Detecting Conserved Regulatory Elements with the Model Genome Of

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Proc. Natl. Acad. Sci. USA Vol. 92, pp. 1684-1688, February 1995 Genetics Detecting conserved regulatory elements with the model genome of the Japanese puffer fish, Fugu rubripes SAMUEL APARICIO*t, ALASTAIR MORRISONt, ALEX GOULDt, JONATHAN GILTHORPE§, CHITRITA CHAUDHURIt, PETER RIGBY§, ROBB KRUMLAUF*, AND SYDNEY BRENNER* *Molecular Genetics Unit, Department of Medicine, Addenbrookes Hospital, Cambridge CB2 2QQ, United Kingdom; iLaboratory of Developmental Neurobiology and §Laboratory of Eukaryotic Molecular Genetics at Medical Research Council National Institute for Medical Research, The Ridgeway Mill Hill, London NW7 1AA, United Kingdom Contributed by Sydney Brenner, October 26, 1994 ABSTRACT Comparative vertebrate genome sequencing with a Mg2+ concentration of 1.5 mM final. A A2001 Sau3AI offers a powerful method for detecting conserved regulatory Fugu genomic library (1) was screened at high stringency with sequences. We propose that the compact genome of the teleost this probe by using the method of Church and Gilbert (9). A Fugu rubripes is well suited for this purpose. The evolutionary phage designated H26S6A1 was obtained after three rounds of distance of teleosts from other vertebrates offers the maxi- plaque purification that contained the Hoxb-4 gene. The re- mum stringency for such evolutionary comparisons. To illus- gion from an internalEcoRI restriction site to the A polylinker, trate the comparative genome approach forF. rubripes, we use approximately 11.4 kb, was subcloned and sequenced by the sequence comparisons between mouse and Fugu Hoxb-4 non- dideoxynucleotide method (10) on an ABI373A DNA se- coding regions to identify conserved sequence blocks. We have quencer according to the manufacturer's instructions. used two approaches to test the function of these conserved DNA Sequence Analysis. The conceptual translation ofFugu blocks. In the first, homologous sequences were deleted from and mouse Hoxb-4 DNA sequences (see Fig. 1) was aligned by a mouse enhancer, resulting in a tissue-specific loss ofactivity using CLUSTALV (11). Regions of nucleotide sequence simi- when assayed in transgenic mice. In the second approach, larity were detected with two methods. First, pairwise DNA Fugu DNA sequences showing homology to mouse sequences alignments were made by using xsip in the Staden suite of were tested for enhancer activity in transgenic mice. This programs (12). The scoring matrix used was the default strategy identified a neural element that mediates a subset of MDM78, the identity score was 6, the odd-span length was 9, Hoxb-4 expression that is conserved between mammals and the proportional score was taken as default, and the standard teleosts. The comparison of noncoding vertebrate sequences deviation above the mean was 2.5. Regions of similarity appear with those of Fugu, coupled to a transgenic bioassay, repre- as continuous lines on the plots. These subregions were then sents a general approach suitable for many genome projects. either locally aligned by using the Smith-Waterman algorithm or searched for the best local similarity (13) by using the The major challenges for all genome projects will be decipher- programs high, mediurn, and low (J. Parsons, personal ing gene function and regulation. In the absence of useful communication) to search larger tracts of sequence for short grammars, testing the value of sequences by transgenesis is an similarity blocks. important approach to finding regulatory information buried Generation of Transgenic Mice. Regulatory regions were in the noncoding regions that constitute 95% of mammalian inserted into two basic lacZ reporter constructs that used genomes; however, transgenic analysis is costly and labor in- either the hsp68 promoter (p610Za; ref. 6) or the Hoxb-4 tensive, and means of facilitating this approach are required. promoter (construct 8; ref. 6). Construct 1 contains the mouse We have shown (1) that the Japanese puffer fish Fugu rubripes 1.38-kb Sal I-Bgl II fragment ofHoxb-4 (wild type). Construct (Fugu) has a compact vertebrate genome and propose that one 2 contains a 1.28-kb Sal I-Bgl II fragment from mouse Hoxb-4, use of Fugu is the discovery of conserved gene regulatory where the conserved region (CR1) was deleted by removing sequences by comparison of Fugu noncoding sequences with the internal Mun I-Sfi I fragment. Construct 3 contains a 3-kb those of higher vertebrates. The HOM/Hox complexes are HindIII-Nco I mouse Hoxb-4 fragment. Construct 4 contains some of the best studied cases of structural, functional, and a 5.1-kbXho I-Sal I fragment from phage H26S6A1 containing regulatory conservation (2-5), and we therefore chose Fugu Fugu Hoxb-4. Construct 5 contains the 250-bp conserved CR2 Hox genes as examples to study the degree of conservation in region generated by PCR with oligonucleotides (BAM- gene regulation. As part of a systematic analysis of the Fugu TCTTGGTTCATGTTCTTTTAATGC and BAM-CTCTT- Hox gene clusters, the Hoxb-4 gene was cloned and sequenced, GCTCTATATTTTTCGATAC; BAM, a BamHI restriction since the