDNP--- Gallus 350 MRLAKTPQTVAG-----YNIPPGHQVCVSPTVNQRLKDSWKDA-LDFKPDRYLRDNP--- Danio 373 MRMAKTPQKVGE-----YTIPPGHQVCVSPTVNHRLQDTWAER-LDFDPDRYLHDNP--- Strongylocentrotus 371 MRVAKSPLTYKD-----MTIPAGHQVCVSPTVNQRLKDNWMPGPKEFNPDRFLDESK--- Monosiga 384 MRRAREDYKVTVN-GVEYVIPKGSQVCVSPTVNGRLEDEWEDP-NTFNPYRFLKEEDGKL Penicillium 375 MRKVKNPMPVPG---TDFVIPPSHTLLSSPGVTARDDRHFRDP-LRWDPHRWES---RVE Aspergillus 368 MRKVKSPLPVPG---TPYMIPPGRVLLASPGVTALSDEHFPNA-GCWDPHRWEN---QAT Erysiphe 380 MRKVKNPMIVPG---TKYVIPTSHVLISSPGCTSQDATFFPDP-LKWDPHRWDIGSGKVL Mycosphaerella 385 LRKVKSPMPIEG---TAYVIPTTHTLLAAPGTTSRMDEHFPDC-LHWEPHRWDES--PSE Saccharomyces 384 FRKVMKDMHVPN---TSYVIPAGYHVLVSPGYTHLRDEYFPNA-HQFNIHRWN----KDS Candida 380 FRKVTNPLRIPE---TNYIVPKGHYVLVSPGYAHTSERYFDNP-EDFDPTRWDTAAAKAN

Sorghum 414 ------EEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWTHL Solanum 410 ------EEDKAAGAFSYISFGGGRHGCLGEPFAYLQIKAIWSHL Arabidopsis 398 ------EEDKAAGSCSYISLGAGRHECPGGSFAFLQIKAVWCHL Aureococcus 415 ------EEHATP--FAHLGFGGGIHQCMGQQFGFMQVKTIISWL Phaeodactylum 408 ------EEHKQP--YAYMGFGGGLHSCMGQNFAFLQVKTIISVL Ectocarpus 412 ------QEHKQP--FAYLGFGAGMHQCMGQQFAFVQVKTILSVL Aphanomyces 414 ------EEDKLP--YTNVSFGGGMHGCMGQQYAYIQVKIILSIF Naegleria 411 ------EQDKFK--YGNVPFGAGRHKCIGENFALLQVKSIISIL Leishmania 402 ------ERNMKLVDGAFCGFGAGVHKCIGEKFGLLQVKTVLATV Trypanosoma 403 ------ERDEK-VDGAFIGFGAGVHKCIGQKFALLQVKTILATA Bostaurus 431 ------ASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTM Homo 438 ------ASGEKFAYVPFGAGRHRCIGENFAYVQIKTIWSTM Gallus 401 ------AAGEKFAYIPFGAGRHRCIGENFAYVQIKTIWSTL Danio 424 ------AAGEKFAYIPFGAGRHRCIGENFAYVQIKTIWSTL Strongylocentrotus 423 ------SNSEKFSYVPFGAGRHRCIGENFAYVQIKTIWSVM Monosiga 442 VVT------EGEQITKGGKFKWVPFGAGRHRCIGFGFAQVQIRCIMSTI Penicillium 428 AED-SSD-TVDYG------YGAVSKGTRSPYLPFGAGRHRCIGEKFAYLNLGVIIATL Aspergillus 421 KEQ-ENDEVVDYG------YGAVSKGTSSPYLPFGAGRHRCIGEKFAYVNLGVILATI Erysiphe 436 GND-AVDEKYDYG------YGLTSTGASSPYLPFGAGRHRCIGEQFATLQLVTIMATM Mycosphaerella 439 KYK-HLSPTTALGSIAEEKEDYGLVSKGAASPYLPFGAGRHRCIGEQFAYVQLQTITATM Saccharomyces 436 ASSYSVGEEVDYG------FGAISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIF Candida 436 SVSFNSSDEVDYG------FGKVSKGVSSPYLPFGGGRHRCIGEQFAYVQLGTILTTF Aphanomyces 1 MNMFVPSSSFPIGQVFNWASSDVYLSTTARVSALHRRPPADYDVNVLLVWFASLSLLLGS Thalassiosira 1 MLLFITK------LYSPGVPLILGT Trypanosoma 1 ------Leishmania 1 ------candida 1 ------Saccharomyces 1 ------Nectria 1 ------Arabidopsis 1 ------Oryza 1 ------

Aphanomyces 61 FSVSAILAETKAIFYSVAASATTLVAASVYVVQIENSTVTKGAIAAALVIFASAVFQTAK Thalassiosira 20 LS------IIVLVHLLFTRIFSSFK Trypanosoma 1 ------Leishmania 1 ------candida 1 ------MSPVQLAEKN Saccharomyces 1 ------MSETELRK-- Nectria 1 ------MVASSTASNLERED Arabidopsis 1 ------Oryza 1 ------MEAATMAWTAAGVGMAL

Aphanomyces 121 IVGNSKVSRDGSDFTTTLLGSTRLLSNPDSVLSRDAVNSRFEDYDKLFKGAREKTGAISS Thalassiosira 39 RDAHNKTFR------TVVDAASLLSNPDSVLKREGVKDSIEGYETLFAGARESLGATST Trypanosoma 1 ------MS------AGAPATLPLNLMRSRRAEEENKDVSTTANRFRERFEGK---DAS Leishmania 1 ------MS------AGGREITPMNLLRRRNKDEINGDVNAAADRFRNRFEK-----AT candida 11 YERDEQFTK------ALHGESY-KKTGLSALIAKSKDAASVAAEGYFKHWDGG--ISKD Saccharomyces 9 --RQAQFTR------ELHGDDIGKKTGLSALMSKNNSAQKEAVQKYLRNWDGR--TDKD Nectria 15 HKRDAEFNK------AMHGSSAQARGGVAAMFRKGGSAKQAAVDEYFKHWDNKPAENET Arabidopsis 1 ------MDLASNLGGKIDKSDVLTAVEKYEQYHVFHGG-----N Oryza 18 VYWFVWVMG------AAEVKGKRAVDLKMGSITNDKVKDKYTQYWSFFRRPKET----AT Region I

Aphanomyces 181 EESIKLRQSEYQLMVDSFYDLVTDFYEYGWGQSFHFANRFRDETFRESIRRVEYFLASKL Thalassiosira 92 SDSIQHRAKEYQTLVNSFYDLVTDFYEWGWGQSFHFAPRKKGETFDESIIRAEHYLALRA Trypanosoma 44 VSGR---KAETTTMVNEYYDIVTDFYEYGWGQGFHFAPRYLGESLLESLARHEFFLAYQG Leishmania 42 LEER---KAATTTMVNEYYDLVTDFYEYGWGQNFHFAPRYAGETFFESLARHEYFLAARG candida 61 DEEK--RLNDYSQLTHHYYNLVTDFYEYGWGSSFHFSRYYKGEAFRQATARHEHFLAHKM Saccharomyces 58 AEER--RLEDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGESFAASIARHEHYLAYKA Nectria 68 AEERAARTAEYATLTRHYYNLATDLYEYGWGQSFHFCRYSLGEPFYQAIARHEHYLAHHI Arabidopsis 34 EEER---KANYTDMVNKYYDLATSFYEYGWGESFHFAQRWKGESLRESIKRHEHFLALQL Oryza 68 TEAS---AEKVPAFVDTFYNLVTDIYEWGWGQSFHFSPSLPGRSHREATRVHEERVADLL Region II

Aphanomyces 241 GLNKSHYALDMGCGIGGPMRNIARFSGAKIKGLTINEYQVRVANKNNEKMGLDKQCHVQQ Thalassiosira 152 NIQQESKVLDVGCGVGGPMISIHHLTGADITGVTLNQYQVRVANQYCTQRGIDDKTRVFQ Trypanosoma 101 QFKPTDTVLDLGCGVGGPARNIVRLAGCNVMGVNNNEYQISRARRHDTKYGMNSKINYTK Leishmania 99 GFMEGDHIVDVGCGVGGPARNIVRLTRCNVTGVNNNDYQISRARRHDALAGMSCKIDYVK candida 119 NLNENMKVLDVGCGVGGPGREITRFTDCEIVGLNNNDYQIERANHYAKKYHLDHKLSYVK Saccharomyces 116 GIQRGDLVLDVGCGVGGPAREIARFTGCNVIGLNNNDYQIAKAKYYAKKYNLSDQMDFVK Nectria 128 GIKEGMKVLDVGCGVGGPAREIAKFTGAHITGLNNNDYQIERATHYAFKEGLSNQLTFVK Arabidopsis 91 GIQPGQKVLDVGCGIGGPLREIARFSNSVVTGLNNNEYQITRGKELNRLAGVDKTCNFVK Oryza 125 QAKPGHRLLDVGCGVGGPMRAIAAHSGSNVVGITINEYQVNRARAHNRKAGLDSRCEVVC

Aphanomyces 301 GNFMEMP--FEANTFDAIYAIESVCHAPDKKGCFAEACRVLKPGGTFVGLDWAVLN--DY Thalassiosira 212 GDFQKLSDQFEAETFDCAYAIEATCHSPDRRVCFKGVNHCLKKGGLFACYDWVVLPERGF Trypanosoma 161 TDFCNMC--FGDNEYDGAYAIEATCHATDKVKCFSEVFRVIKPGSYFVLYEWCITE--KY Leishmania 159 TDFCNMS--LADNTFDGAYAIEATCHAKDKVKCYSEVFRVIKPGTCFVLYEWCMTD--KY candida 179 GDFMQMD--FEPESFDAVYAIEATVHAPVLEGVYSEIYKVLKPGGIFGVYEWVMTD--KY Saccharomyces 176 GDFMKMD--FEENTFDKVYAIEATCHAPKLEGVYSEIYKVLKPGGTFAVYEWVMTD--KY Nectria 188 GDFMQMS--FPDNSFDAVYAIEATVHAPTLKGIYSEIFRVLKPGGVFGVYEWLMTD--DY Arabidopsis 151 ADFMKMP--FPENSFDAVYAIEATCHAPDAYGCYKEIYRVLKPGQCFAAYEWCMTD--AF Oryza 185 GNFLSMP--FSDASFDGAYSIEATCHAPRLQDVYGEVFRVLKPGGLYVSYEWVTTS--LY

Fig. S3 Alignment of sterol methyltransferase amino acid sequences. Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

Conclusion

La mise en évidence de l’existence de gènes codant les différentes enzymes de la voie de synthèse de stérols chez A. euteiches permet d’envisager le développement d’inhibiteurs d’Aphanomyces mais aussi de mieux comprendre l’évolution moléculaire de cette voie métabolique au sein des oomycètes. La sensibilité d’A. euteiches aux triazoles est un résultat majeur de cette étude car il permet d’affirmer d’une part qu’il existe in vitro des composés capables d’inhiber la croissance mycélienne d’A. euteiches et d’autre part que la synthèse de stérols chez A. euteiches s’effectue via la production de lanostérol. Enfin, l’étude phylogénique montre que l’origine de la voie de synthèse des stérols est commune aux organismes membres des straménopiles. L’absence d’une voie de synthèse des stérols chez

Phytophthora serait le résultat d’une perte de ces gènes dans le clade des

Peronosporomycetidae, cela au profit de l’expansion du nombre de gènes codant des transporteurs de stérols comme les élicitines.

107 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 4 : Synthèse des stérols chez A. euteiches -

108 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 5 : Discussion -

Chapitre 5 : Discussion

109 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 5 : Discussion -

110 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 5 : Discussion -

1. Génomique d’A. euteiches

Le séquençage d’ESTs d’A. euteiches a permis de disposer des premières ressources moléculaires pour cet microorganisme. La mise à disposition de la base de données

AphanoDB (www.polebio.scsv.ups-tlse.fr/aphano/) (Madoui et al. 2007) facilite l’accès aux annotations et aux séquences des ESTs assemblées. Les unigènes disponibles seront utiles pour l’aide à la prédiction de gènes dans le cadre d’un projet de séquençage du génome d’A. euteiches. La mise à disposition rapide des données a nécessité la mise au point d’une base de données comportant différents outils comme la recherche d’orthologues chez

A. euteiches par comparaison de séquence ou la recherche de domaines protéiques. Cette base de données n’a pas été uniquement conçue pour les besoins de notre équipe, mais toute la communauté scientifique désirant rechercher des informations moléculaires sur A. euteiches est invitée à l’utiliser, et cette ressource s’ajoute aux bases de données existantes et dédiées principalement à Phytophthora. D’une manière générale, la première version d’AphanoDB remplit entièrement les tâches pour lesquelles elle a été conçue : facilité d’utilisation, accès aux séquences nettoyées et annotées, navigation dans le système « Gene Ontology », recherche de gènes surexprimés par occurrence d’ESTs dans les banques et recherche de similarité entre séquences par BLAST.

En vue d’utiliser les unigènes pour une future annotation du génome d’A. euteiches, il sera nécessaire de développer un support adapté à ce type de tâche. Il existe des systèmes de gestion de données orientés requête (« query oriented data managment system »), comme

Biomart, développé conjointement par le Ontario Institute for Cancer Research (OICR) et l’European Bioinformatics Institute (EBI) http://www.biomart.org/index.html. Ces supports permettent non seulement d’accéder aux données, comme dans AphanoDB mais également une administration plus souple pour l’ajout de fonctionnalités. De plus ces types de systèmes sont régulièrement mis à jour et sont utilisés par de nombreux laboratoires ce qui facilite

111 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 5 : Discussion - grandement leur utilisation. Dans le cadre de l’évolution et de la pérennité d’AphanoDB, il serait intéressant de développer ce type d’outil pour faciliter l’analyse et la la gestion des nouvelles données de génomique d’A. euteiches.