regulation and function of this gene have been enzyme recognition sequence for cloning) from phage examined in detail in mice (6-8). Here we show that sequence H26S6A1. Construct 6 contains the 300-bp CR3 region gen- comparisons between Fugu and mouse can be used to identify erated by PCR with oligonucleotides (BAM-TCTTTTAAT- conserved regulatory elements that direct subsets of the full GTGAATGGGAGCAG and BAM-GGGTGTGAGTGTG- Hoxb-4 expression pattern in transgenic mice. TAGACGTACGC) from phage H26S6A1. All inserts were released from vector sequences prior to microinjection. MATERIALS AND METHODS Animal experiments were performed according to proce- Cloning and Sequencing of Fugu Hoxb-4. Degenerate PCR dures regulated under the project licences issued by the Home primers hox26rl and hox26fl whose sequences were derived Office and the Genetic Manipulation Advisory Group. The from the human and mouse Hoxb-4 exon 2 sequences were generation and analysis of transgenic mice from F1 hybrids used to amplify and clone a fragment of Fugu Hoxb-4 from (CBA x C57BL/6) were as described (6). Pseudopregnant Fugu genomic DNA. Taq DNA polymerase (Cetus) was used females were injected intraperitoneally with the anaesthetic Avertin at a dose of0.015-0.017 ml of a 2.5% solution per gram The publication costs of this article were defrayed in part by page charge payment. This article must therefore be hereby marked "advertisement" in Abbreviations: rn, rhombomere number; dpc, days post coitum. accordance with 18 U.S.C. §1734 solely to indicate this fact. tTo whom correspondance and reprint requests should be addressed. 1684 Downloaded by guest on September 26, 2021 Genetics: Aparicio et al. Proc. Natl. Acad. Sci. USA 92 (1995) 1685 of body weight prior to embryo transfer. Embryos were pho- tographed with the aid of a Leitz M10 stereomicroscope and A Mouse MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESGFQPEAAFGRRAPC camera. The numbers of embryos in each experiment are MAMSSYLINSNYVDPKFPPCEEYSQSDYLP-NHSPDYYSSQRQEPAAQPfDS.LYHHHPHH expressed in the figure legends as follows: the number of Fugu embryos with the pattern shown/total number of embryos Mouse TVQR.----A--YAACRDPGPPPPPPPPPPPPP2GLSPRAPVQPTAG---ALLPEPGQRSEA expressing lacZ. Fugu PQHQQRAEPPYTQCQRAGQPASVV -- MSPRGHVLPPSGLQTTPVPEQSHRCES Mouse VSSSPPPPP-CAQNPLHPSPSHSAC--KEPVVYPWMRKVHVSTVNPNYAGGEPKRSRTAY RESULTS Fugu VTPSPPPPPSCGQTPHSQGASSPASTRKDPVVYPWMKKVHVNIVSSNYTGGEPKRSRTAY Sequence Comparisons. Conceptual translation and com- Mouse TRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKI.PNTKIR parison of the cloned Fugu DNA sequence with the mouse Fugu TRQQVLELEKEFHYNRYLTRRRRVEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKVR Hoxb-4 sequence reveals multiple regions of similarity over the Mouse SGGTAGAAGGPPGRPNGGPPAL entire protein, confirming the Fugu sequence as Hoxb-4 (Fig. Fugu SGSTNTNSQVLTGSQNRTGP-L 1A). The pairwise identity score was 56% over the whole protein but approached 100% in the homeodomain region and B C3 90% in the N-terminal region diagnostic for paralogs in group I 4. The putative splice junction corresponds in phase and po- 0.6 sition to the mouse sequence. At the nucleotide level the C < 2 0 sequence was closer to b-4 than to other group 4 paralogs (data 0.4 0 wr not shown). a) 0 e'10 Most Fugu genes are smaller than their mammalian coun- 0.2 terparts because of unexpanded introns (ref. 1 and unpub- 0 /-k1- lished observations). However, in Hoxb-4 the introns in Fugu '. -, ,I and mammals are of a similar size; we presume that this is 0.5 0 1 -- 2 3 because of functional constraints during evolution due to the Fugu. intron, kb Fugu region A, kb presence of transcriptional regulatory elements within the D regionC regionA intron. Sequence comparisons between the intron and 3' non- B coding regions of mouse and Fugu Hoxb-4 revealed three Mouse 17 op1 Sa 1Bg Nc positionally conserved islands of sequence homology (Fig. 1 B #1 and C). It is intriguing that these sequences mapped within two - A +IacZ #2 large noncoding regions of mouse Hoxb-4 previously shown to 1kb contain enhancers that direct major aspects of the spatially #3 restricted patterns of expression (6). The first conserved is- cr1 cr2 cr3 land, CR1, mapped within the region-C enhancer. Region C Fugu II a mediates the proper spatially restricted expression pattern of E Sa X Hoxb-4 in the mesoderm and gives a subset of the full Hoxb-4 I #4 pattern in the central and peripheral nervous systems. The H +lacZ #5 second and third conserved islands, CR2 and CR3, are located H _ #6 within the region-A enhancer. This 3-kb region, 3' of mouse Hoxb-4, directs expression in the neural tube with a sharp FIG. 1. Comparisons of Fugu and mouse Hoxb-4 genes. (A) Con- anterior boundary at the junction of rhombomeres 6 and 7 ceptual translation and alignment of Fugu Hoxb-4 and mouse Hoxb-4 (r6/7) in the hindbrain (Fig. 3 A and B and ref. 6). Posterior amino acid sequences. Identical residues are indicated with asterisks, to r6/7, expression extends back along the entire length of the and conservative amino acid differences are indicated with periods.
Recommended publications
  • Fish Fins Or Tetrapod Limbs