2. Identification de gènes d’interêt chez A. euteiches

La fouille de données effectuée sur AphanoDB a permis d’analyser in silico et à grande

échelle des gènes appartenant à A. euteiches en recherchant de façon prioritaires des gènes candidats pouvant intervenir dans la pathogénicité. Dans un second temps une liste de gènes impliqués dans des voies de synthèse non décrites ou absentes chez les Phytophthora a été

établie.

Parmi les effecteurs putatifs identifiés lors de cette fouille de données, on trouve en abondance les effecteurs de la famille CRN dont le mode d’action est peu ou mal connu. Cette abondance se retrouve chez les Phytophthora (Torto et al. 2003), suggérant qu’Aphanomyces et Phytophthora partagent certains mécanismes moléculaires intervenant dans la pathogénicité. Cependant la présence de ces protéines CRN chez A. euteiches montre

également une certaine divergence avec les Phytophthora. En effet, les CRN de

Phytophthora, se caractérisent par le motif N-terminal LFLAK (Tyler 2008), qui serait subsitué en motif LYLAK chez A. euteiches. Une étude visant à comparer le rôle des motifs

LFLAK des Phytophthora et LYLAK d’A. euteiches va être initiée d’ici peu dans le cadre d’une collaboration avec S. Kamoun (Sainsbury Lab, UK).

D’autres familles d’effecteurs candidats ont été identifiées : les protéines à domaines CBD et les protéines à domaines PAN/apple (domaines essentiels pour l’attachement de P. falciparum

à la cellule hôte (Haldar et al. 2006)). Nous avons trouvé dans AphanoDB des associations de domaines PAN/apple avec des domaines transmembranaires mais également avec le domaine allergène V5/Tpx-1 (IPR001283), associé au domaine PAN/apple chez l’unigène

112 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 5 : Discussion -

Ae_1AL0901. Les domaines V5/Tpx-1 sont connus pour être présents sur des protéines dont le rôle est souvent en rapport avec des réactions de défense des plantes (Dixon, Cutt, and

Klessig 1991) ou bien ayant un effet toxique.

La comparaison des séquences d’A. euteiches avec les protéomes prédits des organismes entièrement séquencés, permet de distinguer des unigènes d’A. euteiches présents chez d’autres organismes et absents chez les Phytophthora. Dans un premier lieu, l’identification des gènes intervenant dans la synthèse de la spermidine semblerait être un élément singulier qui différencie A. euteiches des Phytophthora. Dans un second temps, les comparaisons de séquences avec les protéomes de Phytophthora ont permis la mise en évidence de gènes intervenant dans la voie de synthèse des stérols.

3. Synthèse des stérols par A. euteiches

3.1 Une nouvelle voie de synthèse identifiée

La recherche dans AphanoDB, de certains gènes impliqués dans la voie de biosynthèse des stérols a permis d’initier un travail conduisant à la caractérisation d’une voie métabolique chez A. euteiches. Bien que certaines enzymes n’aient pas été identifiées in silico, telles que l’activité C3 deshydrogénase, C5 desaturase et C8 isomérase, les enzymes clés de la voie de synthèse sont bien présents dans les banques d’ESTs. En complément, les séquences pleines longueurs de la C14 déméthylase et de la stérol methyltransferase ont été obtenues par RACE PCR. L’analyse biochimique des stérols d’A. euteiches par GC-MS a montré la présence importante de fucostérol (80%) par rapport au cholestérol (20%). Ces deux stérols sont donc les stérols majoritaires d’A. euteiches. L’analyse a également montré que les précurseurs du cholestérol, le 7-dehydrocholestérol et le lathostérol sont aussi présents dans le mycélium. Le profil stéroliques d’A. euteiches est très proche de celui des algues brunes chez

113 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 5 : Discussion - qui le fucostérol a été identifié initialement (Francisco et al. 1977; Goad and Goodwin 1969).

Les essais d’inhibition par des triazoles ont permis la mise en évidence d’une accumulation de lanostérol qui est le substrat potentiel de la CYP51 d’A. euteiches. Ce résultat constitue un point majeur de l’étude car il permet d’ancrer la voie de synthèse en amont et de la confondre

à celle des Opistokontes comme les champignons et les animaux. En aval de la CYP51, la présence du cholestérol et de ses précurseurs est commune à la voie de synthèse des animaux.

La présence d’une stérol methyltransférase et du fucostérol en tant que stérol majoritaire relie cette voie de synthèse à celle des algues brunes. Nous pouvons en conclure qu’il y a chez

A. euteiches une voie de synthèse de stérols où coexiste à la fois la synthèse de stérols où le

C24 est non alkylé, comme le cholestérol, et alkylé et réduit, comme le fucostérol.

L’identification du fucostérol chez A. euteiches est un élément en accord avec les études phylogénétiques des Hétérokontes. Le fucostérol est un stérol initialement identifié chez les algues brunes (Goad and Goodwin 1969), il semble donc cohérent de le retrouver chez un oomycète apparenté aux algues brunes. Nous pourrions donc supposer que les algues brunes, les algues dorés, les diatomés et les oomycètes possèdent un ancêtre commun capable de synthétiser des stérols alkylés sur le carbone 24 comme le fucostérol (Giner, Li, and Boyer

2001; Goad and Goodwin 1969; Volkman 2003).

Il serait intéressant de déterminer quel stérol d’oomycète est le précurseur d'hormone(s) stéroïdienne(s) analogues à celles présentes chez Achlya (Hendrix 1970). Les enzymes intervenant dans la conversion de stérols en stéroïdes restent à identifier, et seraient de bonnes cibles pour bloquer la reproduction sexuée chez les oomycètes synthétisant des stérols.

Les gènes codant les enzymes intervenant dans la voie de synthèse sont en majeure partie absents chez les Phytophthora (Tyler et al. 2006). Notamment l’absence de la CYP51 explique l’inefficacité des triazoles sur les Phytophthora. La sensibilité au triazoles ainsi qu’à

114 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 5 : Discussion - d’autres inhibiteurs visant la voie de synthèse de stérols chez les Pythiales a été récement démontré (Brown, Grooters, and Hosgood 2008), bien qu’aucune enzyme de la voie de synthèse des stérols n’ai été identifiée in silico ou expérimentalement.

La perte de la voie de synthèse et l’abondance des transporteurs de lipides montrent un phénomène adaptatif au niveau moléculaire. Les Phytophthora sont incapables de se reproduire par voie sexuée en présence de stérols qu’ils vont récupérer grâce à des transporteurs comme les élicitines. Ces transporteurs sont capables de lier des phytostérols, sont reconnus par certaines plantes (Blein et al. 2002; Buhot et al. 2001) comme attestant de la présence d’un organisme pathogène et induisent une réponse de défense. Ceci montre que les Phytophthora sont beaucoup plus dépendants de la plante qu’A. euteiches, qui lui est capable de produire des oospores sans l’apport de stérol exogène.