    Fish Fins Or Tetrapod Limbs

    CORE Metadata, citation and similar papers at core.ac.uk Provided by Elsevier - Publisher Connector MICHAEL . COATES LIMB EVOLUTION MICHAEL I. COATES LIMB EVOLUTION Fish fins or tetrapod limbs - a simple twist of fate? Comparisons between Hox gene expression patterns in teleost fins and tetrapod limbs are revealing new insights into the developmental mechanisms underlying the evolutionary transition from fin to limb. Phylogenetic trees represent nested patterns of develop- full breadth of the distal mesenchyme, coincident with mental diversification. Yet, until recently, attempts to link development of a 'digital arch' from which the digits will large-scale evolutionary morphological transformations form (see below, Fig 2c) [4]. Thus, HoxD expression to changes in ontogeny have yielded limited results. restriction is reoriented from an antero-posterior to a Explanations have usually characterized developmental proximo-distal axis [1,2]. HoxA expression, in contrast to evolution in terms of shifts in the relative timing of that of the HoxD members, shows no antero-posterior developmental events and alterations to gross embryonic restriction, and instead consists of a series of proximo- patterns, whether static or dynamic, instead of attempting distally nested bands spanning the entire bud (Fig.la). to identify changes affecting specific morphogenetic pro- cesses. But this situation is changing, largely because of The similarities and differences between the development rapid advances in the study of the genes that regulate of the tetrapod limb bud and that of the zebrafish fin bud development. Perhaps most significantly of all, after the are striking (Fig. lb). By comparison with limbs, fin bud initial interest that was inspired by the remarkably con- outgrowth ceases earlier; mesenchymal proliferation fin- served features of some of these developmental genes, ishes as the apical fin bud ectoderm transforms into a pro- research is now beginning to focus on their diversity.
  • Kenro Kusumi

    Kenro Kusumi

    July 2021 CURRICULUM VITAE Kenro Kusumi ADDRESS Arizona State University Dean Office of the Dean Armstrong Hall, Suite 240 1100 S McAllister Ave. Tempe, AZ 85287-2501, USA Telephone: (480) 965-8065 School Director School of Life Sciences PO Box 874501 Tempe, AZ 85287-4501, USA Telephone: (480) 727-8993 email [email protected] webpage-faculty https://sols.asu.edu/people/kenro-kusumi webpage-lab http://kusumi.lab.asu.edu/ LinkedIn https://www.linkedin.com/in/kenro-kusumi-496aa967/ Twitter @kenrokusumi Wikipedia https://en.wikipedia.org/wiki/Kenro_Kusumi EDUCATION 1984-1988 A.B., magna cum laude, Biochemical Sciences Harvard College, Cambridge, MA Undergraduate Advisors: Dan Stinchcomb & Daniel P. Kiehart Thesis: Identification of a Cytoplasmic Myosin-Like Protein in the Nematode C. elegans 1988–1997 Division of Health Sciences and Technology Program Harvard Medical School/Massachusetts Institute of Technology Completed medical school years 1-2 and USMLE Step 1 Exam 1990-1997 Ph.D., Biology Massachusetts Institute of Technology, Cambridge, MA Graduate Advisor: Eric S. Lander (member, Nat’l Acad Sci) Thesis: Positional Cloning and Characterization of the Mouse Pudgy Locus 1997-1998 Research Scientist Whitehead Institute for Biomedical Research, Cambridge, MA Postdoctoral Mentor: Eric S. Lander (member, Nat’l Acad Sci) 1998–2000 Hitchings-Elion Fellow of the Burroughs Wellcome Fund National Institute for Medical Research, London, UK Postdoctoral Mentor: Robb Krumlauf (member, Nat’l Acad Sci) Kenro Kusumi FACULTY APPOINTMENTS 2001-2006 Assistant
  • DEVELOPMENTAL BIOLOGY an Official Journal of the Society for Developmental Biology

    DEVELOPMENTAL BIOLOGY an Official Journal of the Society for Developmental Biology

    DEVELOPMENTAL BIOLOGY An official journal of the Society for Developmental Biology AUTHOR INFORMATION PACK TABLE OF CONTENTS XXX . • Description p.1 • Audience p.1 • Impact Factor p.1 • Abstracting and Indexing p.2 • Editorial Board p.2 • Guide for Authors p.5 ISSN: 0012-1606 DESCRIPTION . Developmental Biology (DB) publishes original research on mechanisms of development, differentiation, growth, homeostasis and regeneration in animals and plants at the molecular, cellular, genetic and evolutionary levels. Areas of particular emphasis include transcriptional control mechanisms, embryonic patterning, cell-cell interactions, growth factors and signal transduction, and regulatory hierarchies in developing plants and animals. Research Areas Include: Regulation of stem cells and regeneration Gene regulatory networks Morphogenesis and self organization Differentiation in vivo and in vitro (organoids) Growth factors and oncogenes Genetics and epigenetics of development Evolution of developmental control Analysis of development at the single cell level DB authors can choose among a selection of article types- research papers, short communications, technical reports, resource papers, reviews and perspectives - and benefit from academic editors who are practicing scientists, fast publication, no color figures or page charges, flexible publication (open access or subscription) and a vast readership with more than 3 million downloads a year. Subscription articles published in Developmental Biology will become accessible to non-subscribers 12 months after publication on ScienceDirect. SDB members benefit from immediate free online access to all published articles. For queries please contact our editorial office at [email protected] AUDIENCE . Cell and Developmental biologists. Focuses on: mechanisms of development, differentiation, and growth in animals and plants. IMPACT FACTOR . 2020: 3.582 © Clarivate Analytics Journal Citation Reports 2021 AUTHOR INFORMATION PACK 24 Sep 2021 www.elsevier.com/locate/ydbio 1 ABSTRACTING AND INDEXING .
  • Ready, Go! 14 July 2011