3.2 Voie des stérols et molécules anti-oomycètes

Les essais d’inhibition sur A. euteiches par des triazoles ont démontré avec succès que le tébuconazole et l’époxiconazole sont deux molécules permettant l’inhibition de la croissance mycélienne en culture in vitro. La modélisation de l’interaction de la cible avec les triazoles peut être envisagée. En effet, la structure tridimensionelle de CYP51 de Mycobacterium tuberculosis compléxées avec un triazole a été obtenue par cristallisation et analyse au rayon

X (Podust et al. 2007). La modélisation de la CYP51 d’A. euteiches pourrait être envisagée, le modèle obtenu pourra être utilisé pour cribler in silico des triazoles et identifier ainsi de nouveaux inhibiteurs efficaces contre A. euteiches.

L’efficacité in vitro de deux triazoles, le tébuconazole et l’époxiconazole pourrait être une première étape vers la validation de ces composés pour leur utilisation en plein champ. La mise en place d’un traitement phytosanitaire contre A. euteiches utilisant un triazole nécessite l’étude et la validation préalable de son effet sur le processus infectieux en conditions

115 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Chapitre 5 : Discussion - contrôlées en chambre climatique. La difficulté à lutter contre A. euteiches réside dans le caractère racinaire du pathogène et dans son mode de vie. En effet, la persistance d’oospores dans le sol, à des profondeurs pouvant atteindre plus de 60cm, rend très difficile la lutte chimique mais permet toujours un apport phytosanitaire peut-être non négligeable et qui pourrait être combiné avec les méthodes de lutte génétique utilisant des variétés résistantes à

A. euteiches.

4. Conclusion

Les recherches menées au cours de ce travail de thèse ont intégré diverses approches permettant d’approfondir nos connaissances sur un microorganisme jusqu'alors peu connu.

L’apport de la génomique et de la métabolomique ont permis, chez A. euteiches, d’identifier de nouvelles protéines candidates au rôle d’effecteurs et de voies métaboliques absentes des autres oomycètes comme la biosynthèse des stérols. Ces éléments identifiés par différentes approches permettront la mise en place de nouveaux programme de recherche afin de mieux gérer la lutte contre ce pathogène racinaire. A l’heure où la culture de légumineuses, comme le pois et le haricot, est une des meilleures alternatives face à l’importation massive de soja d’origine américaine, la compréhension de la biologie d’A. euteiches pourrait être un atout majeur pour mieux protéger les cultures de légumineuses d’une maladie qui reste encore non maitrisée.

116 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Références -

Références

117 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Références -

Armstrong, M. R., S. C. Whisson, L. Pritchard, J. I. Bos, E. Venter, A. O. Avrova, A. P. Rehmany, U. Bohme, K. Brooks, I. Cherevach, N. Hamlin, B. White, A. Fraser, A. Lord, M. A. Quail, C. Churcher, N. Hall, M. Berriman, S. Huang, S. Kamoun, J. L. Beynon, and P. R. Birch. 2005. An ancestral oomycete locus contains late blight avirulence gene Avr3a, encoding a protein that is recognized in the host cytoplasm. Proc Natl Acad Sci U S A 102 (21):7766-7771.

Ayers, W.A., G.C. Papavizas, and R.D Lumsden. 1969. Purification and properties of the Endopolygalacturonase of Aphanomyces euteiches. Phytopathology 62 (12):4417-4427.

Barrett-Bee, K., and G. Dixon. 1995. Ergosterol biosynthesis inhibition: a target for antifungal agents. Acta Biochim Pol 42 (4):465-479.

Benveniste, P. 1986. Sterol Biosynthesis. Ann Rev Plant Physiol 37:275-308.

Bhattacharjee, S., N. L. Hiller, K. Liolios, J. Win, T. D. Kanneganti, C. Young, S. Kamoun, and K. Haldar. 2006. The malarial host-targeting signal is conserved in the Irish potato famine pathogen. Plos Path 2 (5):e50.

Birch, P. R., A. P. Rehmany, L. Pritchard, S. Kamoun, and J. L. Beynon. 2006. Trafficking arms: oomycete effectors enter host plant cells. Trends Microbiol 14 (1):8-11.

Birch, P. R., P. C. Boevink, E. M. Gilroy, I. Hein, L. Pritchard, and S. C. Whisson. 2008. Oomycete RXLR effectors: delivery, functional redundancy and durable disease resistance. Curr Opin Plant Biol 11 (4):373-379.

Blein, J. P., P. Coutos-Thevenot, D. Marion, and M. Ponchet. 2002. From elicitins to lipid-transfer proteins: a new insight in cell signalling involved in plant defence mechanisms. Trends Plant Sci 7 (7):293-296.

Bligh, E. G., and W. J. Dyer. 1959. A rapid method of total lipid extraction and purification. Can J Biochem Physiol 37 (8):911-917.

Bos, J. I., T. D. Kanneganti, C. Young, C. Cakir, E. Huitema, J. Win, M. R. Armstrong, P. R. Birch, and S. Kamoun. 2006. The C-terminal half of Phytophthora infestans RXLR effector AVR3a is sufficient to trigger R3a-mediated hypersensitivity and suppress INF1-induced cell death in Nicotiana benthamiana. Plant J 48 (2):165-176.

Brown, T. A., A. M. Grooters, and G. L. Hosgood. 2008. In vitro susceptibility of Pythium insidiosum and a Lagenidium sp to itraconazole, posaconazole, voriconazole, terbinafine, caspofungin, and mefenoxam. Am J Vet Res 69 (11):1463-1468.

Buhot, N., J. P. Douliez, A. Jacquemard, D. Marion, V. Tran, B. F. Maume, M. L. Milat, M. Ponchet, V. Mikes, J. C. Kader, and J. P. Blein. 2001. A lipid transfer protein binds to a receptor involved in the control of plant defence responses. FEBS Lett 509 (1):27-30.

Campagnac, E., J. Fontaine, A. L. Sahraoui, F. Laruelle, R. Durand, and A. Grandmougin-Ferjani. 2008. Differential effects of fenpropimorph and fenhexamid, two sterol biosynthesis inhibitor fungicides, on arbuscular mycorrhizal development and sterol metabolism in carrot roots. Phytochemistry 69 (17):2912-2919.

Cerenius, L., and K. Soderhall. 1985. Repeated zoospore emergence as a possible adaptation to parasitism in Aphanomyces. Exp Mycol 9 (3):259-263.