    Ready, Go! 14 July 2011

    Ready, go! 14 July 2011 general transcription factors reduces the number of steps required for productive transcription and allows cells to respond quickly to internal and external signals." Transcriptional control by RNA polymerase II (Pol II) is a tightly orchestrated, multistep process that requires the concerted action of a large number of players to successfully transcribe the full length of genes. For many years, the initiation of transcription-the assembly of the basal transcription machinery at the start site-was considered the rate- limiting step. "We know now that the elongation step is a major node for the regulation of gene expression," says Shilatifard. "In fact, we have shown that mislocated elongation factors are the The Super Elongation Complex (SEC) activates stalled RNA polymerase II in response to developmental and cause for pathogenesis of infant acute environmental cues. Credit: Courtesy of Dr. Ali lymphoblastic and mixed lineage leukemia." Shalitifard, Stowers Institute for Medical Research with permission of CSHL press. Mixed lineage leukemia is caused by a chromosomal translocation of the gene named MLL, resulting in its fusion to a seemingly random collection of other genes. Although the Just like orchestra musicians waiting for their cue, translocation partners don't share any obvious RNA polymerase II molecules are poised at the similarities, they all create potent leukemia-causing start site of many developmentally controlled hybrid genes. In an earlier study, Chengqi Lin, a genes, waiting for the "Go!"- signal to read their graduate student in Shilatifard's lab and first author part of the genomic symphony. An assembly of on the current study, had identified the novel Super transcription elongation factors known as Super Elongation Complex (SEC) as the common Elongation Complex, or SEC for short, helps denominator shared by all MLL-fusion proteins.
  • Duplications of Hox Gene Clusters and the Emergence of Vertebrates

    Duplications of Hox Gene Clusters and the Emergence of Vertebrates

    Developmental Biology 378 (2013) 194–199 Contents lists available at SciVerse ScienceDirect Developmental Biology journal homepage: www.elsevier.com/locate/developmentalbiology Duplications of hox gene clusters and the emergence of vertebrates Natalia Soshnikova a,b, Romain Dewaele a, Philippe Janvier c, Robb Krumlauf d,e, Denis Duboule a,f,n a Department of Genetics and Evolution, University of Geneva, Sciences III, Quai Ernest-Ansermet 30, 1211 Geneva 4, Switzerland b Institute of Molecular Biology, Ackermannweg 4, 55128 Mainz, Germany c Muséum National d’Histoire Naturelle, UMR 7207, CP38, 8, rue Buffon 75231, Paris Cedex 05, France d Stowers Institute for Medical Research, Kansas City, MO 64110, USA e Department of Anatomy and Cell Biology, Kansas University Medical Center, Kansas City, Kansas, USA f School of Life Sciences, Ecole Polytechnique Fédérale, 1015 Lausanne, Switzerland article info abstract Article history: The vertebrate body plan is characterized by an increased complexity relative to that of all other Received 6 February 2013 chordates and large-scale gene amplifications have been associated with key morphological innovations Accepted 5 March 2013 leading to their remarkable evolutionary success. Here, we use compound full Hox clusters deletions to Available online 15 March 2013 investigate how Hox genes duplications may have contributed to the emergence of vertebrate-specific Keywords: innovations. We show that the combined deletion of HoxA and HoxB leads to an atavistic heart Neo-functionalization phenotype, suggesting that the ancestral HoxA/B cluster was co-opted to help in diversifying the Genome duplication complex organ in vertebrates. Other phenotypic effects observed seem to illustrate the resurgence of 2R ancestral (plesiomorphic) features.
  • Gurdon Institute 2006 PROSPECTUS / ANNUAL REPORT 2005

    Gurdon Institute 2006 PROSPECTUS / ANNUAL REPORT 2005

    The Wellcome Trust and Cancer Research UK Gurdon Institute 2006 PROSPECTUS / ANNUAL REPORT 2005 Gurdon I N S T I T U T E PROSPECTUS 2006 ANNUAL REPORT 2005 http://www.gurdon.cam.ac.uk THE GURDON INSTITUTE 1 CONTENTS THE INSTITUTE IN 2005 CHAIRMAN’S INTRODUCTION........................................................3 HISTORICAL BACKGROUND..............................................................4 CENTRAL SUPPORT SERVICES...........................................................5 FUNDING...........................................................................................................5 RESEARCH GROUPS........................................................................6 MEMBERS OF THE INSTITUTE..............................................42 CATEGORIES OF APPOINTMENT..................................................42 POSTGRADUATE OPPORTUNITIES.............................................42 SENIOR GROUP LEADERS..................................................................42 GROUP LEADERS......................................................................................48 SUPPORT STAFF..........................................................................................53 INSTITUTE PUBLICATIONS....................................................55 OTHER INFORMATION STAFF AFFILIATIONS................................................................................62 HONOURS AND AWARDS................................................................63 EDITORIAL BOARDS OF JOURNALS...........................................63
  • The Sea Lamprey Germline Genome Provides Insights Into Programmed Genome Rearrangement and Vertebrate Evolution

    The Sea Lamprey Germline Genome Provides Insights Into Programmed Genome Rearrangement and Vertebrate Evolution

    UC Merced UC Merced Previously Published Works Title The sea lamprey germline genome provides insights into programmed genome rearrangement and vertebrate evolution. Permalink https://escholarship.org/uc/item/66r337hb Journal Nature genetics, 50(2) ISSN 1061-4036 Authors Smith, Jeramiah J Timoshevskaya, Nataliya Ye, Chengxi et al. Publication Date 2018-02-01 DOI 10.1038/s41588-017-0036-1 Peer reviewed eScholarship.org Powered by the California Digital Library University of California ARTICLES https://doi.org/10.1038/s41588-017-0036-1 The sea lamprey germline genome provides insights into programmed genome rearrangement and vertebrate evolution Jeramiah J. Smith 1*, Nataliya Timoshevskaya 1, Chengxi Ye 2, Carson Holt3, Melissa C. Keinath1, Hugo J. Parker 4, Malcolm E. Cook4, Jon E. Hess 5, Shawn R. Narum 5, Francesco Lamanna 6, Henrik Kaessmann6, Vladimir A. Timoshevskiy1, Courtney K. M. Waterbury1, Cody Saraceno1, Leanne M. Wiedemann 4,7, Sofia M. C. Robb4,8, Carl Baker9, Evan E. Eichler 9,10, Dorit Hockman11,14, Tatjana Sauka-Spengler11, Mark Yandell3, Robb Krumlauf4, Greg Elgar12 and Chris T. Amemiya13,15 The sea lamprey (Petromyzon marinus) serves as a comparative model for reconstructing vertebrate evolution. To enable more informed analyses, we developed a new assembly of the lamprey germline genome that integrates several complementary data sets. Analysis of this highly contiguous (chromosome-scale) assembly shows that both chromosomal and whole-genome dupli- cations have played significant roles in the evolution of ancestral vertebrate and lamprey genomes, including chromosomes that carry the six lamprey HOX clusters. The assembly also contains several hundred genes that are reproducibly eliminated from somatic cells during early development in lamprey.
  • An Atlas of Anterior Hox Gene Expression in the Embryonic Sea Lamprey Head: Hox-Code Evolution in Vertebrates