118 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Références -

Cheung, F., J. Win, J. M. Lang, J. Hamilton, H. Vuong, J. E. Leach, S. Kamoun, C. Andre Levesque, N. Tisserat, and C. R. Buell. 2008. Analysis of the Pythium ultimum transcriptome using Sanger and Pyrosequencing approaches. BMC Genomics 9:542.

Cooper, R. A. 1978. Influence of increased membrane cholesterol on membrane fluidity and cell function in human red blood cells. J Supramol Struct 8 (4):413-430.

Deacon, J.W. 1996. Ecological implications of recognition events in the pre-infection stages of root pathogens. New Phytologist 133 (1):135-145.

Deacon, J.W., and G. Saxena. 1998. Germination triggers of zoospore cysts of Aphanomyces euteiches and Phytophthora parasitica. Mycol Res 102:33-41.

Delwiche, P.A., C.R. Grau, E.B. Holub, and J.B. Perry. 1987. Characterisation of Aphanomyces euteiches Isolates Recovered from Alfalfa in Winsconsin. Plant Dis:155.

Dick, M.W., M.C. Vick, J.G. Gibbings, T.A. Hedderson, and C.C. Lopez-Lastra. 1999. 18S rDNA for species of Leptolegnia and other Peronosporomycetes: Justification for the subclass taxa Saprolegniomycetidae and Peronosporomycetidae and division of the Saprolegniaceae sensu lato into the Leptolegniaceae and Saprolegniaceae. Mycol. Res. 103:1119-1125.

Didelot, D., C. Maumene, and B. Carrouee. 1994. Root necrosis in peas. Perspectives Agricoles.

Dixon, D. C., J. R. Cutt, and D. F. Klessig. 1991. Differential targeting of the tobacco PR-1 pathogenesis-related proteins to the extracellular space and vacuoles of crystal idioblasts. Embo J 10 (6):1317-1324.

Do, H. Q., L. Van Landeghem, G. Wielgosz-Collin, M. Takoudju, J. M. Huvelin, J. M. Kornprobst, J. M. Bard, G. Barnathan, and H. Nazih. 2009. Unusual sterolic mixture, and 24-isopropylcholesterol, from the sponge Ciocalypta sp. reduce cholesterol uptake and basolateral secretion in Caco-2 cells. J Cell Biochem.

Dou, D., S. D. Kale, X. Wang, R. H. Jiang, N. A. Bruce, F. D. Arredondo, X. Zhang, and B. M. Tyler. 2008. RXLR-mediated entry of Phytophthora sojae effector Avr1b into soybean cells does not require pathogen- encoded machinery. Plant Cell 20 (7):1930-1947.

Dou, D., S. D. Kale, X. Wang, Y. Chen, Q. Wang, R. H. Jiang, F. D. Arredondo, R. G. Anderson, P. B. Thakur, J. M. McDowell, Y. Wang, and B. M. Tyler. 2008. Conserved C-terminal motifs required for avirulence and suppression of cell death by Phytophthora sojae effector Avr1b. Plant Cell 20 (4):1118-1133.

Dunstan, G. A., M. R. Brown, and J. K. Volkman. 2005. Cryptophyceae and rhodophyceae; chemotaxonomy, phylogeny, and application. Phytochemistry 66 (21):2557-2570.

Edwards, J. A., J. S. Mills, J. Sundeen, and J. H. Fried. 1969. The synthesis of the fungal sex hormone antheridiol. J Am Chem Soc 91 (5):1248-1249.

Fagerlund, U. H., and D. R. Idler. 1961. Marine sterols. IX. Biosynthesis of 24-methylenecholesterol in clams. Can J Biochem Physiol 39:1347-1355.

Flor, H.H. 1941. Pathogenicity of aeciospores obtained by selfing and crossing known physiologic races of Melampsora lini. Phytopathology 31:852-854.

119 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Références -

Francisco, C., G. Combaut, J. Teste, and B. F. Maume. 1977.[Study of sterols from brown seaweeds of the genus Cytoseira. Identification by gas-liquid chromatography coupled with mass spectrometry. Biochim Biophys Acta 487 (1):115-121.

Gaulin, E., C. Jacquet, A. Bottin, and B. Dumas. 2007. Root rot disease of legumes caused by Aphanomyces euteiches. Mol Plant Pathol 8:539-548.

Gaulin, E., A. Jauneau, F. Villalba, M. Rickauer, M. T. Esquerre-Tugaye, and A. Bottin. 2002. The CBEL glycoprotein of Phytophthora parasitica var-nicotianae is involved in cell wall deposition and adhesion to cellulosic substrates. J Cell Sci 115 (Pt 23):4565-4575.

Gaulin, E., M. A. Madoui, A. Bottin, C. Jacquet, C. Mathe, A. Couloux, P. Wincker, and B. Dumas. 2008. Transcriptome of Aphanomyces euteiches: New Oomycete Putative Pathogenicity Factors and Metabolic Pathways. Plos one 3 (3):e1723.

Gaulin, E., N. Drame, C. Lafitte, T. Torto-Alalibo, Y. Martinez, C. Ameline-Torregrosa, M. Khatib, H. Mazarguil, F. Villalba-Mateos, S. Kamoun, C. Mazars, B. Dumas, A. Bottin, M. T. Esquerre-Tugaye, and M. Rickauer. 2006. Cellulose binding domains of a Phytophthora cell wall protein are novel pathogen-associated molecular patterns. Plant Cell 18 (7):1766-1777.

Giner, J. L., X. Li, and G. L. Boyer. 2001. Sterol composition of Aureoumbra lagunensis, the Texas brown tide alga. Phytochemistry 57 (5):787-789.

Goad, L. J., and T. W. Goodwin. 1966. The biosynthesis of sterols in higher plants. Biochem J 99 (3):735-746.

Goad, L. 1969. Studies in phytosterol biosynthesis: observations on the biosynthesis of fucosterol in the marine brown alga Fucus spiralis. Eur J Biochem 7 (4):502-508.

Goad, L. J., G. G. Holz, Jr., and D. H. Beach. 1984. Sterols of Leishmania species. Implications for biosynthesis. Mol Biochem Parasitol 10 (2):161-170.

Gomez-Alpizar, L., I. Carbone, and J. B. Ristaino. 2007. An Andean origin of Phytophthora infestans inferred from mitochondrial and nuclear gene genealogies. Proc Natl Acad Sci U S A 104 (9):3306-3311.

Govers, F., and M. Gijzen. 2006. Phytophthora genomics: the plant destroyers' genome decoded. Mol Plant Microbe Interact 19 (12):1295-1301.

Greenhalgh, F.C., P.R. Merriman, and PJ Keane. 1985. Aphanomyces Euteiches, a Cause of Root Rot of Subterranean Clover in Victoria. Aus Plant Pathol 14 (2):34-37.

Groll, A. H., A. J. De Lucca, and T. J. Walsh. 1998. Emerging targets for the development of novel antifungal therapeutics. Trends Microbiol 6 (3):117-124.

Hackett, J. D., H. S. Yoon, S. Li, A. Reyes-Prieto, S. E. Rummele, and D. Bhattacharya. 2007. Phylogenomic analysis supports the monophyly of cryptophytes and haptophytes and the association of rhizaria with chromalveolates. Mol Biol Evol 24 (8):1702-1713.

Hagedorn, D.J. 1984. Compendium of pea diseases. Edited by A. P. Soc. American Phytopathological Society ed.

Haldar, K., S. Kamoun, N. L. Hiller, S. Bhattacharje, and C. van Ooij. 2006. Common infection strategies of pathogenic eukaryotes. Nat Rev Microbiol 4 (12):922-931.

120 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Références -

Harper, J. T., E. Waanders, and P. J. Keeling. 2005. On the monophyly of chromalveolates using a six-protein phylogeny of eukaryotes. Int J Syst Evol Microbiol 55 (Pt 1):487-496.

Haslewood, G. A. 1939. Metabolism of steroids: The isolation of 7-hydroxycholesterol and of the "hepatols" from ox liver. Biochem J 33 (5):709-712.

Hatai, K., and G. Hoshiai. 1992. Mass mortality in cultured coho salmon (Oncorhynchus kisutch) due to Saprolegnia parasitica coker. J Wildlife Dis 28 (4):532-536.

Hendrix, J. W. 1964. Sterol Induction of Reproduction and Stimulation of Growth of Pythium and Phytophthora. Science 144:1028-1029.

Hendrix, J.W. 1970. Sterols in growth and reproduction of fungi. Annu Rev Phytopathol 8:111-130.

Hudspeth, D.S.S. Nadler, S.A. Hudspeth, ME.S. 2000. A COX2 Molecular Phylogeny of the Peronosporomycetes. Mycologia, Vol. 92, No. 4, 674-684

Kaku, K., and Y. Hiraga. 2003. Sterol composition of a cultured marine dinoflagellate, Heterocapsa circularisquama. Nat Prod Res 17 (4):263-267.

Kamoun, S. 2006. A catalogue of the effector secretome of plant pathogenic oomycetes. Annu Rev Phytopathol 44:41-60.

Kamoun, S., P. Hraber, B. Sobral, D. Nuss, and F. Govers. 1999. Initial assessment of gene diversity for the oomycete pathogen Phytophthora infestans based on expressed sequences. Fungal Genet Biol 28 (2):94-106.

Karst, F., and F. Lacroute. 1977. Ergosterol biosynthesis in Saccharomyces cerevisiae. Molecular and General Genetics MGG 154 (3):269-277.

Kjøller, R., and S. Rosendahl. 1998. Enzymatic Activity of the Mycelium Compared with Oospore Development During Infection of Pea Roots by Aphanomyces euteiches. Phytopathology 88 (9):992-996.

Kodner, R.B., R. E. Summons, A. Pearson, N. King, A. H. Knoll. 2008. Sterols in a unicellular relative of the metazoans. Proc Natl Acad Sci U S A.. 105(29): 9897-9902.

Labrousse, F. 1933. Notes de pathologie végétale. Rev. Pathol. Veg. Ent. Ag. 19,:71–84.

Lamb, D. C., D. E. Kelly, N. J. Manning, and S. L. Kelly. 1998. A sterol biosynthetic pathway in Mycobacterium. FEBS Lett 437 (1-2):142-144.

Le Berre, J. Y., G. Engler, and F. Panabieres. 2008. Exploration of the late stages of the tomato-Phytophthora parasitica interactions through histological analysis and generation of expressed sequence tags. New Phytol 177 (2):480-492.

Li, S., T. Nosenko, J. D. Hackett, and D. Bhattacharya. 2006. Phylogenomic analysis identifies red algal genes of endosymbiotic origin in the chromalveolates. Mol Biol Evol 23 (3):663-674.

Lockwood, J.L. 1960. Factors affecting zoospore production by Aphanomyces euteiches. Phytopathology.

Madoui, M. A., E. Gaulin, C. Mathe, H. San Clemente, A. Couloux, P. Wincker, and B. Dumas. 2007. AphanoDB: a genomic resource for Aphanomyces pathogens. BMC Genomics 8:471.

121 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Références -

Madoui, M. A., J. Bertrand-Michel, E. Gaulin, B. Dumas. 2009. Sterol Metabolism in the Oomycete Aphanomyces euteiches, a Legume Root Pathogen. New Phytol. 183(2):291-300.

Malvick, D., and J.A. Percich. 1998. Variation in Pathogenicity and Genotype Among Single-Zoospore Strains of Aphanomyces euteiches. Phytopathology 88 (1).

Margulis, L., and K.V. Schwartz. 1998. Five Kingdoms: an illustrated guide to the Phyla of life on earth line. 3rd edition ed. New York: Freeman.

Martens, C., K. Vandepoele, and Y. Van de Peer. 2008. Whole-genome analysis reveals molecular innovations and evolutionary transitions in Chromalveolate species. Proc Natl Acad Sci U S A 105 (9):3427-332.

Maufras, J.Y. 1997. Les maladies racinaires du pois. Vol. 226, Perspectives Agricoles (France).

Mendoza, L., F. Hernandez, and L. Ajello. 1993. Life cycle of the human and animal oomycete pathogen Pythium insidiosum. J Clin Microbiol 31 (11):2967-2973.

Mikes, V., M. L. Milat, M. Ponchet, F. Panabieres, P. Ricci, and J. P. Blein. 1998. Elicitins, proteinaceous elicitors of plant defense, are a new class of sterol carrier proteins. Biochem Biophys Res Commun 245 (1):133- 139.

Mullins, J. T., and E. A. Ellis. 1974. Sexual morphogenesis in Achlya: ultrastructural basis for the hormonal induction of antheridial hyphae. Proc Natl Acad Sci U S A 71 (4):1347-1350.

Nes, W. D. 2000. Sterol methyl transferase: enzymology and inhibition. Biochim Biophys Acta 1529 (1-3):63-88.

Nes, W. D., and A. E. Stafford. 1983. Evidence for metabolic and functional discrimination of sterols by Phytophthora cactorum. Proc Natl Acad Sci U S A 80 (11):3227-3231.

Nes, W. D., R. A. Norton, F. G. Crumley, S. J. Madigan, and E. R. Katz. 1990. Sterol phylogenesis and algal evolution. Proc Natl Acad Sci U S A 87 (19):7565-7569.

Nusbaum, C. 2008. Phytophthora infestans Database.

Panabieres, F., J. Amselem, E. Galiana, and J. Y. Le Berre. 2005. Gene identification in the oomycete pathogen Phytophthora parasitica during in vitro vegetative growth through expressed sequence tags. Fungal Genet Biol 42 (7):611-623.

Papavizas, GC., and W.A. Ayers. 1974. Aphanomyces species and their root diseases in pea and sugarbeet. Agric. Res. Serv. Tech.