    An Atlas of Anterior Hox Gene Expression in the Embryonic Sea Lamprey Head: Hox-Code Evolution in Vertebrates

    bioRxiv preprint doi: https://doi.org/10.1101/571448; this version posted March 9, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. An atlas of anterior hox gene expression in the embryonic sea lamprey head: hox-code evolution in vertebrates Hugo J. Parker1, Marianne E. Bronner2 and Robb Krumlauf1,3* 1. Stowers Institute for Medical Research, Kansas City, Missouri 64110, USA 2. Division of Biology and Biological Engineering, California Institute of Technology, Pasadena, California 91125, USA 3. Department of Anatomy and Cell Biology, Kansas University Medical Center, Kansas City, Kansas 66160, USA * Corresponding author: Editorial correspondence to: Robb Krumlauf, Stowers Institute for Medical Research, 1000 E. 50th, Kansas City, MO 64110 Tel: 1-816-926-4051; Email: [email protected] Key Words: Hox expression, hindbrain segmentation, cranial neural crest, vertebrate evolution, rhombomeres, lamprey, gene regulation, axial patterning Running title: Hox code in lamprey head development bioRxiv preprint doi: https://doi.org/10.1101/571448; this version posted March 9, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract: In the hindbrain and the adjacent cranial neural crest (NC) cells of jawed vertebrates (gnathostomes), nested and segmentally-restricted domains of Hox gene expression provide a combinatorial Hox-code for specifying regional properties during head development.
  • Modeling a Hox Gene Network Stochastic Simulation with Experimental Perturbation

    Modeling a Hox Gene Network Stochastic Simulation with Experimental Perturbation

    Modeling a Hox Gene Network Stochastic Simulation with Experimental Perturbation Thesis by Jason Kastner In Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy California Institute of Technology Pasadena, California 2003 (Defended September 25, 2002) ii © 2003 Jason Kastner All Rights Reserved iii Acknowledgments Even though my name is on the title page, I am deeply indebted to a number of people, and without their help this work would not have been possible. My advisors Jerry Solomon and Scott Fraser were both instrumental in every aspect of my research, and this thesis would not have been nearly as interesting or complete without their continual guidance and help. Thanks as well to the rest of my committee, Joel Franklin, Niles Pierce, and Dan Meiron, and the funding from the Computation Molecular Biology program at Caltech, made possible by the Burroughs Wellcome fund. All of the members of the Fraser lab helped my research, but Rusty Lansford, Paul Kulesa, Helen McBride and Reinhard Koester deserve special thanks for their advice and support. At the Stowers Institute for Medical Research, thanks to Heather Marshall, Kristen Correia, and especially Robb Krumlauf, who was incredibly generous with his time and resources. My parents Victoria and George Kastner never failed to profess their belief in both my abilities and me, and for that I am forever indebted. But my deepest gratitude goes to my two closest friends, Jennifer Dooley and Tri Lindhom. They both finished their dissertations several years ago but were forced to relive it all again through me. Their constant support and encouragement through it all was invaluable.
  • How an Ancient Vertebrate Uses Familiar Tools to Build a Strange-Looking Head 14 September 2014

    How an Ancient Vertebrate Uses Familiar Tools to Build a Strange-Looking Head 14 September 2014

    How an ancient vertebrate uses familiar tools to build a strange-looking head 14 September 2014 online issue of Nature from the Stowers Institute for Medical Research shows just how humbling and exhilarating that pursuit can be. In the study, Investigator and Scientific Director Robb Krumlauf, Ph.D. and colleagues show that the sea lamprey Petromyzon marinus, a survivor of ancient jawless vertebrates, exhibits a pattern of gene expression that is reminiscent of its jawed cousins, who evolved much, much later. Those genes, called Hox genes, function like a molecular ruler, determining where along the anterior- posterior (AP) axis an animal will place a particular feature or appendage. The new study means that that the genetic program used by jawed vertebrates, including fish, mice, and us, was up and running ages before a vertebrate ever possessed a recognizable face. "Hox genes regulate a tissue's character or shape, as in head or facial features. Our work in the past has addressed how factors make unique structures, for example, what makes an arm different from a leg," says Krumlauf. "Now, we are excited by the common role that similar sets of genes play in The morphology of an adult sea lamprey (top); the creating a basic structural plan." ventral view of the unique oral disc, adapted for a parasitic lifestyle (bottom left); and a transient transgenic The team at Stowers, collaborating with Marianne lamprey embryo (bottom right). Credit: Krumlauf Lab, Bronner, Ph.D., professor of biology at Caltech, Stowers Institute for Medical Research and Bronner Lab, focused on the sea lamprey because the fossil California Institute of Technology record shows that its ancestors emerged from Cambrian silt approximately 500 million years ago, 100 million years before jawed fish ever swam onto the scene.
  • Developmental and Spatial Patterns of Expression of the Mouse Homeobox Gene, Hox2.1