Patterson, D. J., and J.O. Corliss. 1989. Progress in protistology. Biopress 3.

Pearson, A., M. Budin, and J. J. Brocks. 2003. Phylogenetic and biochemical evidence for sterol synthesis in the bacterium Gemmata obscuriglobus. Proc Natl Acad Sci U S A 100 (26):15352-15357.

Pfender, W.F., and D.J. Hagedorn. 1983. Disease Progress and Yield Loss in Aphanomyces Root Rot of Peas. Phytopathology 73:1109-1113.

Podust, L. M., J. P. von Kries, A. N. Eddine, Y. Kim, L. V. Yermalitskaya, R. Kuehne, H. Ouellet, T. Warrier, M. Altekoster, J. S. Lee, J. Rademann, H. Oschkinat, S. H. Kaufmann, and M. R. Waterman. 2007. Small-

122 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Références - molecule scaffolds for CYP51 inhibitors identified by high-throughput screening and defined by X-ray crystallography. Antimicrob Agents Chemother 51 (11):3915-3923.

Ponchet, M., F. Panabieres, M. L. Milat, V. Mikes, J. L. Montillet, L. Suty, C. Triantaphylides, Y. Tirilly, and J. P. Blein. 1999. Are elicitins cryptograms in plant-Oomycete communications? Cell Mol Life Sci 56 (11- 12):1020-1047.

Qutob, D., P. T. Hraber, B. W. Sobral, and M. Gijzen. 2000. Comparative analysis of expressed sequences in Phytophthora sojae. Plant Physiol 123 (1):243-54.

Raederstorff, D., and M. Rohmer. 1987. Sterol biosynthesis via cycloartenol and other biochemical features related to photosynthetic phyla in the amoeba Naegleria lovaniensis and Naegleria gruberi. Eur J Biochem 164 (2):427-434.

Randall, T. A., R. A. Dwyer, E. Huitema, K. Beyer, C. Cvitanich, H. Kelkar, A. M. Fong, K. Gates, S. Roberts, E. Yatzkan, T. Gaffney, M. Law, A. Testa, T. Torto-Alalibo, M. Zhang, L. Zheng, E. Mueller, J. Windass, A. Binder, P. R. Birch, U. Gisi, F. Govers, N. A. Gow, F. Mauch, P. van West, M. E. Waugh, J. Yu, T. Boller, S. Kamoun, S. T. Lam, and H. S. Judelson. 2005. Large-scale gene discovery in the oomycete Phytophthora infestans reveals likely components of phytopathogenicity shared with true fungi. Mol Plant Microbe Interact 18 (3):229-243.

Rentel, M. C., L. Leonelli, D. Dahlbeck, B. Zhao, and B. J. Staskawicz. 2008. Recognition of the Hyaloperonospora parasitica effector ATR13 triggers resistance against oomycete, bacterial, and viral pathogens. Proc Natl Acad Sci U S A 105 (3):1091-1096.

Ricci, P., P. Bonnet, J. C. Huet, M. Sallantin, F. Beauvais-Cante, M. Bruneteau, V. Billard, G. Michel, and J. C. Pernollet. 1989. Structure and activity of proteins from pathogenic fungi Phytophthora eliciting necrosis and acquired resistance in tobacco. Eur J Biochem 183 (3):555-563.

Rog, T., M. Pasenkiewicz-Gierula, I. Vattulainen, and M. Karttunen. 2009. Ordering effects of cholesterol and its analogues. Biochim Biophys Acta 1788 (1):97-121.

Scott, W. 1961. A monograph of the genus Aphanomyces. Virginia Agr. 151:91–95.

Shan, W., J. S. Marshall, and A. R. Hardham. 2004. Gene expression in germinated cysts of Phytophthora nicotianae. Molec. Plant Pathol. 5:317-330.

Shan, W., M. Cao, D. Leung, and B. M. Tyler. 2004. The Avr1b locus of Phytophthora sojae encodes an elicitor and a regulator required for avirulence on soybean plants carrying resistance gene Rps1b. Mol Plant Microbe Interact 17 (4):394-403.

Shang, H., C.R. Grau, and R.D. Peters. 2000. Evidence of gene flow between pea and bean pathotypes of Aphanomyces euteiches. Can J Plant Pathology 22:265-275.

Shang, H., C. R. Grau, and R. D. Peters. 2000. Oospore Germination of Aphanomyces euteiches in Root Exudates and on the Rhizoplanes of Crop Plants. Plant Dis 84 (9):994-998.

Skalamera, D., A. P. Wasson, and A. R. Hardham. 2004. Genes expressed in zoospores of Phytophthora nicotianae. Mol Genet Genomics 270 (6):549-557.

Smith, A. G., I. Rubinstein, and L. J. Goad. 1973. The sterols of the echinoderm Asterias rubens. Biochem J 135 (3):443-455.

123 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Références -

Sohn, K. H., R. Lei, A. Nemri, and J. D. Jones. 2007. The downy mildew effector proteins ATR1 and ATR13 promote disease susceptibility in Arabidopsis thaliana. Plant Cell 19 (12):4077-4090.

Solovyev, V. V., A. A. Salamov, and C. B. Lawrence. 1994. Predicting internal exons by oligonucleotide composition and discriminant analysis of spliceable open reading frames. Nucleic Acids Res 22 (24):5156-63.

Teixeira ZulloI, M.A., and G. Adam. 2002. Brassinosteroid phytohormones - structure, bioactivity and applications. Braz J Plant Physiol 4 (3).

Tian, M., E. Huitema, L. Da Cunha, T. Torto-Alalibo, and S. Kamoun. 2004. A Kazal-like extracellular serine protease inhibitor from Phytophthora infestans targets the tomato pathogenesis-related protease P69B. J Biol Chem 279 (25):26370-26377.

Tofte, J.E., R.R. Smith, and C.R. Grau. 1992. Reaction of red clover to Aphanomyces euteiches. Plant Dis 76 (1):39-42.

Torto, T. A., S. Li, A. Styer, E. Huitema, A. Testa, N. A. Gow, P. van West, and S. Kamoun. 2003. EST mining and functional expression assays identify extracellular effector proteins from the plant pathogen Phytophthora. Genome Res 13 (7):1675-1685.

Torto-Alalibo, T., M. Tian, K. Gajendran, M. E. Waugh, P. van West, and S. Kamoun. 2005. Expressed sequence tags from the oomycete fish pathogen Saprolegnia parasitica reveal putative virulence factors. BMC Microbiol 5:46-58.

Tripathy, S., V. N. Pandey, B. Fang, F. Salas, and B. M. Tyler. 2006. VMD: a community annotation database for oomycetes and microbial genomes. Nucleic Acids Res 34 (Database issue):D379-381.

Tyler, B. M. 2008. Entering and breaking: virulence effector proteins of oomycete plant pathogens. Cell Microbiol.

Tyler, B. M., S. Tripathy, X. Zhang, P. Dehal, R. H. Jiang, A. Aerts, F. D. Arredondo, L. Baxter, D. Bensasson, J. L. Beynon, J. Chapman, C. M. Damasceno, A. E. Dorrance, D. Dou, A. W. Dickerman, I. L. Dubchak, M. Garbelotto, M. Gijzen, S. G. Gordon, F. Govers, N. J. Grunwald, W. Huang, K. L. Ivors, R. W. Jones, S. Kamoun, K. Krampis, K. H. Lamour, M. K. Lee, W. H. McDonald, M. Medina, H. J. Meijer, E. K. Nordberg, D. J. Maclean, M. D. Ospina-Giraldo, P. F. Morris, V. Phuntumart, N. H. Putnam, S. Rash, J. K. Rose, Y. Sakihama, A. A. Salamov, A. Savidor, C. F. Scheuring, B. M. Smith, B. W. Sobral, A. Terry, T. A. Torto- Alalibo, J. Win, Z. Xu, H. Zhang, I. V. Grigoriev, D. S. Rokhsar, and J. L. Boore. 2006. Phytophthora genome sequences uncover evolutionary origins and mechanisms of pathogenesis. Science 313 (5791):1261-1266.

Unestam, T., and D. W. Weiss. 1970. The host-parasite relationship between freshwater crayfish and the crayfish disease fungus Aphanomyces astaci: responses to infection by a susceptible and a resistant species. J Gen Microbiol 60 (1):77-90. van Poppel, P. M., J. Guo, P. J. van de Vondervoort, M. W. Jung, P. R. Birch, S. C. Whisson, and F. Govers. 2008. The Phytophthora infestans Avirulence Gene Avr4 Encodes an RXLR-dEER Effector. Mol Plant Microbe Interact 21 (11):1460-1470. van West, P. 2008. New insights into animal pathogenic oomycetes. Trends Microbiol 16 (1):9-13.

Veen, M., and C. Lang. 2005. Interactions of the ergosterol biosynthetic pathway with other lipid pathways. Biochem Soc Trans 33 (Pt 5):1178-1181.

124 Génomique fonctionnelle d’Aphanomyces euteiches, un parasite des légumineuses - Références -

Vennerström, P., P. Söderhäll, and L. Cerenius. 1998. The origin of two crayfish plague (Aphanomyces astaci) epizootics in Finland on noble crayfish, Astacus astacus. Ann Zool Fenn 35:43-46.

Volkman, J. K. 2003. Sterols in microorganisms. Appl Microbiol Biotechnol 60 (5):495-506.

Warner, S. A., D. F. Eierman, G. W. Sovocool, and A. J. Domnas. 1982. Cycloartenol-derived sterol biosynthesis in the Peronosporales. Proc Natl Acad Sci U S A 79 (12):3769-3772.

Weiland, J., and J.M. MacGrath. 2006. An Est Database of the Sugarbeet Pathogen, Aphanomyces Cochlioides.

Wicker, E., M. Hulle, and F. Rouxel. 2001. Pathogenic characteristics of isolates of Aphanomyces euteiches from pea in France. Plant pathol 50 (4):433-442.

Whisson, S.C. Boevink, P.C. Moleleki1, L. Avrova1, A.O. Morales J.G. Gilroy1, E.M. Armstrong, M.R. Grouffaud, S. van West, P. Chapman, S. Hein, I. Toth, I.K. Pritchard, L. Birch, P.R.J. 2007. A translocation signal for delivery of oomycete effector proteins into host plant cells. Nature 450, 115-118

Wrather, J.A, T.R. Anderson, D.M. Arsyad, Y. Tan, L.D. Ploper, A. Porta-Puglia, H.H Ram, and J.T. Yorinori. 2001. Soybean disease loss estimates for the top ten soybean-producing countries in 1998. Can. J. Plant Pathol 23:115-121.

Yokozawa, R., S. Kuninaga, and M. Teranaka. 1974. Note on pea root rot fungus, Aphanomyces euteiches drechs. in Japan. Ann of Phytopathol Society of Jap 40:454-457.

125 Résumé

Les oomycètes sont des microorganismes eucaryotes responsables de maladies dévastatrices chez les plantes cultivées. La pourriture racinaire causée par l’oomycète Aphanomyces euteiches est à l'origine de dommages importants sur les cultures de légumineuses. Afin d’identifier les effecteurs du pouvoir pathogène et de mieux connaitre le métabolisme d'A. euteiches, une analyse globale du transcriptome a été réalisée. L’analyse bioinformatique de 20 000 ADNc issus de la souche ATCC201684 a conduit à la mise en place d’une base de données accessible en ligne, AphanoDB, sur laquelle les ESTs assemblées et annotées ont été déposées. L’exploitation d’AphanoDB a permis l’identification de nouveaux effecteurs putatifs du pouvoir pathogène et de voies métaboliques originales comme celle des stérols. L'étude de ce métabolisme a été approfondie par une approche biochimique. Contrairement à d'autre oomycètes comme Phytophthora, incapables de synthétiser des stérols, A. euteiches possède tous les gènes nécessaires à leur synthèse. L’analyse biochimique des stérols d’A. euteiches a montré que le fucostérol correspond au stérol majoritaire. L’inhibition de la synthèse de stérols par des triazoles comme le tébuconazole et l’époxiconazole a conduit à une inhibition de la croissance mycélienne. L'ensemble de ces travaux, associant des approches génomique et biochimique, ont permis une meilleur compréhension de la biologie et du pouvoir pathogène d'A. euteiches. Ils permettront à terme de définir de nouvelles pistes de recherches pour lutter plus efficacement contre la pourriture racinaire des légumineuses.

Abstract

Oomycetes are a group of eukaryotic microorganisms causing devastating diseases on crops. Pea root rot disease caused by the oomycete Aphanomyces euteiches is the causal agent of important damages on legumes. To identify effectors of pathogenicity and metabolic pathways a transcriptomic approach was developped. In silico analysis of 20, 000 cDNAs obtained from the ATCC201684 strain led to the development of a database, AphanoDB, which is an online genomic ressource containing processed A. euteiches ESTs. Data mining on AphanoDB allowed identifying new putatives effectors, and metabolic pathways, such as a sterol biosynthesis pathway. While most of oomycetes such as Phytophthora are unable to produce their own sterols, all the genes required for sterol synthesis were found in A. euteiches. Biochemical analysis showed that fucosterol is the major A. euteiches sterol. Inhibition of sterol synthesis with triazoles, such as tebuconazole and epoxiconazole, led to an inhibition of mycelial growth. This study is the first overview of A.euteiches genomic, transcriptomic and metabolism that paves the way to the identification of new molecular targets to design anti-Aphanomyces chemicals.

Mots-clés : Straménopiles, oomycètes, Aphanomyces euteiches, légumineuses, génomique, Expressed Sequenced Tag, ADNc, base de données, effecteurs du pouvoir pathogène, stérols, fucostérol, triazoles.