    Developmental and Spatial Patterns of Expression of the Mouse Homeobox Gene, Hox2.1

    Development 99, 603-617 (1987) 603 Printed in Great Britain © The Company of Biologists Limited 1987 Developmental and spatial patterns of expression of the mouse homeobox gene, Hox2.1 ROBB KRUMLAUF*, PETER W. H. HOLLAND, JOHN H. McVEY and BRIGID L. M. HOGAN Laboratory of Molecular Embryology, National Institute for Medical Research, Mill Hill, London NW7 1AA, UK * To whom reprint requests should be sent Summary The Hox2.1 gene forms part of a cluster of homeo- liver and visceral yolk sac). Comparison of the tem- box-containing genes on mouse chromosome 11. poral patterns of gene expression during development Analysis of Hox2.1 cDNAs isolated from an 8i-day and in the adult suggests that Hox2.1 is regulated p.c. mouse embryo library predicts that the gene independently in different tissues. Evidence is also encodes a 269 amino acid protein (Mr, 29432). This presented that transcripts from other loci have exten- deduced protein contains a homeobox 15 amino acids sive homology to the Hox2.1 gene in sequences out- from the carboxy terminus and is very rich in serine side of the homeobox. In situ hybridization shows that and proline. A second partially conserved region Hox2.1 transcripts are regionally localized in the present in several other genes containing homeo- spinal cord in an apparent anterior—posterior gradi- boxes, the hexapeptide De-Phe-Pro-Trp-Met-Arg, is ent extending from the hind brain. The distribution of located 12 amino acids upstream of the homeodomain RNA also displays a cell-type specificity in the. lung, and is encoded by a separate exon.
  • Recent Advances in Understanding Vertebrate Segmentation [Version 1; Peer Review: 3 Approved]

    Recent Advances in Understanding Vertebrate Segmentation [Version 1; Peer Review: 3 Approved]

    F1000Research 2018, 7(F1000 Faculty Rev):97 Last updated: 17 JUL 2019 REVIEW Recent advances in understanding vertebrate segmentation [version 1; peer review: 3 approved] Tomás Pais-de-Azevedo1,2*, Ramiro Magno1-3*, Isabel Duarte1,2, Isabel Palmeirim 1,2,4 1Algarve Biomedical Center, Faro, Portugal 2CBMR, Centre for Biomedical Research, University of Algarve, Faro, Portugal 3Theoretical Biology and Bioinformatics, Utrecht University, Utrecht, The Netherlands 4Department of Biomedical Sciences and Medicine, University of Algarve, Faro, Portugal * Equal contributors First published: 23 Jan 2018, 7(F1000 Faculty Rev):97 ( Open Peer Review v1 https://doi.org/10.12688/f1000research.12369.1) Latest published: 23 Jan 2018, 7(F1000 Faculty Rev):97 ( https://doi.org/10.12688/f1000research.12369.1) Reviewer Status Abstract Invited Reviewers Segmentation is the partitioning of the body axis into a series of repeating 1 2 3 units or segments. This widespread body plan is found in annelids, arthropods, and chordates, showing it to be a successful developmental version 1 strategy for growing and generating diverse morphology and anatomy. published Segmentation has been extensively studied over the years. Forty years 23 Jan 2018 ago, Cooke and Zeeman published the Clock and Wavefront model, creating a theoretical framework of how developing cells could acquire and keep temporal and spatial information in order to generate a segmented F1000 Faculty Reviews are written by members of pattern. Twenty years later, in 1997, Palmeirim and co-workers found the the prestigious F1000 Faculty. They are first clock gene whose oscillatory expression pattern fitted within Cooke and commissioned and are peer reviewed before Zeeman’s model.